--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:34:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0418/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -877.07 -879.84
2 -877.08 -880.67
--------------------------------------
TOTAL -877.07 -880.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904324 0.089749 0.379435 1.524989 0.869977 1461.00 1481.00 1.000
r(A<->C){all} 0.172915 0.019747 0.000056 0.450694 0.141411 90.51 173.60 1.000
r(A<->G){all} 0.170395 0.021960 0.000043 0.465670 0.125513 261.87 276.14 1.000
r(A<->T){all} 0.172483 0.020797 0.000070 0.451718 0.134321 181.51 211.13 1.002
r(C<->G){all} 0.161814 0.018800 0.000083 0.441205 0.123614 229.91 250.56 1.002
r(C<->T){all} 0.159538 0.017372 0.000078 0.434650 0.123585 176.09 206.25 1.000
r(G<->T){all} 0.162855 0.019619 0.000148 0.452377 0.123010 238.50 308.33 1.000
pi(A){all} 0.186475 0.000224 0.156354 0.214219 0.186371 1052.07 1184.61 1.001
pi(C){all} 0.295200 0.000328 0.260363 0.329982 0.294894 1142.47 1266.16 1.000
pi(G){all} 0.308321 0.000321 0.272021 0.342139 0.308155 1113.36 1205.20 1.000
pi(T){all} 0.210004 0.000255 0.179284 0.241352 0.209552 1273.67 1339.28 1.000
alpha{1,2} 0.425301 0.222395 0.000164 1.389629 0.264454 1083.79 1203.67 1.000
alpha{3} 0.473721 0.269307 0.000113 1.506697 0.299009 1155.52 1241.14 1.001
pinvar{all} 0.997583 0.000008 0.992053 0.999999 0.998525 898.24 1122.96 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -834.903808
Model 2: PositiveSelection -834.904025
Model 0: one-ratio -834.904131
Model 7: beta -834.903808
Model 8: beta&w>1 -834.903808
Model 0 vs 1 6.459999999606225E-4
Model 2 vs 1 4.340000000411237E-4
Model 8 vs 7 0.0
>C1
LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
AENVTHWDIWoooo
>C2
LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
AENVTHWDIWoooo
>C3
LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
AENVTHWDIWoooo
>C4
LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
AENVTHWDIWoooo
>C5
VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NRLPAENVTHWDIW
>C6
VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NRLPAENVTHWDIW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=218
C1 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
C2 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
C3 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
C4 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
C5 VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
C6 VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
**********************************************
C1 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
C2 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
C3 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
C4 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
C5 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
C6 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
**************************************************
C1 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
C2 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
C3 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
C4 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
C5 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
C6 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
**************************************************
C1 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
C2 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
C3 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
C4 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
C5 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
C6 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
**************************************************
C1 NRLPAENVTHWDIWoooo
C2 NRLPAENVTHWDIWoooo
C3 NRLPAENVTHWDIWoooo
C4 NRLPAENVTHWDIWoooo
C5 NRLPAENVTHWDIW----
C6 NRLPAENVTHWDIW----
**************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6500]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6500]--->[6460]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.485 Mb, Max= 30.762 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
C2 LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
C3 LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
C4 LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
C5 LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
C6 LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWV
**************************************************
C1 FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
C2 FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
C3 FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
C4 FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
C5 FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
C6 FVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYL
**************************************************
C1 AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
C2 AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
C3 AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
C4 AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
C5 AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
C6 AEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLG
**************************************************
C1 TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
C2 TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
C3 TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
C4 TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
C5 TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
C6 TCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLP
**************************************************
C1 AENVTHWDIW
C2 AENVTHWDIW
C3 AENVTHWDIW
C4 AENVTHWDIW
C5 AENVTHWDIW
C6 AENVTHWDIW
**********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
C2 ------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
C3 ------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
C4 ------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
C5 GTGAATCTAAACTTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
C6 GTGAATCTAAACTTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
**************************************
C1 GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
C2 GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
C3 GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
C4 GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
C5 GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
C6 GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
**************************************************
C1 AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
C2 AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
C3 AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
C4 AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
C5 AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
C6 AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
**************************************************
C1 TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
C2 TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
C3 TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
C4 TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
C5 TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
C6 TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
**************************************************
C1 CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
C2 CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
C3 CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
C4 CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
C5 CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
C6 CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
**************************************************
C1 ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
C2 ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
C3 ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
C4 ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
C5 ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
C6 ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
**************************************************
C1 GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
C2 GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
C3 GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
C4 GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
C5 GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
C6 GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
**************************************************
C1 GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
C2 GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
C3 GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
C4 GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
C5 GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
C6 GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
**************************************************
C1 GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
C2 GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
C3 GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
C4 GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
C5 GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
C6 GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
**************************************************
C1 CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
C2 CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
C3 CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
C4 CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
C5 CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
C6 CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
**************************************************
C1 GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
C2 GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
C3 GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
C4 GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
C5 GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
C6 GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
**************************************************
C1 GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
C2 GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
C3 GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
C4 GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
C5 GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
C6 GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
**************************************************
C1 AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
C2 AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
C3 AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
C4 AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
C5 AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
C6 AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
******************************************
C1 ----
C2 ----
C3 ----
C4 ----
C5 ----
C6 ----
>C1
------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
----
>C2
------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
----
>C3
------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
----
>C4
------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
----
>C5
GTGAATCTAAACTTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
----
>C6
GTGAATCTAAACTTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT
GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG
AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC
TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA
CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT
ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC
GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC
GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT
GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC
CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA
GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG
GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC
AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG--------
----
>C1
ooooLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NRLPAENVTHWDIW
>C2
ooooLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NRLPAENVTHWDIW
>C3
ooooLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NRLPAENVTHWDIW
>C4
ooooLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NRLPAENVTHWDIW
>C5
VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NRLPAENVTHWDIW
>C6
VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NRLPAENVTHWDIW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 654 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579800770
Setting output file names to "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1733265260
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1985819497
Seed = 145484780
Swapseed = 1579800770
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 8 unique site patterns
Division 2 has 7 unique site patterns
Division 3 has 9 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1428.897265 -- -24.965149
Chain 2 -- -1430.967878 -- -24.965149
Chain 3 -- -1431.919418 -- -24.965149
Chain 4 -- -1429.960438 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1430.967663 -- -24.965149
Chain 2 -- -1430.967663 -- -24.965149
Chain 3 -- -1430.967663 -- -24.965149
Chain 4 -- -1430.967878 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1428.897] (-1430.968) (-1431.919) (-1429.960) * [-1430.968] (-1430.968) (-1430.968) (-1430.968)
500 -- (-884.197) [-888.697] (-892.484) (-895.581) * (-883.201) (-892.461) (-890.427) [-887.084] -- 0:00:00
1000 -- (-901.131) (-892.636) (-889.305) [-888.473] * (-884.001) (-887.999) [-891.432] (-886.033) -- 0:00:00
1500 -- [-889.444] (-886.637) (-889.515) (-881.622) * (-886.307) (-891.415) (-886.987) [-879.374] -- 0:00:00
2000 -- (-887.393) (-886.058) (-893.448) [-885.722] * (-886.633) (-883.351) (-890.040) [-879.284] -- 0:00:00
2500 -- (-887.660) (-889.650) (-892.098) [-887.377] * (-891.579) (-890.030) (-893.610) [-887.339] -- 0:00:00
3000 -- (-884.509) [-884.779] (-895.269) (-889.303) * (-890.341) (-893.544) [-890.038] (-882.105) -- 0:00:00
3500 -- [-885.156] (-882.191) (-890.076) (-885.812) * (-887.248) (-888.853) [-883.821] (-884.991) -- 0:00:00
4000 -- (-885.594) (-881.949) (-884.190) [-884.251] * (-889.878) (-886.851) (-880.765) [-888.350] -- 0:04:09
4500 -- [-889.105] (-888.355) (-897.925) (-888.372) * (-885.754) (-880.714) (-886.349) [-882.833] -- 0:03:41
5000 -- [-886.795] (-890.251) (-886.271) (-886.016) * (-884.814) (-888.259) [-889.590] (-886.517) -- 0:03:19
Average standard deviation of split frequencies: 0.067344
5500 -- (-885.441) [-887.037] (-888.409) (-888.806) * (-894.463) (-883.014) (-888.638) [-887.306] -- 0:03:00
6000 -- [-882.830] (-886.056) (-893.926) (-882.460) * (-884.760) [-889.215] (-885.680) (-882.967) -- 0:02:45
6500 -- (-887.741) [-886.404] (-886.225) (-896.030) * (-886.967) (-897.874) [-891.407] (-887.600) -- 0:02:32
7000 -- [-879.279] (-883.417) (-886.083) (-887.686) * (-885.096) [-880.353] (-899.263) (-885.556) -- 0:02:21
7500 -- [-887.608] (-884.969) (-891.356) (-890.677) * [-887.475] (-891.473) (-890.936) (-883.963) -- 0:02:12
8000 -- (-884.951) [-888.428] (-896.554) (-896.739) * (-882.463) [-884.768] (-888.169) (-887.739) -- 0:02:04
8500 -- (-887.102) (-891.507) [-892.170] (-882.120) * [-889.766] (-884.920) (-888.453) (-887.442) -- 0:01:56
9000 -- (-882.857) (-891.610) (-889.590) [-880.306] * (-890.656) (-889.511) (-894.388) [-885.968] -- 0:01:50
9500 -- (-883.297) [-888.301] (-885.447) (-880.235) * [-886.340] (-884.180) (-881.015) (-888.720) -- 0:01:44
10000 -- (-887.278) [-888.702] (-895.048) (-883.953) * (-882.679) [-885.807] (-878.419) (-887.444) -- 0:01:39
Average standard deviation of split frequencies: 0.048403
10500 -- (-886.529) [-886.800] (-884.939) (-877.476) * (-883.126) (-887.191) (-877.938) [-882.437] -- 0:01:34
11000 -- (-889.731) [-885.957] (-891.956) (-878.133) * (-885.607) (-889.154) (-877.951) [-884.230] -- 0:01:29
11500 -- (-886.964) [-881.355] (-900.409) (-878.670) * (-885.434) (-888.869) (-876.719) [-887.084] -- 0:01:25
12000 -- (-899.655) (-893.418) (-883.286) [-877.253] * [-882.468] (-885.698) (-878.061) (-894.919) -- 0:01:22
12500 -- (-890.249) (-891.624) (-881.233) [-878.464] * (-889.366) (-894.310) [-877.018] (-888.479) -- 0:01:19
13000 -- (-878.646) (-891.046) (-884.080) [-878.006] * (-892.410) (-883.339) [-876.605] (-892.326) -- 0:01:15
13500 -- (-877.166) (-881.986) [-881.841] (-878.900) * (-884.428) (-884.228) (-875.452) [-887.095] -- 0:01:13
14000 -- (-877.556) (-894.044) (-885.188) [-876.376] * (-884.086) (-888.425) [-877.023] (-884.433) -- 0:01:10
14500 -- [-877.460] (-886.847) (-893.212) (-878.041) * (-881.547) (-897.751) (-878.277) [-881.574] -- 0:01:07
15000 -- (-877.152) (-894.558) (-891.441) [-876.135] * (-882.153) (-885.337) (-877.893) [-890.056] -- 0:02:11
Average standard deviation of split frequencies: 0.055824
15500 -- (-875.673) (-885.863) (-886.775) [-876.576] * (-889.862) [-888.777] (-877.568) (-890.685) -- 0:02:07
16000 -- [-877.186] (-888.521) (-886.962) (-876.255) * (-891.599) (-889.417) (-879.509) [-884.783] -- 0:02:03
16500 -- [-876.036] (-883.784) (-893.458) (-877.308) * [-889.898] (-885.852) (-878.440) (-888.885) -- 0:01:59
17000 -- (-876.863) [-887.009] (-884.459) (-878.610) * [-884.268] (-886.475) (-877.247) (-883.923) -- 0:01:55
17500 -- [-876.842] (-886.978) (-885.266) (-882.356) * (-889.365) (-887.453) (-877.280) [-882.817] -- 0:01:52
18000 -- [-876.323] (-889.088) (-887.726) (-879.249) * (-891.630) [-893.523] (-875.887) (-888.269) -- 0:01:49
18500 -- (-878.778) [-888.370] (-891.056) (-880.653) * (-884.848) (-886.559) (-876.877) [-886.695] -- 0:01:46
19000 -- (-879.051) [-890.357] (-891.305) (-880.480) * (-893.138) (-878.958) (-876.138) [-885.215] -- 0:01:43
19500 -- (-879.160) (-886.557) [-884.156] (-882.197) * (-895.400) (-877.874) [-876.630] (-886.054) -- 0:01:40
20000 -- [-877.589] (-884.557) (-883.623) (-880.645) * (-891.610) (-878.111) (-877.459) [-892.861] -- 0:01:38
Average standard deviation of split frequencies: 0.052329
20500 -- (-876.778) (-892.144) (-889.756) [-877.482] * (-884.764) [-878.445] (-877.529) (-883.489) -- 0:01:35
21000 -- (-879.111) (-885.884) [-887.799] (-877.906) * (-888.193) (-878.769) (-884.247) [-890.375] -- 0:01:33
21500 -- [-878.087] (-887.488) (-884.452) (-877.451) * (-885.524) (-878.565) (-877.719) [-886.369] -- 0:01:31
22000 -- [-876.113] (-885.498) (-887.055) (-877.011) * (-889.311) (-877.045) [-876.829] (-886.720) -- 0:01:28
22500 -- [-875.618] (-879.385) (-892.650) (-878.696) * (-892.516) (-876.276) (-877.008) [-886.670] -- 0:01:26
23000 -- (-877.540) (-885.195) (-897.458) [-878.282] * (-883.797) [-876.576] (-878.164) (-885.820) -- 0:01:24
23500 -- [-877.936] (-885.515) (-890.846) (-877.695) * (-889.968) (-879.563) [-877.516] (-891.784) -- 0:01:23
24000 -- (-875.656) (-888.359) (-889.169) [-878.770] * (-887.293) (-876.144) (-876.682) [-885.882] -- 0:01:21
24500 -- (-877.404) (-902.404) [-890.494] (-877.481) * (-893.622) [-877.655] (-876.564) (-883.511) -- 0:01:19
25000 -- (-878.047) (-885.960) (-884.403) [-877.774] * (-896.570) [-878.199] (-878.009) (-887.560) -- 0:01:18
Average standard deviation of split frequencies: 0.043169
25500 -- (-877.980) [-883.517] (-890.840) (-878.665) * (-888.059) (-877.182) (-878.254) [-883.894] -- 0:01:16
26000 -- (-878.596) [-887.795] (-884.617) (-877.478) * (-885.804) [-877.266] (-878.038) (-886.392) -- 0:01:14
26500 -- (-877.372) (-891.525) (-891.862) [-878.130] * (-881.203) [-878.064] (-877.118) (-885.388) -- 0:01:13
27000 -- (-877.398) (-896.299) [-886.499] (-879.080) * [-878.855] (-878.559) (-881.976) (-887.328) -- 0:01:12
27500 -- (-879.576) (-897.197) [-891.285] (-876.098) * (-877.125) [-878.289] (-877.823) (-885.795) -- 0:01:10
28000 -- (-876.950) (-889.818) (-886.129) [-878.360] * (-876.538) [-881.834] (-881.067) (-883.793) -- 0:01:44
28500 -- (-877.419) (-880.641) [-886.138] (-875.664) * (-878.507) [-877.712] (-878.259) (-889.365) -- 0:01:42
29000 -- (-876.807) (-892.274) [-888.869] (-883.188) * (-879.338) (-880.723) (-879.886) [-881.197] -- 0:01:40
29500 -- (-877.666) (-885.001) [-885.082] (-879.093) * (-876.477) (-880.152) [-878.057] (-890.143) -- 0:01:38
30000 -- [-879.651] (-883.309) (-903.977) (-879.105) * (-877.691) (-882.511) (-878.525) [-890.875] -- 0:01:37
Average standard deviation of split frequencies: 0.046848
30500 -- [-879.178] (-888.637) (-878.313) (-876.304) * (-877.421) (-880.551) [-877.753] (-893.456) -- 0:01:35
31000 -- (-877.787) (-886.791) (-877.189) [-876.525] * [-877.558] (-877.632) (-882.717) (-885.702) -- 0:01:33
31500 -- (-878.424) (-888.675) [-877.946] (-879.088) * (-879.802) (-876.167) (-883.845) [-892.321] -- 0:01:32
32000 -- (-876.892) (-886.459) (-877.516) [-877.233] * (-882.515) (-877.249) [-880.341] (-891.830) -- 0:01:30
32500 -- [-877.158] (-885.609) (-878.150) (-876.306) * (-882.618) (-879.196) [-876.844] (-895.465) -- 0:01:29
33000 -- (-877.354) (-882.204) (-879.950) [-875.686] * (-876.464) [-877.116] (-880.656) (-884.499) -- 0:01:27
33500 -- (-880.040) [-878.592] (-879.638) (-875.711) * [-875.973] (-878.035) (-881.894) (-893.679) -- 0:01:26
34000 -- (-877.506) (-878.185) [-881.825] (-877.998) * (-876.152) [-877.059] (-878.458) (-893.035) -- 0:01:25
34500 -- (-877.934) (-875.715) [-878.586] (-880.285) * [-875.916] (-876.957) (-877.966) (-888.705) -- 0:01:23
35000 -- (-881.047) (-884.085) (-881.449) [-882.717] * [-877.583] (-879.525) (-877.711) (-885.338) -- 0:01:22
Average standard deviation of split frequencies: 0.047021
35500 -- [-878.769] (-880.284) (-880.824) (-882.850) * (-880.464) (-879.476) (-877.551) [-883.531] -- 0:01:21
36000 -- (-877.158) [-877.501] (-880.276) (-879.781) * (-877.118) (-877.352) [-878.364] (-888.340) -- 0:01:20
36500 -- (-877.595) [-877.861] (-878.524) (-879.328) * (-878.545) [-875.831] (-877.801) (-877.374) -- 0:01:19
37000 -- (-877.508) [-877.977] (-882.045) (-878.717) * (-876.485) [-876.766] (-875.802) (-877.426) -- 0:01:18
37500 -- [-875.786] (-877.483) (-879.659) (-880.248) * (-878.607) [-875.833] (-877.691) (-876.412) -- 0:01:17
38000 -- (-876.470) (-877.077) [-876.885] (-884.978) * (-879.315) (-876.851) [-880.327] (-876.062) -- 0:01:15
38500 -- (-878.583) (-879.595) (-877.137) [-877.950] * [-878.023] (-879.615) (-877.121) (-877.402) -- 0:01:14
39000 -- (-876.160) [-876.741] (-886.426) (-877.814) * (-877.434) (-876.309) [-879.552] (-875.768) -- 0:01:13
39500 -- (-877.108) [-876.636] (-879.640) (-876.992) * (-876.666) (-877.401) (-889.198) [-878.176] -- 0:01:12
40000 -- (-875.776) (-878.857) (-878.683) [-879.540] * [-876.666] (-876.508) (-882.432) (-878.463) -- 0:01:12
Average standard deviation of split frequencies: 0.043608
40500 -- (-877.117) (-877.152) (-887.377) [-876.515] * (-877.089) [-876.467] (-878.320) (-878.131) -- 0:01:11
41000 -- (-876.333) (-877.314) (-877.115) [-879.103] * [-878.984] (-877.258) (-878.235) (-878.729) -- 0:01:33
41500 -- [-875.809] (-877.898) (-877.601) (-876.502) * (-879.231) [-876.322] (-880.591) (-879.505) -- 0:01:32
42000 -- [-876.354] (-881.025) (-877.539) (-876.407) * [-878.060] (-878.788) (-879.919) (-880.596) -- 0:01:31
42500 -- (-879.708) [-876.989] (-877.306) (-876.045) * (-876.523) (-877.653) [-875.894] (-876.609) -- 0:01:30
43000 -- [-877.593] (-877.192) (-878.145) (-877.700) * (-879.685) (-876.538) (-875.824) [-879.805] -- 0:01:29
43500 -- [-876.931] (-878.132) (-876.992) (-878.446) * (-877.342) (-881.140) (-875.809) [-879.969] -- 0:01:27
44000 -- (-877.153) (-881.426) (-876.925) [-876.604] * (-879.461) (-881.883) [-876.030] (-878.168) -- 0:01:26
44500 -- (-879.094) (-882.371) [-876.350] (-876.679) * (-879.022) (-879.196) [-878.175] (-882.451) -- 0:01:25
45000 -- (-878.495) (-876.225) (-881.159) [-877.873] * (-878.118) (-880.510) (-876.898) [-877.337] -- 0:01:24
Average standard deviation of split frequencies: 0.036334
45500 -- [-876.482] (-879.069) (-876.659) (-875.609) * [-877.392] (-879.583) (-877.388) (-877.136) -- 0:01:23
46000 -- [-878.061] (-878.177) (-878.214) (-877.263) * (-877.557) [-880.191] (-876.468) (-876.623) -- 0:01:22
46500 -- (-881.415) [-877.827] (-876.324) (-878.205) * (-878.604) [-878.581] (-879.544) (-876.406) -- 0:01:22
47000 -- (-878.965) [-876.192] (-876.131) (-877.359) * (-879.965) (-878.244) [-876.375] (-881.245) -- 0:01:21
47500 -- (-879.825) (-878.992) (-877.565) [-878.421] * (-877.240) [-875.935] (-877.884) (-879.117) -- 0:01:20
48000 -- (-877.017) [-877.930] (-876.518) (-877.174) * (-878.768) (-875.723) [-879.627] (-880.034) -- 0:01:19
48500 -- [-877.581] (-879.568) (-876.373) (-881.421) * (-885.303) (-877.725) (-883.313) [-880.855] -- 0:01:18
49000 -- (-876.157) [-875.775] (-878.826) (-881.563) * (-876.726) (-876.976) [-879.340] (-880.032) -- 0:01:17
49500 -- (-877.741) (-877.138) (-880.615) [-881.000] * (-877.604) [-880.027] (-881.131) (-877.089) -- 0:01:16
50000 -- [-877.282] (-878.736) (-879.905) (-882.004) * (-877.223) (-880.064) [-878.067] (-885.148) -- 0:01:16
Average standard deviation of split frequencies: 0.031457
50500 -- [-876.715] (-876.707) (-879.162) (-878.323) * (-877.758) (-876.049) [-876.021] (-879.054) -- 0:01:15
51000 -- [-878.740] (-877.070) (-876.291) (-879.269) * (-878.691) (-876.494) [-875.875] (-879.890) -- 0:01:14
51500 -- (-877.542) (-876.206) [-877.477] (-875.643) * (-877.233) (-880.298) [-877.724] (-880.679) -- 0:01:13
52000 -- (-876.363) (-880.517) [-877.601] (-878.248) * [-877.135] (-879.665) (-877.154) (-879.607) -- 0:01:12
52500 -- [-878.004] (-880.557) (-876.056) (-876.790) * [-878.984] (-881.465) (-876.869) (-878.860) -- 0:01:12
53000 -- (-879.338) (-878.896) (-877.369) [-876.507] * (-877.295) (-878.016) [-876.538] (-879.539) -- 0:01:11
53500 -- (-876.551) (-877.531) [-876.918] (-877.699) * (-877.880) (-877.102) (-877.220) [-878.872] -- 0:01:10
54000 -- (-879.413) [-877.008] (-877.881) (-877.458) * [-877.356] (-876.457) (-876.174) (-879.193) -- 0:01:27
54500 -- (-879.146) (-880.008) (-877.440) [-876.433] * (-877.887) [-875.965] (-877.691) (-877.096) -- 0:01:26
55000 -- (-876.111) (-877.617) (-878.269) [-879.209] * (-877.508) [-876.294] (-877.756) (-875.986) -- 0:01:25
Average standard deviation of split frequencies: 0.026056
55500 -- (-875.853) (-877.596) (-883.856) [-878.834] * (-877.558) [-877.030] (-878.647) (-879.126) -- 0:01:25
56000 -- (-878.422) [-877.579] (-881.614) (-878.282) * [-877.399] (-876.518) (-877.454) (-878.856) -- 0:01:24
56500 -- [-878.313] (-880.951) (-881.921) (-876.320) * (-881.700) (-876.492) (-877.499) [-879.595] -- 0:01:23
57000 -- (-878.410) (-877.142) [-880.267] (-877.567) * [-876.660] (-876.297) (-877.484) (-879.497) -- 0:01:22
57500 -- (-877.563) (-876.680) [-879.809] (-878.804) * (-882.405) (-876.544) (-876.295) [-878.096] -- 0:01:21
58000 -- (-876.942) (-879.679) [-880.485] (-880.657) * [-879.865] (-878.337) (-876.399) (-877.245) -- 0:01:21
58500 -- (-880.066) (-879.827) (-878.382) [-877.795] * (-875.622) (-877.203) (-876.720) [-876.330] -- 0:01:20
59000 -- (-878.299) (-877.881) (-878.287) [-877.742] * (-879.067) (-876.146) (-879.139) [-876.764] -- 0:01:19
59500 -- (-876.813) (-880.702) [-879.570] (-876.282) * (-881.670) [-876.949] (-876.705) (-879.475) -- 0:01:19
60000 -- (-878.628) (-880.260) [-879.121] (-879.903) * (-875.956) [-879.661] (-876.640) (-876.874) -- 0:01:18
Average standard deviation of split frequencies: 0.026031
60500 -- (-880.323) [-875.910] (-877.953) (-876.076) * (-878.921) [-876.555] (-877.639) (-877.752) -- 0:01:17
61000 -- [-879.172] (-877.438) (-878.170) (-876.796) * (-882.545) [-877.120] (-884.119) (-875.976) -- 0:01:16
61500 -- (-880.012) (-880.439) (-881.927) [-877.183] * (-876.961) (-876.961) [-877.199] (-880.316) -- 0:01:16
62000 -- (-877.281) (-878.491) [-877.162] (-877.869) * (-877.246) [-877.534] (-876.918) (-878.038) -- 0:01:15
62500 -- [-879.914] (-877.833) (-878.462) (-878.138) * (-877.945) (-880.794) (-876.408) [-875.817] -- 0:01:15
63000 -- (-879.835) [-876.014] (-879.410) (-878.392) * [-875.828] (-877.627) (-877.066) (-876.308) -- 0:01:14
63500 -- (-877.812) (-876.404) (-879.480) [-877.763] * (-878.058) (-877.726) (-879.315) [-878.484] -- 0:01:13
64000 -- (-881.290) [-877.947] (-880.030) (-877.237) * (-878.536) [-876.443] (-877.619) (-878.029) -- 0:01:13
64500 -- (-880.595) (-877.344) (-878.711) [-876.993] * [-877.539] (-877.238) (-876.823) (-878.009) -- 0:01:12
65000 -- (-878.198) [-877.883] (-876.445) (-876.592) * (-878.842) [-880.606] (-878.002) (-878.230) -- 0:01:11
Average standard deviation of split frequencies: 0.025465
65500 -- (-877.716) (-878.002) [-877.670] (-877.147) * (-878.257) (-884.542) [-878.928] (-876.903) -- 0:01:11
66000 -- (-876.591) [-877.409] (-877.925) (-877.430) * [-878.873] (-880.045) (-878.946) (-876.740) -- 0:01:10
66500 -- (-877.029) (-884.240) (-877.775) [-879.112] * (-878.114) [-878.132] (-879.471) (-876.833) -- 0:01:10
67000 -- [-876.623] (-875.459) (-879.154) (-876.872) * (-876.130) [-876.145] (-879.833) (-878.233) -- 0:01:23
67500 -- (-879.677) [-875.461] (-877.297) (-877.938) * (-878.593) (-877.226) (-878.026) [-876.714] -- 0:01:22
68000 -- (-878.388) (-876.443) (-878.028) [-876.399] * (-880.178) (-878.568) (-880.944) [-875.568] -- 0:01:22
68500 -- [-879.872] (-877.038) (-878.998) (-876.212) * (-878.112) (-877.844) [-879.289] (-875.595) -- 0:01:21
69000 -- (-879.839) (-876.288) [-877.134] (-879.041) * (-877.627) [-877.003] (-885.145) (-877.189) -- 0:01:20
69500 -- (-877.987) [-875.940] (-875.906) (-880.187) * [-876.367] (-878.078) (-877.599) (-880.249) -- 0:01:20
70000 -- (-877.443) (-877.231) (-875.792) [-876.032] * (-878.170) [-875.869] (-877.978) (-883.800) -- 0:01:19
Average standard deviation of split frequencies: 0.022821
70500 -- (-877.347) [-878.827] (-876.451) (-875.832) * (-876.557) [-875.822] (-884.529) (-878.497) -- 0:01:19
71000 -- (-877.965) (-879.080) [-878.485] (-877.547) * (-881.056) (-876.640) [-884.751] (-877.557) -- 0:01:18
71500 -- [-877.250] (-877.620) (-877.075) (-879.323) * (-879.573) [-876.745] (-877.341) (-879.638) -- 0:01:17
72000 -- (-877.167) [-877.783] (-875.674) (-877.263) * (-878.282) (-877.010) (-875.964) [-877.917] -- 0:01:17
72500 -- [-876.242] (-877.206) (-876.072) (-878.408) * (-876.863) (-876.904) (-876.314) [-875.562] -- 0:01:16
73000 -- (-887.013) (-876.147) [-879.085] (-880.392) * [-875.880] (-877.787) (-880.180) (-880.376) -- 0:01:16
73500 -- (-879.564) (-876.811) [-876.977] (-878.031) * (-876.827) (-876.939) (-879.174) [-877.449] -- 0:01:15
74000 -- (-879.227) (-876.453) [-876.426] (-877.946) * (-882.397) (-879.364) (-878.941) [-876.942] -- 0:01:15
74500 -- [-877.715] (-875.644) (-876.251) (-876.993) * [-876.846] (-876.835) (-883.556) (-878.411) -- 0:01:14
75000 -- (-879.107) (-875.842) (-881.375) [-877.121] * (-880.126) (-877.231) [-877.804] (-877.004) -- 0:01:14
Average standard deviation of split frequencies: 0.022986
75500 -- (-878.435) (-877.390) [-877.816] (-876.124) * (-882.190) (-876.431) (-878.519) [-876.863] -- 0:01:13
76000 -- [-876.125] (-876.348) (-881.333) (-875.565) * (-880.868) (-879.494) [-877.011] (-877.072) -- 0:01:12
76500 -- (-877.989) [-882.819] (-881.608) (-876.142) * [-877.901] (-877.656) (-877.606) (-879.328) -- 0:01:12
77000 -- [-875.860] (-877.315) (-877.677) (-876.957) * (-878.565) (-878.289) [-876.266] (-878.723) -- 0:01:11
77500 -- [-876.426] (-876.770) (-876.009) (-882.449) * (-879.255) [-878.959] (-877.459) (-878.465) -- 0:01:11
78000 -- (-876.063) [-876.822] (-875.457) (-882.293) * (-877.004) (-876.713) [-877.802] (-878.284) -- 0:01:10
78500 -- [-880.298] (-880.063) (-879.771) (-878.515) * (-877.229) (-878.081) [-877.739] (-877.466) -- 0:01:10
79000 -- [-877.340] (-877.126) (-879.721) (-878.956) * (-877.201) [-877.661] (-877.118) (-877.187) -- 0:01:09
79500 -- [-876.136] (-875.808) (-882.887) (-877.997) * (-877.206) (-879.219) (-876.197) [-877.414] -- 0:01:09
80000 -- [-876.361] (-876.655) (-881.105) (-877.113) * (-877.574) [-876.247] (-878.946) (-879.097) -- 0:01:09
Average standard deviation of split frequencies: 0.027393
80500 -- (-881.108) (-876.745) [-879.133] (-882.505) * (-877.574) (-877.459) (-877.588) [-877.581] -- 0:01:19
81000 -- (-878.810) [-877.172] (-880.968) (-877.548) * (-876.801) (-877.201) (-876.592) [-877.838] -- 0:01:19
81500 -- [-876.799] (-877.739) (-877.709) (-877.915) * (-876.642) (-877.344) (-881.155) [-876.052] -- 0:01:18
82000 -- [-876.697] (-878.087) (-876.619) (-879.992) * (-876.990) (-880.332) [-876.893] (-876.227) -- 0:01:18
82500 -- (-878.172) (-877.428) (-880.016) [-879.271] * [-876.833] (-880.566) (-876.417) (-876.662) -- 0:01:17
83000 -- (-877.447) (-880.244) [-880.723] (-878.946) * (-878.332) [-879.207] (-877.981) (-878.109) -- 0:01:17
83500 -- [-877.936] (-879.995) (-879.345) (-877.766) * (-877.609) [-882.129] (-876.943) (-880.133) -- 0:01:16
84000 -- (-877.313) (-878.742) [-876.740] (-878.469) * (-876.953) [-878.290] (-878.199) (-880.561) -- 0:01:16
84500 -- (-877.284) (-880.349) (-878.724) [-878.516] * (-877.025) (-878.851) [-878.768] (-879.754) -- 0:01:15
85000 -- [-877.455] (-877.896) (-877.074) (-876.888) * (-876.129) (-878.316) (-880.624) [-878.672] -- 0:01:15
Average standard deviation of split frequencies: 0.024811
85500 -- (-877.774) (-877.628) [-875.539] (-875.641) * [-878.386] (-877.094) (-882.407) (-876.086) -- 0:01:14
86000 -- (-876.639) (-883.398) (-877.936) [-877.414] * (-878.649) (-875.801) (-887.583) [-880.215] -- 0:01:14
86500 -- (-877.814) (-881.648) [-876.005] (-880.417) * (-875.873) [-877.124] (-882.543) (-879.817) -- 0:01:13
87000 -- [-876.939] (-879.093) (-877.468) (-879.478) * [-880.460] (-877.996) (-877.523) (-879.797) -- 0:01:13
87500 -- (-879.016) [-881.558] (-876.310) (-881.170) * (-878.944) [-877.188] (-876.956) (-882.679) -- 0:01:13
88000 -- (-878.195) [-878.802] (-880.817) (-878.885) * (-881.609) (-876.811) [-877.162] (-882.765) -- 0:01:12
88500 -- (-882.411) (-883.324) [-879.035] (-877.039) * (-879.941) (-876.688) [-877.766] (-879.126) -- 0:01:12
89000 -- (-876.917) (-877.289) (-878.665) [-879.510] * (-878.992) (-876.993) [-877.983] (-883.392) -- 0:01:11
89500 -- (-877.082) [-876.749] (-878.237) (-878.235) * (-877.205) (-876.730) [-876.530] (-880.145) -- 0:01:11
90000 -- (-878.198) (-876.982) (-879.040) [-878.721] * [-878.602] (-876.333) (-881.060) (-882.590) -- 0:01:10
Average standard deviation of split frequencies: 0.023260
90500 -- (-878.988) [-875.649] (-877.889) (-878.441) * [-878.197] (-880.286) (-879.727) (-879.551) -- 0:01:10
91000 -- (-879.809) [-876.332] (-877.004) (-877.465) * (-880.045) (-877.495) [-875.956] (-879.568) -- 0:01:09
91500 -- [-879.132] (-877.748) (-877.515) (-876.502) * (-877.423) (-876.735) [-875.545] (-877.898) -- 0:01:09
92000 -- (-877.994) (-877.320) (-878.878) [-879.141] * (-875.932) (-878.384) (-875.924) [-880.288] -- 0:01:09
92500 -- [-876.477] (-880.232) (-877.358) (-876.563) * (-879.129) [-878.057] (-875.713) (-879.970) -- 0:01:08
93000 -- [-877.094] (-879.658) (-877.470) (-876.415) * (-875.389) (-880.124) [-877.990] (-877.229) -- 0:01:18
93500 -- (-877.151) (-877.944) [-877.865] (-875.854) * (-875.837) (-878.572) [-876.635] (-876.670) -- 0:01:17
94000 -- (-876.442) (-877.726) [-879.941] (-876.591) * [-875.441] (-877.686) (-878.917) (-876.480) -- 0:01:17
94500 -- (-876.519) (-876.756) [-877.036] (-890.844) * (-875.441) (-877.430) (-877.929) [-877.652] -- 0:01:16
95000 -- (-876.285) (-881.172) [-876.498] (-883.763) * (-877.807) (-877.144) [-877.253] (-876.969) -- 0:01:16
Average standard deviation of split frequencies: 0.025069
95500 -- [-875.877] (-878.914) (-877.144) (-881.399) * [-879.489] (-877.292) (-875.952) (-878.334) -- 0:01:15
96000 -- (-876.665) [-878.107] (-878.476) (-877.585) * (-878.564) (-877.135) [-877.812] (-878.688) -- 0:01:15
96500 -- [-877.040] (-876.417) (-875.672) (-878.321) * (-878.140) [-877.077] (-876.789) (-878.904) -- 0:01:14
97000 -- (-876.759) (-876.635) (-880.353) [-881.740] * (-877.297) (-877.329) (-876.487) [-875.685] -- 0:01:14
97500 -- (-876.306) [-877.686] (-876.953) (-878.539) * [-877.488] (-876.933) (-877.342) (-876.913) -- 0:01:14
98000 -- (-876.051) (-877.717) [-876.472] (-881.372) * (-877.217) (-878.849) (-878.757) [-875.847] -- 0:01:13
98500 -- (-876.423) [-877.878] (-878.626) (-883.660) * (-877.790) (-879.357) (-880.948) [-877.829] -- 0:01:13
99000 -- (-876.668) [-880.515] (-877.678) (-878.201) * (-879.617) (-876.311) [-877.962] (-881.998) -- 0:01:12
99500 -- [-878.051] (-879.179) (-877.538) (-878.520) * (-877.706) (-880.359) [-876.962] (-878.457) -- 0:01:12
100000 -- (-877.486) [-879.925] (-878.033) (-880.645) * (-880.609) (-881.664) (-878.327) [-877.847] -- 0:01:12
Average standard deviation of split frequencies: 0.022921
100500 -- [-877.345] (-877.667) (-876.999) (-876.089) * (-880.152) [-876.284] (-880.597) (-877.874) -- 0:01:11
101000 -- [-877.810] (-876.707) (-877.399) (-877.399) * [-876.716] (-877.929) (-877.100) (-876.571) -- 0:01:11
101500 -- (-875.883) (-878.164) [-877.019] (-878.632) * (-877.899) [-875.770] (-881.755) (-877.904) -- 0:01:10
102000 -- (-876.091) [-879.951] (-876.313) (-876.482) * [-875.780] (-877.364) (-879.031) (-880.634) -- 0:01:10
102500 -- (-877.877) [-878.596] (-877.380) (-875.973) * [-876.600] (-879.315) (-877.888) (-876.200) -- 0:01:10
103000 -- (-876.168) (-875.907) (-877.375) [-877.769] * [-875.621] (-877.359) (-876.595) (-879.444) -- 0:01:09
103500 -- (-878.903) (-878.251) [-877.615] (-876.131) * (-876.230) [-877.834] (-878.878) (-878.794) -- 0:01:09
104000 -- (-876.988) (-879.100) [-877.014] (-875.805) * (-876.250) (-880.072) [-879.535] (-880.440) -- 0:01:08
104500 -- [-878.717] (-879.279) (-880.301) (-877.294) * [-878.626] (-876.989) (-878.229) (-878.487) -- 0:01:08
105000 -- (-876.146) (-876.172) [-879.540] (-879.151) * (-878.300) (-878.509) (-877.462) [-877.818] -- 0:01:08
Average standard deviation of split frequencies: 0.022470
105500 -- [-876.622] (-879.583) (-876.437) (-876.601) * (-877.006) (-882.071) (-876.609) [-876.712] -- 0:01:07
106000 -- [-877.224] (-878.794) (-877.945) (-876.611) * (-878.687) [-878.296] (-876.849) (-877.801) -- 0:01:15
106500 -- (-878.515) (-876.818) [-876.665] (-879.359) * (-879.418) [-877.413] (-877.846) (-879.241) -- 0:01:15
107000 -- (-877.845) (-878.361) [-876.129] (-878.511) * (-876.991) (-876.812) (-877.891) [-876.669] -- 0:01:15
107500 -- [-880.316] (-879.013) (-876.082) (-878.624) * [-878.727] (-877.313) (-878.695) (-878.088) -- 0:01:14
108000 -- (-877.388) (-878.595) (-878.046) [-877.856] * (-878.307) [-876.709] (-879.074) (-878.438) -- 0:01:14
108500 -- [-876.802] (-876.607) (-877.828) (-879.024) * (-876.418) (-876.095) [-878.140] (-876.906) -- 0:01:13
109000 -- (-876.511) (-881.165) (-879.314) [-878.568] * (-876.541) [-878.072] (-875.986) (-876.549) -- 0:01:13
109500 -- [-877.616] (-879.605) (-878.242) (-880.203) * (-883.866) [-876.956] (-877.385) (-876.753) -- 0:01:13
110000 -- (-876.424) (-878.663) (-876.359) [-878.369] * [-878.563] (-876.475) (-876.985) (-875.872) -- 0:01:12
Average standard deviation of split frequencies: 0.019505
110500 -- [-877.003] (-876.565) (-877.490) (-877.371) * (-877.788) (-875.662) [-878.764] (-881.310) -- 0:01:12
111000 -- [-877.595] (-875.759) (-876.710) (-884.345) * (-878.548) (-879.185) [-880.038] (-879.668) -- 0:01:12
111500 -- (-880.305) (-882.347) [-877.901] (-877.632) * [-879.144] (-881.284) (-878.776) (-883.155) -- 0:01:11
112000 -- (-877.820) (-881.933) (-877.961) [-878.271] * [-878.667] (-878.700) (-878.301) (-879.091) -- 0:01:11
112500 -- [-878.027] (-880.123) (-876.613) (-879.167) * (-877.876) (-878.682) [-876.760] (-878.582) -- 0:01:11
113000 -- (-877.252) [-877.187] (-876.501) (-879.428) * (-877.734) [-880.641] (-878.551) (-877.970) -- 0:01:10
113500 -- (-881.245) (-878.608) (-875.562) [-876.310] * (-877.815) (-879.502) (-877.139) [-877.643] -- 0:01:10
114000 -- (-879.246) [-877.748] (-881.200) (-879.371) * (-877.332) [-877.328] (-878.048) (-877.884) -- 0:01:09
114500 -- (-880.213) [-876.661] (-877.657) (-877.710) * (-876.423) (-879.007) [-877.094] (-877.959) -- 0:01:09
115000 -- (-879.724) (-877.189) (-877.109) [-878.786] * (-878.031) (-879.223) [-876.082] (-885.172) -- 0:01:09
Average standard deviation of split frequencies: 0.020105
115500 -- [-877.390] (-875.932) (-878.914) (-878.145) * (-883.844) (-875.817) [-876.321] (-879.293) -- 0:01:08
116000 -- (-876.095) (-878.513) (-876.907) [-876.044] * (-877.983) (-877.196) (-876.320) [-875.935] -- 0:01:08
116500 -- (-884.131) (-879.511) (-879.505) [-878.415] * (-875.816) [-876.503] (-877.546) (-876.086) -- 0:01:08
117000 -- [-879.880] (-877.365) (-879.842) (-877.571) * (-876.195) (-877.787) (-876.053) [-876.552] -- 0:01:07
117500 -- [-880.030] (-877.192) (-879.103) (-876.582) * (-877.468) (-878.479) (-875.641) [-877.063] -- 0:01:07
118000 -- (-881.352) (-876.968) [-882.392] (-877.560) * [-876.958] (-881.561) (-877.386) (-877.453) -- 0:01:07
118500 -- (-880.033) (-878.056) (-877.160) [-876.701] * (-879.361) (-879.817) (-880.566) [-877.781] -- 0:01:06
119000 -- (-879.862) (-878.014) (-877.968) [-875.903] * (-875.635) [-878.025] (-880.917) (-876.969) -- 0:01:14
119500 -- (-879.758) (-880.679) (-879.326) [-877.098] * [-878.112] (-877.471) (-877.405) (-877.007) -- 0:01:13
120000 -- (-878.616) [-876.095] (-879.275) (-876.609) * (-880.552) (-876.391) [-879.119] (-876.212) -- 0:01:13
Average standard deviation of split frequencies: 0.019967
120500 -- (-884.037) (-876.348) [-880.697] (-876.957) * (-885.601) (-878.346) (-880.470) [-876.733] -- 0:01:12
121000 -- (-881.356) [-880.241] (-878.235) (-882.129) * (-880.220) (-876.147) [-876.006] (-881.946) -- 0:01:12
121500 -- [-876.214] (-879.739) (-881.273) (-880.583) * (-876.768) (-879.042) [-876.360] (-877.807) -- 0:01:12
122000 -- (-877.517) [-879.431] (-876.990) (-881.784) * (-876.846) [-879.784] (-876.355) (-882.741) -- 0:01:11
122500 -- [-877.063] (-877.442) (-880.059) (-882.506) * (-876.635) [-876.598] (-876.850) (-877.234) -- 0:01:11
123000 -- [-876.761] (-877.948) (-877.089) (-881.096) * [-879.424] (-876.436) (-878.005) (-876.383) -- 0:01:11
123500 -- (-877.009) (-878.472) [-876.372] (-875.938) * (-880.829) (-876.498) [-876.239] (-879.442) -- 0:01:10
124000 -- (-876.946) (-877.099) (-878.552) [-875.988] * (-878.645) [-880.797] (-877.677) (-878.190) -- 0:01:10
124500 -- (-879.270) (-876.955) (-877.785) [-875.971] * (-877.777) (-878.785) [-877.499] (-877.947) -- 0:01:10
125000 -- (-877.836) (-878.482) (-875.941) [-876.588] * (-878.541) (-877.422) [-878.602] (-876.810) -- 0:01:10
Average standard deviation of split frequencies: 0.019494
125500 -- (-878.345) (-878.283) (-875.490) [-878.252] * (-876.123) [-877.521] (-878.595) (-880.325) -- 0:01:09
126000 -- [-876.507] (-879.636) (-877.585) (-880.776) * (-877.745) [-876.836] (-878.637) (-878.482) -- 0:01:09
126500 -- (-876.046) [-876.643] (-877.769) (-878.345) * (-876.630) (-877.404) (-877.426) [-878.175] -- 0:01:09
127000 -- (-878.555) (-879.227) (-882.860) [-878.524] * (-878.147) (-876.876) [-879.502] (-878.219) -- 0:01:08
127500 -- [-877.839] (-880.103) (-879.579) (-877.036) * (-877.912) (-878.976) [-877.465] (-876.453) -- 0:01:08
128000 -- (-881.084) (-878.119) (-880.300) [-876.432] * (-882.048) [-876.386] (-880.619) (-877.294) -- 0:01:08
128500 -- [-878.740] (-885.415) (-881.966) (-876.865) * (-881.072) [-876.855] (-882.413) (-877.283) -- 0:01:07
129000 -- (-878.365) [-879.008] (-879.122) (-883.244) * (-878.697) (-879.074) [-879.824] (-878.781) -- 0:01:07
129500 -- (-878.618) [-875.935] (-877.751) (-877.699) * (-881.150) (-880.316) (-877.115) [-876.501] -- 0:01:07
130000 -- (-878.915) (-876.045) (-879.663) [-876.805] * (-880.661) (-877.109) (-877.233) [-877.291] -- 0:01:06
Average standard deviation of split frequencies: 0.019100
130500 -- (-878.422) [-876.742] (-877.419) (-880.893) * (-879.842) [-876.804] (-876.943) (-875.524) -- 0:01:06
131000 -- (-878.326) (-875.568) (-878.738) [-880.258] * (-876.251) (-878.742) (-877.149) [-876.012] -- 0:01:06
131500 -- (-876.950) [-876.611] (-877.435) (-881.595) * (-877.337) (-877.629) [-881.046] (-879.182) -- 0:01:06
132000 -- (-876.422) [-876.557] (-878.942) (-877.262) * [-876.503] (-877.573) (-878.817) (-877.038) -- 0:01:12
132500 -- (-876.916) [-876.622] (-879.822) (-881.051) * [-878.245] (-877.216) (-876.377) (-878.469) -- 0:01:12
133000 -- [-876.866] (-877.260) (-877.558) (-881.331) * (-877.018) [-878.417] (-876.086) (-878.246) -- 0:01:11
133500 -- [-878.476] (-878.950) (-877.549) (-882.892) * (-883.764) [-877.119] (-879.057) (-877.148) -- 0:01:11
134000 -- (-875.771) (-877.423) (-877.672) [-878.021] * (-876.395) (-875.815) [-876.083] (-878.114) -- 0:01:11
134500 -- (-875.771) [-877.794] (-877.134) (-876.946) * (-876.793) (-878.786) [-876.065] (-877.766) -- 0:01:10
135000 -- [-876.589] (-877.732) (-878.427) (-878.386) * (-876.895) (-876.303) (-877.589) [-878.638] -- 0:01:10
Average standard deviation of split frequencies: 0.018351
135500 -- (-876.422) (-878.317) (-877.294) [-880.451] * (-877.928) (-881.633) [-877.648] (-877.407) -- 0:01:10
136000 -- [-876.407] (-880.485) (-879.599) (-877.771) * (-877.496) (-877.969) [-877.977] (-876.071) -- 0:01:09
136500 -- [-877.719] (-877.343) (-878.143) (-878.215) * (-877.092) (-877.050) (-877.626) [-884.333] -- 0:01:09
137000 -- (-877.555) (-879.863) [-876.841] (-876.714) * [-875.666] (-877.092) (-878.631) (-881.322) -- 0:01:09
137500 -- (-876.441) (-879.146) [-877.750] (-877.734) * (-876.490) [-875.690] (-878.352) (-877.114) -- 0:01:09
138000 -- (-876.994) (-881.602) (-876.992) [-877.524] * (-876.160) [-878.962] (-876.847) (-879.640) -- 0:01:08
138500 -- (-877.804) (-876.187) (-875.891) [-878.210] * (-878.036) (-876.164) [-878.371] (-881.128) -- 0:01:08
139000 -- (-876.338) [-877.218] (-875.620) (-876.440) * [-882.238] (-877.700) (-879.618) (-880.960) -- 0:01:08
139500 -- (-876.005) (-878.620) [-877.945] (-877.553) * (-876.615) (-877.158) [-878.222] (-877.741) -- 0:01:07
140000 -- [-876.851] (-876.100) (-878.490) (-881.280) * (-876.521) [-877.158] (-877.737) (-878.835) -- 0:01:07
Average standard deviation of split frequencies: 0.017315
140500 -- [-875.669] (-876.428) (-880.975) (-879.677) * (-876.214) (-877.513) (-878.288) [-876.677] -- 0:01:07
141000 -- (-879.655) [-876.293] (-876.600) (-876.639) * (-882.180) (-876.223) [-877.434] (-877.541) -- 0:01:07
141500 -- (-878.690) (-876.479) (-876.982) [-876.554] * (-882.944) (-881.570) [-881.613] (-876.318) -- 0:01:06
142000 -- (-880.627) (-876.716) (-877.377) [-876.139] * (-876.880) (-877.570) (-876.066) [-876.800] -- 0:01:06
142500 -- (-877.078) (-877.945) [-876.650] (-876.054) * [-876.606] (-877.109) (-876.939) (-878.044) -- 0:01:06
143000 -- [-875.984] (-878.509) (-877.459) (-877.970) * (-876.375) [-878.542] (-877.374) (-877.826) -- 0:01:05
143500 -- (-876.663) (-876.090) [-876.502] (-876.510) * (-876.511) (-878.759) [-876.228] (-876.868) -- 0:01:05
144000 -- (-876.603) (-875.520) [-879.356] (-876.066) * (-879.641) [-876.043] (-877.830) (-877.383) -- 0:01:05
144500 -- (-876.968) (-887.208) (-875.609) [-876.577] * [-881.440] (-876.194) (-876.686) (-877.004) -- 0:01:05
145000 -- (-879.742) (-882.361) (-876.355) [-876.330] * (-880.645) (-878.243) [-879.642] (-878.343) -- 0:01:04
Average standard deviation of split frequencies: 0.018863
145500 -- (-876.443) (-884.528) (-875.936) [-876.842] * (-879.708) (-877.545) [-876.244] (-879.414) -- 0:01:10
146000 -- (-878.675) (-878.841) (-877.897) [-876.881] * [-880.416] (-876.852) (-877.330) (-884.296) -- 0:01:10
146500 -- (-877.531) [-879.750] (-877.440) (-877.328) * (-876.173) (-880.345) [-877.018] (-876.339) -- 0:01:09
147000 -- (-880.739) (-877.012) [-879.723] (-880.303) * [-877.223] (-877.103) (-876.052) (-879.250) -- 0:01:09
147500 -- (-876.739) (-879.076) [-877.896] (-879.314) * (-879.188) (-879.264) [-878.799] (-877.153) -- 0:01:09
148000 -- (-876.192) (-878.074) [-878.378] (-882.186) * (-877.827) (-880.515) [-876.113] (-876.382) -- 0:01:09
148500 -- [-876.585] (-877.096) (-876.604) (-877.002) * (-877.877) [-878.158] (-876.891) (-880.633) -- 0:01:08
149000 -- (-876.731) (-880.574) [-876.289] (-878.666) * (-878.473) (-878.659) [-877.607] (-878.877) -- 0:01:08
149500 -- (-876.460) (-875.992) (-876.277) [-879.013] * [-878.542] (-876.964) (-877.064) (-878.514) -- 0:01:08
150000 -- [-876.178] (-876.801) (-876.550) (-879.141) * (-878.667) (-876.325) [-877.229] (-878.179) -- 0:01:08
Average standard deviation of split frequencies: 0.018608
150500 -- [-876.607] (-876.207) (-877.109) (-878.406) * [-879.785] (-875.781) (-878.604) (-879.036) -- 0:01:07
151000 -- [-876.453] (-880.173) (-875.641) (-880.626) * [-876.391] (-878.130) (-876.652) (-878.723) -- 0:01:07
151500 -- [-876.288] (-881.199) (-876.021) (-879.950) * [-878.199] (-878.715) (-877.409) (-880.332) -- 0:01:07
152000 -- (-877.336) (-878.412) (-879.677) [-879.759] * (-877.769) (-876.235) [-875.853] (-878.250) -- 0:01:06
152500 -- (-879.927) (-879.671) (-877.290) [-878.219] * (-877.383) (-878.441) [-877.412] (-877.123) -- 0:01:06
153000 -- (-878.508) [-877.843] (-876.989) (-878.293) * (-880.884) [-880.443] (-876.447) (-877.371) -- 0:01:06
153500 -- (-876.929) (-879.349) [-875.899] (-877.043) * (-879.454) (-875.951) [-876.813] (-879.449) -- 0:01:06
154000 -- (-875.986) [-878.407] (-877.437) (-878.761) * (-876.515) (-875.963) [-878.862] (-878.286) -- 0:01:05
154500 -- (-878.841) (-878.076) [-876.317] (-880.924) * (-879.288) [-876.959] (-876.294) (-881.973) -- 0:01:05
155000 -- (-879.670) (-876.345) [-876.225] (-879.694) * (-878.117) (-878.066) (-877.774) [-877.256] -- 0:01:05
Average standard deviation of split frequencies: 0.019810
155500 -- (-877.286) (-878.181) (-880.231) [-880.222] * (-878.688) [-878.071] (-879.153) (-880.171) -- 0:01:05
156000 -- [-880.490] (-877.617) (-879.527) (-882.387) * [-876.897] (-879.226) (-877.997) (-877.896) -- 0:01:04
156500 -- (-880.969) (-877.233) [-877.223] (-878.631) * (-875.655) [-878.290] (-876.882) (-877.625) -- 0:01:04
157000 -- (-878.301) (-878.544) [-879.015] (-881.062) * [-877.579] (-883.256) (-877.837) (-877.806) -- 0:01:04
157500 -- [-876.362] (-876.521) (-877.857) (-882.523) * (-878.551) (-878.353) (-877.510) [-879.215] -- 0:01:04
158000 -- (-876.892) (-876.534) [-882.416] (-878.876) * (-878.822) (-877.622) [-877.918] (-882.072) -- 0:01:03
158500 -- (-877.778) (-876.333) [-879.508] (-881.804) * (-883.776) [-875.623] (-876.663) (-877.948) -- 0:01:09
159000 -- (-876.697) [-876.304] (-876.947) (-880.033) * (-882.120) (-878.238) [-877.234] (-877.869) -- 0:01:08
159500 -- (-878.236) (-875.954) [-876.326] (-877.323) * (-876.552) [-877.199] (-876.419) (-880.040) -- 0:01:08
160000 -- (-880.608) (-878.091) [-876.611] (-878.085) * (-877.331) [-875.613] (-875.855) (-881.416) -- 0:01:08
Average standard deviation of split frequencies: 0.018908
160500 -- (-877.933) (-883.589) (-876.668) [-878.209] * (-880.230) [-875.774] (-875.751) (-880.081) -- 0:01:07
161000 -- (-876.068) (-880.855) [-877.776] (-877.424) * (-879.102) (-877.499) [-875.805] (-876.604) -- 0:01:07
161500 -- (-875.950) (-880.685) (-878.913) [-880.050] * (-878.035) (-880.024) (-878.248) [-878.227] -- 0:01:07
162000 -- [-877.580] (-880.693) (-878.987) (-879.605) * (-877.056) [-877.441] (-879.168) (-880.715) -- 0:01:07
162500 -- (-876.145) (-879.502) [-879.876] (-879.529) * [-876.588] (-876.928) (-879.558) (-880.321) -- 0:01:07
163000 -- (-879.128) [-878.045] (-879.382) (-878.234) * (-877.126) (-877.271) (-877.549) [-876.958] -- 0:01:06
163500 -- (-879.149) [-879.613] (-880.409) (-881.973) * (-878.785) (-877.205) [-875.984] (-877.650) -- 0:01:06
164000 -- [-878.402] (-882.952) (-880.161) (-879.468) * (-881.066) (-876.341) (-880.137) [-877.673] -- 0:01:06
164500 -- (-875.549) (-878.043) (-877.878) [-878.113] * (-879.939) (-876.889) [-877.991] (-879.444) -- 0:01:06
165000 -- (-882.507) (-879.466) [-876.746] (-879.433) * (-877.446) (-878.318) (-876.973) [-880.259] -- 0:01:05
Average standard deviation of split frequencies: 0.019090
165500 -- (-878.414) (-878.505) [-880.590] (-880.528) * (-877.486) [-876.584] (-881.357) (-877.453) -- 0:01:05
166000 -- (-876.527) (-876.062) (-876.810) [-879.037] * [-876.662] (-876.928) (-876.532) (-876.471) -- 0:01:05
166500 -- (-877.295) (-877.934) (-876.214) [-877.872] * (-880.052) (-880.566) [-876.913] (-877.185) -- 0:01:05
167000 -- (-878.145) (-877.985) (-877.960) [-879.228] * (-876.354) (-881.758) (-877.995) [-877.921] -- 0:01:04
167500 -- (-878.143) (-878.367) [-883.284] (-877.164) * (-878.654) (-878.249) (-879.280) [-878.938] -- 0:01:04
168000 -- (-878.740) [-879.075] (-877.237) (-877.200) * (-876.657) (-879.494) (-880.109) [-878.855] -- 0:01:04
168500 -- [-877.468] (-877.938) (-877.981) (-876.986) * [-876.154] (-878.771) (-880.321) (-876.096) -- 0:01:04
169000 -- (-879.660) (-877.304) (-878.452) [-877.139] * (-879.986) [-881.376] (-876.940) (-876.131) -- 0:01:03
169500 -- (-877.010) [-876.600] (-883.868) (-878.848) * [-878.294] (-876.202) (-877.204) (-876.299) -- 0:01:03
170000 -- (-877.010) (-876.342) (-876.201) [-877.560] * (-878.049) (-879.071) [-877.319] (-876.617) -- 0:01:03
Average standard deviation of split frequencies: 0.019335
170500 -- (-880.244) (-877.880) (-875.629) [-877.241] * (-878.145) (-878.627) (-876.621) [-877.026] -- 0:01:03
171000 -- (-878.924) (-877.862) [-876.507] (-876.274) * (-880.584) (-878.859) (-875.853) [-877.850] -- 0:01:03
171500 -- (-878.270) (-878.675) [-877.509] (-882.268) * [-876.915] (-878.859) (-881.206) (-876.233) -- 0:01:07
172000 -- [-877.981] (-876.480) (-876.616) (-880.757) * (-879.216) (-878.424) [-879.102] (-876.393) -- 0:01:07
172500 -- (-875.919) (-877.486) (-878.214) [-877.513] * (-880.161) [-876.987] (-880.483) (-876.191) -- 0:01:07
173000 -- [-876.592] (-876.778) (-878.100) (-877.311) * [-879.635] (-876.966) (-880.665) (-877.502) -- 0:01:06
173500 -- [-876.036] (-878.384) (-880.667) (-879.895) * [-877.412] (-875.842) (-877.297) (-878.928) -- 0:01:06
174000 -- (-876.371) [-877.266] (-878.299) (-877.284) * (-877.432) [-878.669] (-879.908) (-878.267) -- 0:01:06
174500 -- (-877.252) [-875.830] (-876.649) (-878.673) * (-877.807) [-878.249] (-878.479) (-875.934) -- 0:01:06
175000 -- (-878.372) [-876.123] (-876.498) (-878.911) * (-876.636) (-876.682) [-878.028] (-877.798) -- 0:01:06
Average standard deviation of split frequencies: 0.016740
175500 -- (-878.198) (-876.499) [-877.175] (-878.777) * (-877.521) [-877.386] (-881.940) (-877.938) -- 0:01:05
176000 -- (-877.345) [-876.114] (-877.883) (-877.628) * [-880.346] (-877.982) (-881.308) (-879.505) -- 0:01:05
176500 -- [-880.769] (-875.872) (-876.492) (-877.962) * (-876.049) (-875.762) (-879.168) [-880.414] -- 0:01:05
177000 -- [-879.866] (-876.610) (-877.317) (-877.859) * (-878.067) (-876.599) (-877.523) [-876.678] -- 0:01:05
177500 -- (-878.864) [-876.617] (-876.644) (-877.323) * [-878.956] (-882.837) (-877.506) (-880.357) -- 0:01:04
178000 -- (-877.300) (-876.187) (-878.622) [-877.127] * (-877.508) (-877.753) [-875.995] (-879.281) -- 0:01:04
178500 -- [-876.784] (-883.280) (-880.816) (-876.514) * [-878.333] (-876.819) (-878.228) (-877.297) -- 0:01:04
179000 -- (-876.267) [-878.511] (-879.757) (-877.087) * (-880.357) [-876.237] (-879.974) (-878.266) -- 0:01:04
179500 -- (-877.329) (-877.972) (-878.546) [-879.373] * (-877.252) [-877.506] (-883.258) (-877.050) -- 0:01:03
180000 -- (-876.737) (-879.639) (-881.160) [-876.428] * (-877.867) [-879.826] (-877.009) (-876.650) -- 0:01:03
Average standard deviation of split frequencies: 0.014677
180500 -- (-877.824) (-876.381) (-880.720) [-877.382] * (-878.315) [-877.939] (-880.114) (-878.207) -- 0:01:03
181000 -- (-877.101) [-877.463] (-878.092) (-880.320) * (-877.146) (-877.113) [-877.310] (-878.472) -- 0:01:03
181500 -- (-881.906) (-878.746) (-877.949) [-878.682] * (-879.449) [-877.117] (-877.102) (-878.385) -- 0:01:03
182000 -- [-878.223] (-876.424) (-878.935) (-877.065) * (-878.516) [-876.174] (-877.951) (-878.656) -- 0:01:02
182500 -- (-879.202) [-879.948] (-881.373) (-878.818) * (-880.716) [-876.972] (-878.154) (-880.129) -- 0:01:02
183000 -- [-878.086] (-879.982) (-878.923) (-876.029) * [-881.294] (-877.166) (-877.779) (-877.672) -- 0:01:02
183500 -- (-879.707) [-882.063] (-877.522) (-876.753) * (-881.415) [-877.818] (-876.874) (-876.930) -- 0:01:02
184000 -- (-876.742) (-876.441) (-878.392) [-875.664] * (-882.040) (-882.539) (-878.178) [-876.566] -- 0:01:02
184500 -- [-876.843] (-876.408) (-880.774) (-879.886) * [-878.745] (-876.848) (-875.561) (-878.255) -- 0:01:06
185000 -- [-877.420] (-878.774) (-878.831) (-880.189) * (-877.388) (-878.913) (-878.538) [-878.257] -- 0:01:06
Average standard deviation of split frequencies: 0.013716
185500 -- (-877.117) (-876.728) [-877.111] (-877.838) * (-881.199) (-879.006) [-876.479] (-881.083) -- 0:01:05
186000 -- [-876.273] (-879.454) (-877.204) (-876.579) * (-877.214) (-878.289) (-876.390) [-881.160] -- 0:01:05
186500 -- [-876.630] (-877.328) (-878.002) (-878.556) * (-876.145) (-879.996) (-878.151) [-877.906] -- 0:01:05
187000 -- (-876.765) (-877.623) [-878.222] (-878.809) * (-877.355) [-876.779] (-878.883) (-878.587) -- 0:01:05
187500 -- (-879.748) [-875.793] (-876.775) (-878.073) * (-879.171) (-879.801) [-878.815] (-877.581) -- 0:01:05
188000 -- (-881.002) (-875.841) (-876.801) [-879.747] * (-878.371) [-878.243] (-877.622) (-876.070) -- 0:01:04
188500 -- (-880.257) (-875.624) [-878.482] (-877.273) * (-879.900) (-877.004) [-877.700] (-878.847) -- 0:01:04
189000 -- (-878.000) (-879.928) [-877.679] (-876.599) * (-877.688) (-876.370) (-878.378) [-878.561] -- 0:01:04
189500 -- (-878.654) (-876.885) (-876.897) [-878.601] * [-877.422] (-876.152) (-882.779) (-877.835) -- 0:01:04
190000 -- (-879.107) (-877.582) [-877.178] (-877.567) * (-876.538) (-876.298) (-878.798) [-876.246] -- 0:01:03
Average standard deviation of split frequencies: 0.011489
190500 -- (-877.280) (-877.025) [-876.120] (-879.291) * (-875.830) [-876.336] (-877.670) (-876.686) -- 0:01:03
191000 -- (-876.369) [-876.232] (-880.795) (-878.780) * [-877.603] (-877.619) (-877.446) (-876.991) -- 0:01:03
191500 -- (-878.840) (-876.605) (-881.302) [-876.388] * [-876.996] (-877.869) (-877.734) (-876.138) -- 0:01:03
192000 -- [-879.493] (-875.653) (-879.221) (-880.275) * [-878.766] (-882.610) (-879.226) (-876.496) -- 0:01:03
192500 -- (-878.411) (-875.636) [-876.001] (-879.137) * (-880.329) (-879.611) [-879.378] (-877.172) -- 0:01:02
193000 -- (-879.585) (-876.572) [-879.297] (-877.353) * (-876.971) [-881.935] (-877.171) (-878.705) -- 0:01:02
193500 -- (-880.643) (-876.986) [-878.474] (-879.137) * [-879.979] (-877.298) (-877.809) (-878.277) -- 0:01:02
194000 -- [-877.905] (-878.562) (-877.909) (-877.203) * (-876.565) (-877.634) [-875.673] (-878.299) -- 0:01:02
194500 -- (-878.850) (-879.465) (-876.579) [-877.113] * (-877.226) (-881.238) (-877.585) [-876.513] -- 0:01:02
195000 -- [-877.759] (-877.387) (-878.252) (-876.034) * (-880.027) (-879.655) (-877.948) [-876.676] -- 0:01:01
Average standard deviation of split frequencies: 0.010673
195500 -- (-877.658) [-877.831] (-879.517) (-878.123) * (-884.166) (-876.422) (-878.577) [-878.257] -- 0:01:01
196000 -- (-878.356) (-879.316) (-876.263) [-876.247] * [-879.813] (-876.876) (-877.311) (-880.767) -- 0:01:01
196500 -- (-878.857) (-876.846) (-878.156) [-878.447] * [-875.883] (-876.978) (-876.368) (-880.762) -- 0:01:01
197000 -- [-877.342] (-877.220) (-876.608) (-881.582) * [-876.895] (-879.050) (-876.098) (-879.526) -- 0:01:01
197500 -- [-876.690] (-878.375) (-878.025) (-883.246) * (-879.404) [-879.599] (-877.351) (-876.737) -- 0:01:05
198000 -- [-878.046] (-878.300) (-877.187) (-876.911) * (-877.079) (-879.068) [-875.840] (-877.946) -- 0:01:04
198500 -- [-876.417] (-877.130) (-876.785) (-877.244) * [-877.422] (-876.316) (-880.508) (-879.302) -- 0:01:04
199000 -- (-882.499) [-879.252] (-878.685) (-875.788) * (-880.348) [-878.887] (-881.562) (-880.203) -- 0:01:04
199500 -- (-878.096) [-879.896] (-878.639) (-875.816) * (-880.472) (-879.328) (-877.149) [-877.563] -- 0:01:04
200000 -- (-877.628) (-878.888) (-883.694) [-876.455] * (-882.456) [-877.115] (-875.948) (-879.153) -- 0:01:04
Average standard deviation of split frequencies: 0.009837
200500 -- (-879.374) (-877.323) [-877.073] (-883.027) * (-880.366) [-884.828] (-878.148) (-876.568) -- 0:01:03
201000 -- (-880.360) [-876.253] (-880.194) (-877.747) * (-879.201) [-878.817] (-877.445) (-883.352) -- 0:01:03
201500 -- (-882.640) [-876.879] (-876.365) (-876.454) * (-882.252) (-876.665) (-877.852) [-877.737] -- 0:01:03
202000 -- (-878.855) (-878.410) (-876.796) [-876.930] * [-879.396] (-877.123) (-879.393) (-877.184) -- 0:01:03
202500 -- (-877.467) (-876.429) [-877.151] (-879.824) * (-878.787) [-876.431] (-880.115) (-878.796) -- 0:01:03
203000 -- (-877.374) (-876.504) (-876.538) [-876.455] * (-876.270) (-878.276) (-878.357) [-877.730] -- 0:01:02
203500 -- (-875.772) (-876.644) [-878.804] (-878.880) * (-877.039) [-881.076] (-879.251) (-879.777) -- 0:01:02
204000 -- [-876.212] (-876.569) (-876.302) (-877.315) * (-879.317) (-875.907) (-878.790) [-876.540] -- 0:01:02
204500 -- (-878.870) [-877.081] (-877.110) (-877.257) * (-875.489) [-880.992] (-883.393) (-877.945) -- 0:01:02
205000 -- (-877.740) (-876.281) [-878.272] (-877.922) * (-878.873) (-877.514) (-876.955) [-878.139] -- 0:01:02
Average standard deviation of split frequencies: 0.010552
205500 -- (-878.475) (-876.437) (-880.842) [-876.889] * (-878.590) (-881.545) [-875.953] (-878.105) -- 0:01:01
206000 -- (-876.574) (-876.822) (-876.355) [-876.247] * [-876.983] (-880.260) (-876.441) (-877.431) -- 0:01:01
206500 -- [-876.668] (-877.310) (-876.885) (-881.875) * (-875.891) (-876.196) [-877.680] (-877.871) -- 0:01:01
207000 -- [-877.408] (-877.596) (-879.073) (-879.177) * (-877.283) (-877.164) (-876.199) [-880.216] -- 0:01:01
207500 -- [-876.220] (-878.513) (-877.488) (-878.709) * (-877.453) [-877.536] (-876.693) (-882.085) -- 0:01:01
208000 -- (-877.309) [-876.086] (-881.589) (-880.115) * (-881.537) [-877.000] (-879.556) (-878.029) -- 0:01:00
208500 -- (-877.266) [-876.522] (-878.828) (-879.904) * (-877.997) [-877.388] (-878.246) (-881.509) -- 0:01:00
209000 -- (-875.948) [-877.892] (-876.489) (-880.485) * [-878.453] (-877.588) (-876.508) (-879.756) -- 0:01:00
209500 -- [-876.508] (-887.297) (-879.684) (-876.304) * (-875.566) (-876.236) [-880.030] (-884.284) -- 0:01:00
210000 -- [-877.614] (-880.540) (-879.242) (-880.209) * (-878.058) (-875.492) [-876.592] (-884.627) -- 0:01:00
Average standard deviation of split frequencies: 0.009477
210500 -- [-878.669] (-877.614) (-879.192) (-879.658) * (-877.451) [-876.052] (-876.496) (-878.176) -- 0:01:03
211000 -- (-883.197) [-877.693] (-877.842) (-876.921) * (-878.181) (-876.434) [-878.383] (-877.283) -- 0:01:03
211500 -- (-878.320) [-877.378] (-879.439) (-880.209) * (-878.681) (-879.263) (-879.600) [-875.525] -- 0:01:03
212000 -- (-877.591) [-876.666] (-879.990) (-876.695) * (-881.690) (-880.915) [-880.054] (-878.334) -- 0:01:03
212500 -- (-878.669) (-876.499) [-877.135] (-877.317) * [-876.658] (-878.458) (-878.969) (-878.809) -- 0:01:03
213000 -- (-881.153) (-881.576) (-878.562) [-876.134] * (-880.700) (-877.845) (-878.233) [-882.285] -- 0:01:02
213500 -- [-877.621] (-878.156) (-878.766) (-878.155) * (-875.618) (-877.754) [-879.838] (-877.570) -- 0:01:02
214000 -- (-877.126) (-881.141) [-876.990] (-876.975) * (-878.235) (-876.205) [-879.025] (-885.970) -- 0:01:02
214500 -- (-877.097) [-876.901] (-878.689) (-877.398) * (-877.164) [-878.863] (-879.214) (-878.027) -- 0:01:02
215000 -- (-877.750) [-877.152] (-879.301) (-876.940) * (-878.240) (-876.120) [-879.097] (-876.536) -- 0:01:02
Average standard deviation of split frequencies: 0.009372
215500 -- (-877.413) (-875.558) [-881.080] (-877.421) * (-877.837) (-876.478) (-877.317) [-875.788] -- 0:01:01
216000 -- (-876.135) [-875.852] (-877.563) (-876.494) * (-876.820) [-876.818] (-876.045) (-878.644) -- 0:01:01
216500 -- [-876.938] (-877.666) (-881.179) (-878.565) * (-876.522) (-880.692) [-878.854] (-879.199) -- 0:01:01
217000 -- (-877.960) (-876.941) (-878.226) [-882.267] * (-876.471) [-877.128] (-877.746) (-879.774) -- 0:01:01
217500 -- (-877.669) [-878.512] (-876.808) (-883.987) * (-875.803) (-878.322) (-877.879) [-880.309] -- 0:01:01
218000 -- (-877.832) (-880.324) [-876.711] (-878.193) * [-875.818] (-879.486) (-876.858) (-876.391) -- 0:01:00
218500 -- (-877.926) [-880.251] (-875.771) (-876.949) * [-876.823] (-877.732) (-875.788) (-877.428) -- 0:01:00
219000 -- (-877.622) [-880.403] (-876.416) (-883.327) * (-876.490) (-879.404) [-877.328] (-878.980) -- 0:01:00
219500 -- (-876.542) (-878.387) (-878.996) [-877.986] * (-876.868) (-878.706) (-878.497) [-878.515] -- 0:01:00
220000 -- (-878.024) [-876.784] (-879.328) (-877.535) * [-879.159] (-877.361) (-876.269) (-876.203) -- 0:01:00
Average standard deviation of split frequencies: 0.008189
220500 -- (-877.343) (-879.082) [-876.994] (-876.997) * [-876.791] (-878.155) (-879.844) (-878.709) -- 0:01:00
221000 -- (-877.935) (-879.999) [-877.859] (-878.564) * (-876.980) (-879.221) [-877.277] (-877.805) -- 0:00:59
221500 -- (-877.255) (-881.127) (-879.199) [-877.972] * (-876.133) (-878.765) [-879.720] (-878.632) -- 0:00:59
222000 -- [-876.904] (-879.317) (-876.793) (-876.238) * (-876.326) (-882.762) (-877.307) [-877.780] -- 0:00:59
222500 -- [-876.712] (-876.067) (-880.353) (-878.069) * [-875.945] (-877.589) (-881.577) (-876.523) -- 0:00:59
223000 -- [-877.498] (-877.049) (-881.115) (-878.970) * (-875.979) [-878.062] (-876.638) (-877.349) -- 0:00:59
223500 -- (-875.823) [-877.156] (-878.958) (-877.704) * [-883.278] (-878.953) (-876.037) (-878.077) -- 0:01:02
224000 -- [-875.840] (-878.221) (-878.236) (-876.631) * (-877.765) [-876.783] (-876.868) (-879.851) -- 0:01:02
224500 -- (-878.712) [-876.673] (-878.314) (-876.866) * (-878.288) [-877.731] (-876.518) (-877.894) -- 0:01:02
225000 -- (-880.730) [-876.158] (-876.178) (-876.990) * (-881.264) (-876.663) [-876.791] (-877.498) -- 0:01:02
Average standard deviation of split frequencies: 0.008834
225500 -- [-877.708] (-877.152) (-876.252) (-880.251) * (-877.503) (-876.737) [-876.737] (-878.983) -- 0:01:01
226000 -- (-881.117) [-879.136] (-876.085) (-879.389) * (-880.341) (-876.802) [-878.939] (-877.736) -- 0:01:01
226500 -- (-879.356) (-879.029) (-881.420) [-877.949] * (-882.558) [-876.838] (-876.034) (-880.088) -- 0:01:01
227000 -- (-876.323) (-878.111) [-885.150] (-878.286) * (-879.637) [-875.758] (-876.065) (-878.139) -- 0:01:01
227500 -- (-878.663) (-882.780) (-885.389) [-877.993] * (-876.978) (-875.555) [-878.170] (-877.995) -- 0:01:01
228000 -- (-880.874) (-876.704) [-879.625] (-877.688) * [-876.500] (-876.385) (-880.260) (-880.987) -- 0:01:00
228500 -- [-878.454] (-878.925) (-877.725) (-877.513) * [-876.375] (-878.689) (-878.377) (-877.891) -- 0:01:00
229000 -- (-879.058) [-878.317] (-877.819) (-881.222) * (-878.284) (-877.610) (-876.001) [-876.771] -- 0:01:00
229500 -- (-878.769) [-876.276] (-878.440) (-876.572) * (-877.789) (-875.627) (-878.011) [-878.247] -- 0:01:00
230000 -- [-877.952] (-879.056) (-878.168) (-878.888) * (-878.013) (-880.134) (-876.990) [-877.586] -- 0:01:00
Average standard deviation of split frequencies: 0.008656
230500 -- (-880.119) (-877.724) [-876.580] (-878.504) * [-878.301] (-877.483) (-875.918) (-877.248) -- 0:01:00
231000 -- [-877.626] (-877.165) (-876.209) (-877.409) * (-877.363) (-877.127) [-875.531] (-879.250) -- 0:00:59
231500 -- (-875.815) (-877.200) (-876.735) [-875.983] * (-878.197) [-879.474] (-878.441) (-880.659) -- 0:00:59
232000 -- (-877.642) (-878.699) (-877.650) [-876.717] * (-877.111) [-878.424] (-878.179) (-878.480) -- 0:00:59
232500 -- (-878.286) [-876.769] (-877.921) (-878.904) * [-877.230] (-880.154) (-879.309) (-876.225) -- 0:00:59
233000 -- [-878.211] (-877.445) (-878.941) (-876.861) * (-876.337) [-876.920] (-877.372) (-876.029) -- 0:00:59
233500 -- (-878.472) [-877.896] (-878.179) (-882.631) * (-877.425) [-881.420] (-879.130) (-875.930) -- 0:00:59
234000 -- (-876.116) [-876.620] (-877.373) (-877.203) * (-880.334) (-877.081) [-877.879] (-876.590) -- 0:00:58
234500 -- (-876.598) [-877.028] (-876.861) (-880.283) * (-878.150) [-877.072] (-880.490) (-877.657) -- 0:00:58
235000 -- [-877.247] (-877.804) (-878.191) (-876.017) * (-877.189) (-881.607) (-879.191) [-877.246] -- 0:00:58
Average standard deviation of split frequencies: 0.009544
235500 -- [-879.552] (-881.222) (-878.267) (-877.951) * (-877.863) (-882.770) (-878.397) [-877.371] -- 0:00:58
236000 -- (-879.379) (-880.542) [-877.031] (-883.684) * [-876.985] (-882.041) (-876.741) (-879.540) -- 0:01:01
236500 -- (-879.107) (-877.282) [-879.129] (-876.624) * [-876.784] (-877.007) (-879.612) (-882.375) -- 0:01:01
237000 -- (-879.934) (-877.745) [-878.150] (-877.024) * (-877.959) [-876.677] (-878.055) (-877.822) -- 0:01:01
237500 -- (-877.276) [-876.129] (-876.988) (-878.749) * (-877.292) (-879.187) (-877.413) [-879.010] -- 0:01:01
238000 -- [-876.442] (-879.280) (-877.232) (-880.084) * [-879.371] (-881.202) (-877.668) (-877.752) -- 0:01:00
238500 -- (-877.173) [-877.694] (-877.232) (-882.493) * (-877.072) (-881.185) [-877.735] (-879.071) -- 0:01:00
239000 -- [-878.492] (-878.168) (-876.330) (-876.383) * [-876.582] (-879.719) (-877.747) (-875.906) -- 0:01:00
239500 -- [-879.185] (-878.662) (-880.822) (-878.250) * (-877.543) (-883.742) (-882.104) [-880.781] -- 0:01:00
240000 -- (-882.485) (-878.992) (-880.167) [-876.089] * (-881.183) (-879.084) [-875.716] (-877.248) -- 0:01:00
Average standard deviation of split frequencies: 0.010255
240500 -- (-877.789) [-877.869] (-877.058) (-878.970) * (-878.100) (-878.907) [-876.310] (-879.597) -- 0:01:00
241000 -- (-879.013) (-877.436) (-877.787) [-877.976] * (-875.867) (-878.940) (-877.885) [-878.064] -- 0:00:59
241500 -- (-878.380) (-878.103) (-877.761) [-876.558] * (-875.870) [-878.510] (-878.720) (-879.895) -- 0:00:59
242000 -- (-877.287) [-879.560] (-878.939) (-878.293) * (-881.558) (-878.367) (-876.683) [-876.831] -- 0:00:59
242500 -- (-877.426) (-879.252) (-878.850) [-875.802] * [-878.413] (-880.185) (-880.577) (-875.899) -- 0:00:59
243000 -- (-877.482) [-885.216] (-880.796) (-879.871) * (-882.863) (-881.777) (-885.273) [-882.806] -- 0:00:59
243500 -- (-876.603) (-881.166) (-879.927) [-878.302] * (-882.498) [-879.831] (-877.733) (-876.163) -- 0:00:59
244000 -- (-876.961) (-884.305) (-878.322) [-880.540] * (-876.973) (-883.035) (-878.917) [-880.762] -- 0:00:58
244500 -- [-876.353] (-876.577) (-880.523) (-876.780) * [-877.429] (-876.672) (-876.658) (-877.095) -- 0:00:58
245000 -- (-876.546) (-877.882) (-881.358) [-881.125] * (-877.615) (-878.643) (-879.166) [-876.720] -- 0:00:58
Average standard deviation of split frequencies: 0.010590
245500 -- [-876.813] (-876.704) (-881.086) (-877.596) * (-880.640) (-878.364) (-876.372) [-879.278] -- 0:00:58
246000 -- (-878.642) [-876.568] (-880.824) (-877.307) * [-879.029] (-879.021) (-875.750) (-877.315) -- 0:00:58
246500 -- (-880.359) [-876.108] (-877.564) (-877.354) * (-880.435) [-878.766] (-876.082) (-878.733) -- 0:00:58
247000 -- (-886.957) (-876.979) [-876.422] (-878.306) * (-877.764) (-878.026) [-876.646] (-880.457) -- 0:00:57
247500 -- (-879.330) [-876.576] (-879.337) (-876.943) * (-878.066) (-878.211) (-878.523) [-879.469] -- 0:00:57
248000 -- [-881.964] (-875.695) (-876.001) (-876.070) * (-877.228) (-875.760) (-875.904) [-876.704] -- 0:00:57
248500 -- [-876.213] (-877.807) (-876.829) (-877.077) * (-878.055) [-876.014] (-878.653) (-878.932) -- 0:00:57
249000 -- (-877.822) (-877.359) [-877.595] (-875.682) * (-882.063) (-877.665) [-877.302] (-880.408) -- 0:01:00
249500 -- (-875.628) [-878.020] (-878.423) (-878.983) * (-878.673) (-877.753) (-877.845) [-878.040] -- 0:01:00
250000 -- (-876.089) [-878.399] (-876.711) (-879.547) * (-877.591) (-876.986) [-876.616] (-878.839) -- 0:01:00
Average standard deviation of split frequencies: 0.010866
250500 -- (-877.212) (-878.452) (-877.389) [-877.489] * (-877.422) [-876.752] (-880.581) (-876.549) -- 0:00:59
251000 -- (-877.566) [-881.435] (-876.212) (-878.132) * (-879.341) (-876.007) (-878.774) [-877.661] -- 0:00:59
251500 -- (-876.371) [-876.834] (-879.187) (-880.495) * [-876.916] (-880.675) (-880.720) (-878.417) -- 0:00:59
252000 -- [-876.425] (-876.882) (-877.731) (-880.096) * (-876.559) [-878.497] (-879.063) (-877.297) -- 0:00:59
252500 -- (-875.875) (-877.204) (-876.463) [-876.279] * (-879.949) [-877.884] (-876.544) (-876.940) -- 0:00:59
253000 -- (-881.840) (-876.035) [-879.545] (-879.199) * (-880.561) (-881.374) [-876.684] (-876.960) -- 0:00:59
253500 -- (-881.044) [-875.899] (-880.103) (-881.249) * (-878.121) [-875.802] (-877.843) (-878.131) -- 0:00:58
254000 -- (-880.457) (-879.949) [-877.939] (-878.625) * (-876.705) [-876.249] (-879.730) (-882.796) -- 0:00:58
254500 -- (-876.695) (-877.149) (-876.777) [-878.404] * (-878.061) (-876.314) [-876.162] (-876.311) -- 0:00:58
255000 -- [-878.393] (-878.933) (-879.687) (-877.959) * (-879.430) (-877.050) [-877.828] (-876.131) -- 0:00:58
Average standard deviation of split frequencies: 0.009207
255500 -- (-877.723) (-885.213) (-876.468) [-879.671] * (-876.333) (-880.213) [-877.722] (-876.434) -- 0:00:58
256000 -- [-875.638] (-882.196) (-876.389) (-876.827) * (-876.105) [-876.032] (-875.782) (-879.032) -- 0:00:58
256500 -- (-876.732) (-877.727) (-881.378) [-879.640] * (-875.821) [-876.079] (-877.277) (-876.391) -- 0:00:57
257000 -- [-876.431] (-881.301) (-879.344) (-879.071) * (-877.198) [-878.289] (-879.366) (-877.508) -- 0:00:57
257500 -- (-878.533) [-876.998] (-876.665) (-880.064) * (-877.544) (-879.058) [-876.174] (-876.043) -- 0:00:57
258000 -- (-878.636) (-876.578) [-875.842] (-878.317) * (-877.231) [-876.311] (-877.398) (-875.896) -- 0:00:57
258500 -- [-877.611] (-876.631) (-877.880) (-877.202) * (-878.130) [-876.295] (-878.506) (-875.822) -- 0:00:57
259000 -- (-879.414) (-877.084) [-877.395] (-876.156) * (-876.502) (-876.322) (-878.611) [-876.974] -- 0:00:57
259500 -- (-878.217) (-879.266) [-877.780] (-876.291) * (-878.407) (-877.383) [-879.243] (-876.913) -- 0:00:57
260000 -- (-879.297) (-878.034) (-876.541) [-878.739] * (-877.192) (-876.798) [-882.039] (-879.125) -- 0:00:56
Average standard deviation of split frequencies: 0.009681
260500 -- [-876.514] (-879.644) (-878.603) (-875.968) * (-876.706) (-876.632) [-876.407] (-878.915) -- 0:00:56
261000 -- (-877.396) (-879.305) (-875.861) [-877.103] * (-877.242) (-875.778) [-878.563] (-877.488) -- 0:00:56
261500 -- [-877.343] (-878.033) (-878.022) (-879.239) * (-877.255) [-876.794] (-877.547) (-879.526) -- 0:00:56
262000 -- (-876.963) [-876.603] (-884.439) (-878.371) * (-875.769) [-876.906] (-877.892) (-877.658) -- 0:00:59
262500 -- (-877.470) [-877.052] (-878.301) (-878.451) * (-876.235) (-879.892) [-877.929] (-877.364) -- 0:00:59
263000 -- (-877.451) (-880.567) (-880.204) [-877.397] * [-876.368] (-879.682) (-877.101) (-880.339) -- 0:00:58
263500 -- [-876.210] (-876.602) (-880.177) (-878.794) * (-879.954) (-877.294) [-881.269] (-878.362) -- 0:00:58
264000 -- (-876.501) (-877.776) (-879.098) [-879.594] * (-878.224) (-878.695) [-878.909] (-878.776) -- 0:00:58
264500 -- (-877.645) [-877.741] (-879.320) (-877.423) * [-877.732] (-880.133) (-877.755) (-882.124) -- 0:00:58
265000 -- (-877.157) (-879.750) [-876.928] (-877.988) * (-884.721) (-879.396) [-877.731] (-877.880) -- 0:00:58
Average standard deviation of split frequencies: 0.009452
265500 -- (-879.678) (-877.816) (-877.642) [-878.103] * (-877.216) (-881.406) (-876.668) [-877.865] -- 0:00:58
266000 -- [-877.080] (-876.933) (-877.768) (-876.775) * (-877.039) [-879.809] (-876.208) (-877.374) -- 0:00:57
266500 -- (-877.544) [-876.891] (-878.710) (-876.207) * (-882.207) (-879.935) [-877.423] (-879.831) -- 0:00:57
267000 -- (-877.496) [-876.980] (-879.177) (-876.869) * [-879.099] (-879.205) (-878.080) (-876.359) -- 0:00:57
267500 -- (-876.164) (-877.228) [-877.673] (-880.329) * (-879.326) [-877.903] (-877.919) (-876.787) -- 0:00:57
268000 -- (-875.764) [-878.917] (-877.175) (-877.754) * (-876.503) (-877.849) (-877.711) [-877.711] -- 0:00:57
268500 -- [-876.410] (-876.378) (-879.747) (-876.479) * (-877.399) [-879.861] (-876.046) (-876.115) -- 0:00:57
269000 -- (-879.512) [-877.435] (-878.733) (-878.642) * (-876.056) (-876.006) (-878.089) [-877.581] -- 0:00:57
269500 -- (-882.578) (-879.270) [-880.759] (-882.202) * (-878.238) [-875.762] (-877.299) (-878.073) -- 0:00:56
270000 -- [-878.520] (-880.888) (-877.058) (-877.517) * [-876.888] (-878.901) (-882.015) (-878.583) -- 0:00:56
Average standard deviation of split frequencies: 0.009938
270500 -- (-878.115) (-879.047) [-878.152] (-877.272) * (-877.217) [-879.305] (-877.360) (-882.319) -- 0:00:56
271000 -- [-877.317] (-876.166) (-877.905) (-878.521) * (-877.050) [-878.519] (-875.711) (-882.261) -- 0:00:56
271500 -- (-878.519) (-878.438) (-877.337) [-882.501] * (-876.751) (-880.967) (-876.230) [-879.201] -- 0:00:56
272000 -- [-875.692] (-880.335) (-880.017) (-877.378) * [-876.447] (-876.195) (-876.434) (-881.298) -- 0:00:56
272500 -- [-878.087] (-880.990) (-884.074) (-882.116) * (-877.102) [-878.029] (-876.696) (-878.858) -- 0:00:56
273000 -- (-878.663) [-877.317] (-884.399) (-877.558) * [-878.025] (-878.833) (-875.861) (-881.005) -- 0:00:55
273500 -- (-876.800) (-877.327) (-879.089) [-876.514] * [-878.747] (-877.828) (-877.061) (-876.666) -- 0:00:55
274000 -- (-878.696) [-877.822] (-880.121) (-876.918) * (-879.934) [-877.010] (-875.681) (-878.009) -- 0:00:55
274500 -- (-878.741) (-877.313) (-881.002) [-875.653] * (-878.545) (-877.551) (-876.083) [-877.820] -- 0:00:55
275000 -- (-879.688) (-876.103) (-879.767) [-876.463] * (-876.707) [-881.590] (-879.556) (-876.711) -- 0:00:58
Average standard deviation of split frequencies: 0.010533
275500 -- (-876.848) [-877.830] (-879.847) (-879.376) * [-879.104] (-879.969) (-880.415) (-877.829) -- 0:00:57
276000 -- (-876.015) (-879.841) (-876.174) [-879.821] * (-880.238) [-876.887] (-878.268) (-877.908) -- 0:00:57
276500 -- (-876.699) (-879.839) (-880.059) [-877.215] * (-878.178) (-876.834) [-879.397] (-881.016) -- 0:00:57
277000 -- (-875.879) [-881.237] (-878.610) (-876.690) * (-876.721) (-876.266) (-884.961) [-881.463] -- 0:00:57
277500 -- [-875.839] (-877.665) (-877.051) (-876.955) * [-879.893] (-879.737) (-878.252) (-876.140) -- 0:00:57
278000 -- [-875.784] (-883.881) (-878.244) (-881.145) * (-878.141) [-878.009] (-876.977) (-879.081) -- 0:00:57
278500 -- [-876.532] (-877.180) (-880.467) (-877.783) * (-877.713) [-881.599] (-877.032) (-882.181) -- 0:00:56
279000 -- (-878.078) (-876.708) (-878.771) [-876.800] * [-878.272] (-878.605) (-879.887) (-879.386) -- 0:00:56
279500 -- [-877.566] (-876.455) (-877.634) (-880.346) * (-879.717) [-877.277] (-883.400) (-876.696) -- 0:00:56
280000 -- (-877.680) (-877.329) [-878.098] (-879.743) * (-883.312) (-876.173) (-879.120) [-877.341] -- 0:00:56
Average standard deviation of split frequencies: 0.010451
280500 -- (-875.826) (-877.805) [-876.735] (-876.615) * (-879.225) (-876.543) (-881.541) [-876.716] -- 0:00:56
281000 -- (-878.121) [-876.474] (-876.599) (-878.149) * [-877.605] (-875.894) (-879.363) (-878.639) -- 0:00:56
281500 -- (-876.348) (-877.301) [-876.829] (-876.352) * (-877.528) (-877.485) (-879.111) [-877.615] -- 0:00:56
282000 -- (-875.970) (-879.598) [-876.520] (-877.711) * (-880.951) (-878.626) (-876.408) [-876.609] -- 0:00:56
282500 -- (-881.440) (-878.419) (-875.609) [-877.724] * (-884.365) (-876.304) (-878.025) [-878.891] -- 0:00:55
283000 -- (-876.316) (-879.184) (-877.627) [-878.539] * (-877.128) (-878.328) (-877.911) [-877.129] -- 0:00:55
283500 -- [-878.820] (-877.401) (-878.555) (-877.585) * [-876.619] (-880.228) (-877.250) (-877.027) -- 0:00:55
284000 -- (-878.937) (-880.412) (-876.115) [-875.856] * (-875.538) (-880.592) (-879.402) [-878.977] -- 0:00:55
284500 -- [-877.900] (-883.605) (-876.614) (-877.431) * (-879.825) [-877.369] (-875.892) (-878.678) -- 0:00:55
285000 -- (-878.275) (-883.734) [-878.216] (-879.676) * (-878.199) [-878.258] (-875.925) (-878.562) -- 0:00:55
Average standard deviation of split frequencies: 0.010256
285500 -- [-878.341] (-879.562) (-877.695) (-876.085) * (-885.394) [-878.417] (-877.504) (-878.131) -- 0:00:55
286000 -- (-876.824) (-878.577) (-877.278) [-876.153] * [-878.269] (-875.936) (-876.440) (-884.404) -- 0:00:54
286500 -- (-878.957) [-876.305] (-879.924) (-877.401) * (-878.020) [-876.389] (-877.875) (-877.306) -- 0:00:54
287000 -- (-877.503) (-877.803) (-878.704) [-876.607] * (-877.165) [-875.548] (-877.772) (-878.646) -- 0:00:54
287500 -- (-877.321) (-879.427) [-876.294] (-878.042) * (-876.763) (-877.018) [-878.128] (-877.072) -- 0:00:54
288000 -- (-877.808) (-881.895) (-876.425) [-880.274] * [-876.359] (-877.732) (-879.662) (-877.985) -- 0:00:56
288500 -- (-875.614) (-878.911) [-877.352] (-877.951) * (-876.358) [-877.778] (-878.441) (-879.959) -- 0:00:56
289000 -- (-876.322) (-877.886) [-877.922] (-877.261) * (-877.439) [-876.875] (-876.043) (-882.242) -- 0:00:56
289500 -- (-879.129) (-879.577) [-880.277] (-878.316) * [-876.412] (-880.885) (-876.221) (-882.543) -- 0:00:56
290000 -- (-878.683) (-877.099) [-879.260] (-876.694) * [-878.551] (-878.174) (-876.187) (-878.621) -- 0:00:56
Average standard deviation of split frequencies: 0.010091
290500 -- [-878.239] (-876.207) (-876.176) (-876.795) * (-878.063) (-875.727) (-877.212) [-877.784] -- 0:00:56
291000 -- [-878.815] (-876.282) (-876.628) (-880.027) * [-880.779] (-875.864) (-878.885) (-879.803) -- 0:00:56
291500 -- (-877.376) [-875.854] (-877.231) (-877.266) * (-879.792) [-875.841] (-876.795) (-876.793) -- 0:00:55
292000 -- [-876.352] (-878.740) (-877.105) (-877.424) * (-877.338) (-876.073) (-876.732) [-880.024] -- 0:00:55
292500 -- [-875.820] (-875.549) (-875.757) (-876.233) * [-877.516] (-876.118) (-878.845) (-884.106) -- 0:00:55
293000 -- (-878.433) [-878.958] (-875.757) (-884.787) * (-878.290) (-877.565) [-880.580] (-880.338) -- 0:00:55
293500 -- (-876.469) (-877.325) [-876.935] (-877.135) * (-879.240) (-876.916) [-878.767] (-877.960) -- 0:00:55
294000 -- (-878.475) (-879.459) (-878.045) [-878.219] * (-877.612) (-875.942) [-875.789] (-877.616) -- 0:00:55
294500 -- (-881.584) [-879.831] (-876.358) (-878.310) * (-876.812) (-875.798) (-879.299) [-876.493] -- 0:00:55
295000 -- [-878.919] (-878.153) (-877.164) (-878.004) * (-878.162) (-875.799) [-877.671] (-876.885) -- 0:00:54
Average standard deviation of split frequencies: 0.009732
295500 -- (-876.897) (-877.656) [-876.401] (-879.332) * [-880.294] (-877.511) (-878.775) (-877.644) -- 0:00:54
296000 -- (-881.939) (-876.260) [-876.900] (-879.437) * (-881.414) (-877.139) [-879.009] (-877.418) -- 0:00:54
296500 -- (-877.085) (-877.404) (-876.962) [-877.073] * (-881.230) (-876.938) (-876.653) [-878.565] -- 0:00:54
297000 -- [-877.066] (-876.347) (-877.765) (-877.245) * [-877.357] (-878.034) (-878.512) (-877.085) -- 0:00:54
297500 -- [-876.790] (-878.501) (-877.901) (-879.907) * (-877.256) [-877.306] (-876.094) (-877.394) -- 0:00:54
298000 -- (-875.818) [-876.415] (-876.649) (-879.530) * (-876.038) (-876.612) [-879.276] (-880.239) -- 0:00:54
298500 -- (-877.325) [-876.342] (-876.902) (-877.257) * (-876.141) (-878.398) (-878.338) [-878.230] -- 0:00:54
299000 -- [-876.012] (-876.796) (-875.664) (-883.697) * (-876.759) (-881.591) [-877.547] (-877.303) -- 0:00:53
299500 -- (-876.215) (-875.567) [-877.339] (-876.828) * (-877.170) [-878.737] (-878.690) (-882.095) -- 0:00:53
300000 -- [-875.987] (-875.466) (-876.451) (-881.860) * (-879.213) (-878.585) [-877.593] (-878.479) -- 0:00:53
Average standard deviation of split frequencies: 0.009756
300500 -- [-876.762] (-876.939) (-877.499) (-879.845) * [-879.203] (-877.657) (-877.268) (-880.159) -- 0:00:53
301000 -- (-877.103) [-877.565] (-875.975) (-879.769) * [-878.448] (-878.009) (-876.790) (-876.174) -- 0:00:55
301500 -- (-877.242) [-876.690] (-876.930) (-878.354) * (-876.996) (-882.099) [-875.988] (-877.051) -- 0:00:55
302000 -- (-877.821) (-876.743) (-879.722) [-877.713] * (-882.737) (-878.760) (-876.282) [-876.207] -- 0:00:55
302500 -- (-880.335) (-879.114) [-877.603] (-876.455) * (-880.259) (-875.803) (-876.880) [-877.978] -- 0:00:55
303000 -- (-878.382) (-876.482) [-877.206] (-876.508) * (-879.414) (-876.633) [-876.679] (-877.174) -- 0:00:55
303500 -- (-875.843) (-877.538) (-876.106) [-877.811] * (-881.138) [-876.243] (-876.656) (-878.631) -- 0:00:55
304000 -- (-880.441) (-876.884) [-877.399] (-876.624) * [-876.440] (-876.372) (-881.214) (-875.700) -- 0:00:54
304500 -- (-877.143) (-876.208) (-880.373) [-878.466] * [-881.465] (-876.523) (-877.603) (-879.635) -- 0:00:54
305000 -- (-877.271) (-878.866) (-883.544) [-877.029] * [-876.874] (-880.329) (-876.919) (-879.606) -- 0:00:54
Average standard deviation of split frequencies: 0.009329
305500 -- (-877.228) (-879.918) (-881.412) [-877.315] * (-878.621) [-876.464] (-877.156) (-879.216) -- 0:00:54
306000 -- (-876.462) (-878.795) [-881.343] (-877.652) * [-880.111] (-875.793) (-877.347) (-879.219) -- 0:00:54
306500 -- (-877.496) [-880.884] (-882.466) (-876.555) * (-880.065) [-875.917] (-876.729) (-877.804) -- 0:00:54
307000 -- (-879.366) [-880.777] (-877.753) (-876.888) * [-877.127] (-876.017) (-878.701) (-880.614) -- 0:00:54
307500 -- (-881.842) (-879.415) (-875.979) [-876.501] * (-878.066) (-876.265) (-879.764) [-877.711] -- 0:00:54
308000 -- (-880.621) (-877.197) [-877.250] (-882.354) * [-875.686] (-879.431) (-882.961) (-877.161) -- 0:00:53
308500 -- (-880.356) [-877.641] (-876.673) (-879.304) * (-880.534) [-878.656] (-879.736) (-877.076) -- 0:00:53
309000 -- (-879.169) (-876.463) [-881.228] (-882.191) * (-881.936) (-876.877) (-875.657) [-876.186] -- 0:00:53
309500 -- (-876.808) (-878.037) (-876.298) [-878.264] * [-877.787] (-881.428) (-881.865) (-879.267) -- 0:00:53
310000 -- (-878.611) [-877.498] (-879.287) (-877.635) * [-877.907] (-876.191) (-882.373) (-879.206) -- 0:00:53
Average standard deviation of split frequencies: 0.008851
310500 -- (-876.184) (-876.348) [-876.539] (-878.128) * (-877.362) (-877.007) [-881.005] (-882.509) -- 0:00:53
311000 -- [-875.918] (-876.620) (-875.648) (-880.520) * (-875.817) (-876.596) [-878.551] (-876.841) -- 0:00:53
311500 -- (-876.042) (-878.698) (-875.857) [-878.432] * [-875.628] (-877.751) (-878.824) (-880.682) -- 0:00:53
312000 -- (-877.288) (-880.917) [-877.959] (-877.285) * (-877.174) (-877.066) (-877.024) [-876.846] -- 0:00:52
312500 -- (-875.784) [-876.778] (-879.667) (-875.674) * (-877.518) [-876.285] (-879.897) (-877.560) -- 0:00:52
313000 -- [-876.093] (-878.428) (-878.399) (-877.171) * (-880.563) (-877.177) (-880.054) [-877.532] -- 0:00:52
313500 -- (-875.384) (-878.438) (-879.791) [-877.325] * (-877.511) (-880.973) [-877.160] (-877.927) -- 0:00:52
314000 -- [-875.396] (-877.560) (-879.897) (-876.891) * (-878.372) [-876.700] (-875.574) (-876.115) -- 0:00:54
314500 -- (-878.102) [-878.797] (-879.121) (-876.056) * [-882.203] (-877.581) (-876.639) (-876.685) -- 0:00:54
315000 -- (-879.837) (-877.751) [-877.236] (-876.058) * [-878.699] (-877.394) (-878.352) (-877.318) -- 0:00:54
Average standard deviation of split frequencies: 0.009448
315500 -- (-879.984) [-877.197] (-875.626) (-876.602) * (-882.970) [-877.405] (-877.044) (-878.858) -- 0:00:54
316000 -- (-878.865) (-878.063) [-875.492] (-877.432) * (-878.973) (-876.640) (-878.933) [-877.181] -- 0:00:54
316500 -- (-877.051) (-877.197) (-876.767) [-876.288] * (-879.714) [-876.489] (-875.682) (-879.051) -- 0:00:53
317000 -- (-882.196) [-876.655] (-877.364) (-879.710) * (-876.655) (-879.757) (-876.865) [-878.596] -- 0:00:53
317500 -- [-876.909] (-877.060) (-875.697) (-876.059) * (-876.856) (-876.004) (-878.313) [-878.297] -- 0:00:53
318000 -- (-879.536) (-878.554) [-878.362] (-875.760) * (-877.201) (-877.873) [-877.704] (-878.064) -- 0:00:53
318500 -- (-876.788) (-881.724) (-877.755) [-876.387] * (-877.509) (-878.562) [-880.286] (-881.313) -- 0:00:53
319000 -- (-879.200) (-877.626) [-876.209] (-879.396) * (-877.802) (-875.414) (-878.442) [-880.208] -- 0:00:53
319500 -- (-877.692) [-881.484] (-878.343) (-879.057) * (-875.494) [-877.950] (-878.765) (-876.619) -- 0:00:53
320000 -- (-877.080) [-879.392] (-880.340) (-878.590) * (-876.602) [-876.105] (-880.527) (-876.109) -- 0:00:53
Average standard deviation of split frequencies: 0.010209
320500 -- (-877.969) [-880.595] (-878.351) (-878.708) * (-877.811) (-879.628) [-877.255] (-879.246) -- 0:00:53
321000 -- [-877.921] (-879.509) (-880.070) (-881.039) * (-879.551) (-878.704) [-875.828] (-881.191) -- 0:00:52
321500 -- (-880.342) [-876.643] (-880.307) (-879.714) * [-879.893] (-878.955) (-877.710) (-878.219) -- 0:00:52
322000 -- (-878.350) (-877.520) [-879.155] (-877.593) * (-877.484) (-879.483) [-876.904] (-886.634) -- 0:00:52
322500 -- (-877.825) (-880.830) [-877.048] (-876.711) * (-876.578) (-882.214) [-876.891] (-878.375) -- 0:00:52
323000 -- (-879.143) (-882.731) (-877.824) [-875.762] * [-876.789] (-877.869) (-876.410) (-877.628) -- 0:00:52
323500 -- (-878.036) (-878.953) [-877.892] (-877.403) * [-876.231] (-876.833) (-881.963) (-877.773) -- 0:00:52
324000 -- (-879.250) [-878.040] (-880.941) (-877.077) * (-876.419) [-876.017] (-877.265) (-877.746) -- 0:00:52
324500 -- [-875.987] (-877.623) (-877.287) (-876.125) * (-876.434) [-876.000] (-878.766) (-876.253) -- 0:00:52
325000 -- (-875.982) (-876.365) (-878.152) [-876.380] * [-877.613] (-879.644) (-880.101) (-877.751) -- 0:00:51
Average standard deviation of split frequencies: 0.012050
325500 -- [-876.735] (-877.025) (-877.550) (-879.443) * (-882.655) [-879.877] (-876.668) (-876.520) -- 0:00:51
326000 -- [-878.180] (-883.334) (-878.168) (-881.871) * (-876.608) (-878.274) [-876.096] (-876.452) -- 0:00:51
326500 -- (-877.792) (-878.618) (-878.408) [-878.295] * [-875.462] (-878.772) (-878.356) (-876.483) -- 0:00:51
327000 -- (-876.271) (-878.091) [-876.590] (-878.524) * (-877.059) [-875.898] (-876.728) (-881.785) -- 0:00:53
327500 -- (-876.180) (-879.561) (-876.762) [-877.200] * (-878.558) (-875.558) (-876.544) [-875.853] -- 0:00:53
328000 -- (-876.828) (-876.183) [-876.041] (-881.214) * [-878.697] (-876.287) (-875.893) (-876.162) -- 0:00:53
328500 -- (-877.811) [-877.768] (-879.135) (-879.680) * (-880.507) [-877.061] (-877.782) (-876.534) -- 0:00:53
329000 -- (-880.620) (-881.578) (-876.356) [-880.209] * (-882.312) (-877.941) [-879.083] (-877.201) -- 0:00:53
329500 -- (-880.563) (-878.645) [-878.862] (-877.847) * (-882.268) (-880.605) (-877.838) [-877.194] -- 0:00:52
330000 -- (-877.512) (-878.871) [-876.294] (-879.797) * (-881.525) (-876.197) (-877.253) [-877.236] -- 0:00:52
Average standard deviation of split frequencies: 0.011484
330500 -- (-877.898) (-878.530) [-876.178] (-875.739) * (-877.503) (-878.758) (-879.490) [-879.509] -- 0:00:52
331000 -- (-877.802) (-878.406) (-876.138) [-879.157] * [-877.555] (-879.541) (-877.826) (-877.351) -- 0:00:52
331500 -- (-878.191) [-877.403] (-880.621) (-878.572) * (-877.647) (-879.525) (-877.452) [-876.269] -- 0:00:52
332000 -- (-878.793) [-878.345] (-880.163) (-884.676) * (-876.290) (-879.620) (-880.053) [-876.840] -- 0:00:52
332500 -- (-877.808) [-876.292] (-879.528) (-878.007) * (-879.704) (-879.513) (-877.988) [-877.741] -- 0:00:52
333000 -- [-882.468] (-876.935) (-878.224) (-875.989) * (-878.683) (-877.154) (-882.006) [-876.519] -- 0:00:52
333500 -- (-878.550) (-875.805) [-878.544] (-875.891) * (-878.459) (-876.585) (-875.523) [-876.668] -- 0:00:51
334000 -- (-878.007) (-876.772) [-880.490] (-876.426) * (-878.677) (-877.620) (-875.551) [-877.485] -- 0:00:51
334500 -- (-883.858) [-876.937] (-877.842) (-877.625) * (-877.356) [-876.924] (-875.484) (-878.908) -- 0:00:51
335000 -- (-877.831) (-876.238) [-877.152] (-883.483) * [-879.924] (-877.705) (-877.124) (-875.830) -- 0:00:51
Average standard deviation of split frequencies: 0.012627
335500 -- [-876.462] (-876.279) (-878.160) (-878.504) * [-882.511] (-876.086) (-876.173) (-879.552) -- 0:00:51
336000 -- (-877.692) [-876.619] (-879.959) (-880.455) * (-877.257) [-879.399] (-876.669) (-876.857) -- 0:00:51
336500 -- (-877.604) (-877.861) (-881.968) [-877.173] * (-879.803) (-881.236) (-879.628) [-876.787] -- 0:00:51
337000 -- (-878.463) (-879.895) (-877.531) [-878.729] * (-876.370) [-877.242] (-880.508) (-877.583) -- 0:00:51
337500 -- (-878.803) (-876.450) [-876.451] (-878.769) * [-876.572] (-876.954) (-877.808) (-877.998) -- 0:00:51
338000 -- (-878.347) [-879.413] (-875.942) (-877.521) * (-880.314) [-877.548] (-876.279) (-877.716) -- 0:00:50
338500 -- (-878.498) [-876.367] (-878.398) (-878.003) * (-875.857) [-876.511] (-881.742) (-878.711) -- 0:00:50
339000 -- [-876.073] (-880.261) (-879.275) (-877.960) * (-878.247) (-876.356) [-878.290] (-877.304) -- 0:00:50
339500 -- [-876.790] (-875.976) (-880.359) (-882.451) * (-876.935) [-877.887] (-879.340) (-878.652) -- 0:00:50
340000 -- (-880.408) (-880.377) [-877.984] (-875.717) * (-878.322) (-878.421) [-881.417] (-879.546) -- 0:00:52
Average standard deviation of split frequencies: 0.013376
340500 -- (-879.856) (-876.852) (-879.362) [-879.722] * (-878.175) [-877.206] (-877.452) (-879.233) -- 0:00:52
341000 -- (-881.771) (-878.207) (-877.391) [-878.178] * (-881.886) [-876.379] (-883.429) (-880.007) -- 0:00:52
341500 -- [-876.480] (-875.896) (-878.977) (-880.313) * (-880.211) (-878.242) [-877.167] (-878.741) -- 0:00:52
342000 -- [-879.718] (-878.158) (-877.629) (-879.366) * (-878.982) (-876.907) (-879.125) [-879.901] -- 0:00:51
342500 -- (-883.814) (-878.091) (-877.375) [-876.420] * (-880.330) (-878.748) [-879.411] (-877.799) -- 0:00:51
343000 -- (-879.625) (-881.406) (-878.475) [-877.021] * (-876.082) (-878.049) (-877.916) [-876.371] -- 0:00:51
343500 -- (-881.908) (-878.560) (-876.639) [-876.741] * (-876.452) (-877.359) (-877.378) [-876.581] -- 0:00:51
344000 -- [-877.220] (-877.011) (-877.499) (-882.130) * (-882.681) (-884.000) [-877.439] (-876.081) -- 0:00:51
344500 -- [-878.545] (-877.923) (-881.209) (-876.150) * [-876.715] (-881.270) (-876.224) (-876.505) -- 0:00:51
345000 -- (-876.759) (-883.380) (-883.039) [-875.745] * [-876.805] (-879.973) (-879.937) (-876.871) -- 0:00:51
Average standard deviation of split frequencies: 0.014126
345500 -- (-876.717) [-878.379] (-879.205) (-879.617) * (-881.296) (-878.842) (-875.876) [-879.266] -- 0:00:51
346000 -- (-878.395) [-876.724] (-880.222) (-881.673) * [-877.482] (-878.694) (-875.519) (-880.294) -- 0:00:51
346500 -- (-880.090) [-877.552] (-881.652) (-882.391) * [-877.101] (-876.478) (-876.712) (-879.818) -- 0:00:50
347000 -- (-879.987) (-876.571) (-876.996) [-878.112] * [-878.245] (-876.625) (-876.148) (-875.493) -- 0:00:50
347500 -- (-876.679) [-877.242] (-882.766) (-878.638) * (-877.174) (-882.659) [-878.665] (-877.963) -- 0:00:50
348000 -- (-876.707) (-877.102) [-877.014] (-881.262) * (-880.322) (-879.496) (-877.842) [-875.631] -- 0:00:50
348500 -- [-878.234] (-877.000) (-878.037) (-878.216) * [-878.124] (-878.036) (-876.887) (-875.681) -- 0:00:50
349000 -- [-877.693] (-878.020) (-878.409) (-880.070) * (-875.973) [-876.677] (-877.871) (-877.152) -- 0:00:50
349500 -- [-878.028] (-877.806) (-879.374) (-877.647) * [-879.655] (-882.616) (-879.001) (-881.270) -- 0:00:50
350000 -- (-876.365) [-877.580] (-878.449) (-876.741) * (-878.399) (-880.186) (-877.811) [-878.250] -- 0:00:50
Average standard deviation of split frequencies: 0.013443
350500 -- (-878.226) (-876.836) [-876.307] (-881.577) * (-878.605) (-879.789) (-876.435) [-878.374] -- 0:00:50
351000 -- [-877.492] (-878.593) (-875.638) (-876.016) * (-879.040) (-877.563) (-877.122) [-879.361] -- 0:00:49
351500 -- (-877.400) (-877.560) (-878.894) [-877.127] * (-882.805) (-878.841) [-879.147] (-878.895) -- 0:00:49
352000 -- [-880.998] (-878.677) (-879.892) (-880.178) * (-883.324) (-876.219) (-879.382) [-876.895] -- 0:00:49
352500 -- (-878.703) [-883.195] (-878.567) (-878.525) * (-879.084) (-878.321) [-880.207] (-878.021) -- 0:00:49
353000 -- (-875.873) (-881.947) (-878.180) [-876.911] * (-876.056) (-878.038) [-877.292] (-878.315) -- 0:00:51
353500 -- (-878.349) [-877.588] (-879.187) (-878.770) * (-876.499) [-879.147] (-879.632) (-882.192) -- 0:00:51
354000 -- [-880.891] (-878.521) (-877.941) (-876.395) * (-876.530) (-877.936) [-876.913] (-880.031) -- 0:00:51
354500 -- (-878.688) [-879.339] (-879.260) (-879.381) * (-876.123) (-876.767) [-877.480] (-878.610) -- 0:00:50
355000 -- (-876.592) [-880.537] (-876.197) (-881.011) * (-878.307) (-876.879) (-876.336) [-878.890] -- 0:00:50
Average standard deviation of split frequencies: 0.014198
355500 -- (-878.432) (-878.985) [-876.681] (-879.920) * (-879.920) (-879.332) [-876.477] (-878.382) -- 0:00:50
356000 -- (-875.968) (-877.148) [-875.827] (-880.371) * [-878.374] (-876.203) (-876.561) (-878.633) -- 0:00:50
356500 -- (-876.099) (-877.301) (-875.789) [-878.723] * (-877.346) [-880.096] (-877.785) (-880.805) -- 0:00:50
357000 -- (-880.463) (-877.619) (-876.414) [-877.385] * (-878.824) [-877.843] (-877.793) (-879.923) -- 0:00:50
357500 -- (-881.730) (-876.230) [-877.258] (-876.593) * (-879.881) (-877.217) (-875.929) [-878.548] -- 0:00:50
358000 -- (-880.814) [-876.104] (-877.011) (-877.136) * (-881.909) [-876.931] (-876.356) (-878.260) -- 0:00:50
358500 -- [-877.383] (-877.881) (-880.332) (-877.046) * (-879.075) [-876.000] (-877.261) (-880.180) -- 0:00:50
359000 -- (-878.029) (-877.296) [-876.203] (-877.439) * (-878.370) (-875.639) (-878.671) [-878.989] -- 0:00:49
359500 -- (-876.482) [-876.370] (-876.059) (-878.402) * (-877.996) (-879.281) (-878.883) [-876.867] -- 0:00:49
360000 -- [-876.867] (-879.497) (-877.743) (-876.259) * (-875.571) (-876.197) [-877.369] (-879.368) -- 0:00:49
Average standard deviation of split frequencies: 0.013579
360500 -- (-876.266) (-880.910) (-875.775) [-877.632] * [-879.298] (-884.460) (-879.168) (-881.839) -- 0:00:49
361000 -- (-878.684) (-883.952) [-876.360] (-880.878) * (-876.226) (-877.353) (-881.031) [-884.907] -- 0:00:49
361500 -- [-878.797] (-876.148) (-879.534) (-879.378) * (-876.966) [-878.493] (-878.511) (-878.694) -- 0:00:49
362000 -- (-876.933) [-876.149] (-877.560) (-881.864) * (-876.404) (-880.294) (-879.190) [-876.204] -- 0:00:49
362500 -- (-876.519) (-876.082) [-876.842] (-878.922) * [-876.354] (-881.084) (-878.265) (-875.917) -- 0:00:49
363000 -- (-879.876) [-875.746] (-876.363) (-884.146) * (-877.093) [-876.561] (-877.237) (-875.785) -- 0:00:49
363500 -- (-877.124) [-882.263] (-877.609) (-876.883) * (-878.667) (-881.970) (-878.266) [-876.260] -- 0:00:49
364000 -- [-878.007] (-882.388) (-878.637) (-877.786) * (-878.572) [-878.341] (-876.512) (-876.780) -- 0:00:48
364500 -- (-878.376) (-877.997) (-883.086) [-877.466] * (-878.554) [-878.123] (-879.032) (-879.817) -- 0:00:48
365000 -- (-878.059) [-876.706] (-881.631) (-877.785) * (-877.666) (-877.503) (-878.153) [-878.226] -- 0:00:48
Average standard deviation of split frequencies: 0.013287
365500 -- [-877.506] (-875.496) (-880.680) (-877.727) * (-876.731) (-879.469) [-876.268] (-877.031) -- 0:00:48
366000 -- (-878.761) (-876.003) [-883.059] (-878.794) * (-880.186) [-878.743] (-879.333) (-879.332) -- 0:00:50
366500 -- (-879.085) (-875.952) (-878.696) [-877.923] * (-877.265) [-880.341] (-877.543) (-876.905) -- 0:00:50
367000 -- (-878.559) [-877.170] (-877.072) (-880.268) * (-877.801) (-876.887) (-876.579) [-877.359] -- 0:00:50
367500 -- (-876.484) (-876.967) (-879.930) [-880.138] * (-876.477) [-878.239] (-878.925) (-876.416) -- 0:00:49
368000 -- (-877.037) [-877.670] (-877.687) (-881.440) * (-879.258) [-877.070] (-883.405) (-883.605) -- 0:00:49
368500 -- (-875.949) (-877.119) (-880.439) [-881.446] * [-877.888] (-877.006) (-882.216) (-881.567) -- 0:00:49
369000 -- (-878.513) (-877.491) (-878.705) [-877.591] * [-877.298] (-879.678) (-881.186) (-879.781) -- 0:00:49
369500 -- (-877.991) (-876.498) (-879.349) [-877.098] * (-876.595) (-877.596) (-878.417) [-881.009] -- 0:00:49
370000 -- [-876.675] (-876.644) (-875.772) (-881.242) * (-877.169) [-878.769] (-878.263) (-876.946) -- 0:00:49
Average standard deviation of split frequencies: 0.013320
370500 -- (-877.001) (-876.473) [-875.947] (-879.073) * (-877.175) (-879.356) (-877.906) [-877.398] -- 0:00:49
371000 -- (-877.202) (-876.660) [-877.087] (-878.500) * (-876.170) [-879.489] (-878.000) (-875.602) -- 0:00:49
371500 -- (-877.168) [-878.143] (-882.828) (-878.491) * [-877.300] (-876.893) (-877.877) (-877.122) -- 0:00:49
372000 -- (-876.626) [-876.511] (-879.464) (-877.397) * (-878.144) (-883.768) [-875.993] (-877.800) -- 0:00:48
372500 -- (-879.303) [-876.556] (-878.191) (-876.333) * (-877.043) (-876.942) [-875.659] (-876.914) -- 0:00:48
373000 -- (-878.759) [-875.940] (-876.912) (-878.375) * [-877.449] (-877.680) (-877.799) (-882.103) -- 0:00:48
373500 -- (-877.253) (-880.510) [-879.122] (-878.980) * (-878.392) [-877.656] (-875.744) (-880.126) -- 0:00:48
374000 -- (-879.997) [-877.603] (-880.984) (-880.270) * (-878.759) (-880.145) [-878.204] (-878.908) -- 0:00:48
374500 -- [-880.406] (-881.620) (-877.194) (-879.387) * (-877.522) (-876.483) (-876.770) [-879.821] -- 0:00:48
375000 -- (-879.189) [-879.842] (-878.763) (-876.838) * (-879.040) (-876.233) [-875.751] (-877.537) -- 0:00:48
Average standard deviation of split frequencies: 0.013263
375500 -- (-877.554) (-879.141) (-876.187) [-876.198] * (-876.552) (-879.970) [-877.661] (-876.328) -- 0:00:48
376000 -- (-878.584) (-878.456) [-878.728] (-875.850) * (-877.258) (-878.493) [-877.929] (-877.915) -- 0:00:48
376500 -- (-877.175) [-877.214] (-879.717) (-877.347) * (-877.104) (-877.861) (-876.022) [-877.561] -- 0:00:48
377000 -- (-879.140) [-879.045] (-877.585) (-877.421) * (-877.903) (-878.567) (-877.449) [-878.163] -- 0:00:47
377500 -- (-876.522) (-878.046) [-880.021] (-877.555) * (-877.118) (-875.831) (-877.362) [-881.074] -- 0:00:47
378000 -- (-879.229) (-876.872) (-878.977) [-877.030] * [-876.080] (-876.602) (-877.546) (-877.154) -- 0:00:47
378500 -- (-880.350) (-879.232) [-878.181] (-877.412) * (-876.117) [-877.067] (-879.215) (-876.239) -- 0:00:47
379000 -- (-877.822) (-879.318) (-876.142) [-877.430] * (-877.793) (-876.523) (-877.483) [-876.443] -- 0:00:49
379500 -- [-876.912] (-878.497) (-876.121) (-878.838) * [-877.927] (-878.689) (-878.675) (-877.397) -- 0:00:49
380000 -- (-880.772) (-877.630) [-876.121] (-881.489) * (-882.104) (-879.215) (-878.631) [-878.822] -- 0:00:48
Average standard deviation of split frequencies: 0.012710
380500 -- (-878.175) [-878.520] (-882.254) (-881.035) * (-878.340) (-877.336) (-878.667) [-877.559] -- 0:00:48
381000 -- [-877.519] (-875.965) (-878.108) (-876.702) * (-876.897) (-881.833) [-876.775] (-876.623) -- 0:00:48
381500 -- (-877.258) [-877.018] (-878.564) (-877.060) * (-878.594) [-878.726] (-878.578) (-877.953) -- 0:00:48
382000 -- [-875.729] (-877.526) (-876.304) (-877.661) * [-877.460] (-879.481) (-880.373) (-876.237) -- 0:00:48
382500 -- [-878.956] (-877.322) (-876.659) (-879.165) * [-878.309] (-884.064) (-881.373) (-875.768) -- 0:00:48
383000 -- (-879.687) (-880.237) [-877.186] (-878.523) * (-878.434) [-878.512] (-883.915) (-878.349) -- 0:00:48
383500 -- [-876.943] (-877.140) (-879.943) (-877.358) * (-879.097) (-877.089) [-880.998] (-880.890) -- 0:00:48
384000 -- (-876.193) (-876.935) (-878.721) [-878.188] * [-877.267] (-875.890) (-877.511) (-884.294) -- 0:00:48
384500 -- [-876.254] (-876.726) (-878.309) (-878.492) * (-879.045) (-877.734) (-877.502) [-881.886] -- 0:00:48
385000 -- (-878.084) [-878.510] (-879.392) (-877.185) * (-877.557) (-876.293) (-878.706) [-878.429] -- 0:00:47
Average standard deviation of split frequencies: 0.012148
385500 -- (-876.842) [-879.650] (-879.792) (-876.625) * (-877.769) (-879.143) [-880.278] (-876.955) -- 0:00:47
386000 -- (-876.223) [-879.496] (-877.682) (-880.647) * (-878.574) [-880.277] (-880.119) (-875.729) -- 0:00:47
386500 -- (-876.852) [-879.251] (-877.078) (-878.847) * (-876.965) (-879.578) (-879.953) [-881.532] -- 0:00:47
387000 -- (-877.303) [-879.267] (-877.988) (-878.627) * (-878.927) (-880.124) (-879.115) [-881.243] -- 0:00:47
387500 -- (-882.234) [-879.772] (-876.680) (-882.044) * (-876.521) (-877.330) [-879.542] (-876.496) -- 0:00:47
388000 -- (-879.008) [-878.407] (-880.347) (-877.894) * [-876.949] (-876.389) (-879.153) (-877.247) -- 0:00:47
388500 -- [-876.824] (-877.781) (-879.326) (-885.515) * [-877.187] (-875.456) (-882.913) (-875.591) -- 0:00:47
389000 -- [-877.189] (-877.141) (-879.208) (-884.291) * (-879.469) [-876.427] (-880.893) (-880.018) -- 0:00:47
389500 -- (-876.964) (-876.258) [-878.163] (-878.760) * [-877.872] (-877.428) (-876.750) (-879.111) -- 0:00:47
390000 -- [-879.909] (-876.691) (-877.175) (-881.414) * (-878.504) (-876.397) [-875.932] (-878.764) -- 0:00:46
Average standard deviation of split frequencies: 0.011432
390500 -- [-878.527] (-879.010) (-876.953) (-877.032) * (-877.399) (-877.998) [-876.986] (-878.507) -- 0:00:46
391000 -- [-878.900] (-879.819) (-877.465) (-877.429) * (-875.804) (-877.717) [-876.165] (-878.996) -- 0:00:46
391500 -- (-876.031) (-880.255) (-876.992) [-878.194] * (-876.236) (-876.726) (-878.031) [-879.608] -- 0:00:46
392000 -- (-878.567) (-882.167) (-878.045) [-875.471] * (-876.753) [-876.545] (-880.543) (-879.617) -- 0:00:48
392500 -- (-876.687) [-879.694] (-878.512) (-876.757) * (-879.315) [-878.627] (-882.390) (-881.368) -- 0:00:47
393000 -- (-876.013) [-876.952] (-877.688) (-879.643) * (-877.272) [-880.575] (-880.203) (-878.125) -- 0:00:47
393500 -- (-876.065) [-876.206] (-878.858) (-879.150) * (-877.672) [-876.220] (-878.007) (-878.872) -- 0:00:47
394000 -- [-876.053] (-876.661) (-877.173) (-877.798) * (-876.485) [-879.159] (-878.102) (-877.768) -- 0:00:47
394500 -- (-875.968) [-878.605] (-879.360) (-878.941) * (-877.475) [-876.353] (-876.672) (-877.568) -- 0:00:47
395000 -- (-878.277) (-882.585) [-877.181] (-877.576) * (-881.030) [-877.251] (-880.982) (-880.556) -- 0:00:47
Average standard deviation of split frequencies: 0.010964
395500 -- (-880.607) [-876.499] (-877.394) (-877.177) * (-879.609) [-877.251] (-878.804) (-879.281) -- 0:00:47
396000 -- (-877.887) (-876.982) [-877.190] (-881.614) * (-876.424) (-877.077) (-879.246) [-877.662] -- 0:00:47
396500 -- (-879.617) (-877.704) (-877.219) [-880.702] * (-878.453) [-877.806] (-877.875) (-878.641) -- 0:00:47
397000 -- (-879.829) [-877.439] (-882.734) (-877.451) * (-876.430) (-881.283) (-880.650) [-876.139] -- 0:00:47
397500 -- (-880.954) (-876.688) (-877.927) [-876.228] * [-875.871] (-879.368) (-876.360) (-876.147) -- 0:00:46
398000 -- (-877.324) (-881.382) (-878.803) [-876.548] * (-875.918) [-876.729] (-876.138) (-876.761) -- 0:00:46
398500 -- (-877.346) [-877.007] (-878.322) (-876.729) * (-876.743) [-878.468] (-877.361) (-878.131) -- 0:00:46
399000 -- [-877.727] (-876.595) (-878.640) (-876.170) * (-879.192) (-877.613) (-879.250) [-877.913] -- 0:00:46
399500 -- [-877.075] (-876.488) (-878.030) (-879.389) * (-876.674) [-878.435] (-878.812) (-878.148) -- 0:00:46
400000 -- (-878.972) [-876.477] (-879.040) (-877.477) * (-877.203) [-877.205] (-877.949) (-876.304) -- 0:00:46
Average standard deviation of split frequencies: 0.012385
400500 -- (-877.513) (-877.645) (-879.284) [-875.737] * (-877.903) (-875.655) (-876.090) [-876.909] -- 0:00:46
401000 -- (-877.823) [-876.249] (-883.153) (-878.209) * [-879.297] (-877.415) (-877.980) (-877.965) -- 0:00:46
401500 -- (-877.827) (-875.754) (-879.814) [-879.365] * (-877.159) (-885.982) [-876.653] (-877.438) -- 0:00:46
402000 -- (-877.819) (-875.434) (-880.582) [-877.361] * (-877.537) [-877.625] (-876.317) (-879.912) -- 0:00:46
402500 -- (-877.858) (-878.061) [-876.751] (-880.414) * (-877.654) [-876.526] (-879.116) (-876.343) -- 0:00:46
403000 -- (-876.683) (-877.941) [-876.940] (-879.336) * (-877.666) (-877.243) (-877.985) [-876.297] -- 0:00:45
403500 -- (-877.132) (-879.732) (-877.801) [-878.046] * (-876.518) (-880.101) [-879.314] (-876.573) -- 0:00:45
404000 -- (-878.155) (-877.355) (-875.892) [-876.935] * [-877.520] (-879.914) (-879.706) (-876.092) -- 0:00:45
404500 -- (-878.039) (-877.271) [-876.561] (-877.189) * (-878.731) (-876.464) [-879.891] (-877.545) -- 0:00:45
405000 -- (-877.756) [-876.728] (-876.629) (-877.420) * (-879.092) (-876.669) (-879.837) [-878.336] -- 0:00:47
Average standard deviation of split frequencies: 0.011489
405500 -- (-877.948) (-876.167) [-876.622] (-877.884) * (-875.722) [-879.227] (-879.074) (-879.916) -- 0:00:46
406000 -- (-878.670) (-878.798) [-879.302] (-878.663) * (-877.335) (-876.985) [-878.224] (-877.734) -- 0:00:46
406500 -- (-878.337) (-875.934) (-876.485) [-876.621] * (-875.777) (-879.637) [-879.485] (-877.799) -- 0:00:46
407000 -- (-879.185) [-877.220] (-877.632) (-879.392) * (-876.916) [-878.061] (-878.534) (-880.556) -- 0:00:46
407500 -- (-882.073) [-876.930] (-879.591) (-876.534) * [-876.375] (-876.226) (-879.347) (-876.380) -- 0:00:46
408000 -- (-881.501) (-877.314) (-876.634) [-880.975] * [-877.112] (-877.663) (-877.799) (-876.583) -- 0:00:46
408500 -- (-877.960) (-877.478) (-879.017) [-876.644] * [-877.779] (-877.385) (-878.372) (-877.985) -- 0:00:46
409000 -- [-878.245] (-876.080) (-877.128) (-877.759) * (-877.757) (-877.841) [-876.602] (-880.578) -- 0:00:46
409500 -- (-879.868) (-876.918) [-877.881] (-878.598) * (-876.971) (-878.647) (-880.198) [-879.050] -- 0:00:46
410000 -- [-878.794] (-876.682) (-879.674) (-881.401) * (-877.835) (-878.282) (-879.443) [-880.616] -- 0:00:46
Average standard deviation of split frequencies: 0.010754
410500 -- (-876.021) (-876.552) [-877.549] (-880.413) * (-877.751) (-879.885) [-879.679] (-877.677) -- 0:00:45
411000 -- [-877.500] (-877.625) (-878.350) (-877.973) * (-881.220) (-877.701) [-878.244] (-876.760) -- 0:00:45
411500 -- (-881.971) [-876.121] (-881.266) (-876.501) * [-876.805] (-879.687) (-876.275) (-877.047) -- 0:00:45
412000 -- (-884.373) (-877.980) (-882.177) [-877.317] * (-879.394) (-877.930) (-882.594) [-875.766] -- 0:00:45
412500 -- (-876.793) [-876.321] (-880.669) (-881.617) * [-878.549] (-875.849) (-880.579) (-877.571) -- 0:00:45
413000 -- (-876.666) [-877.391] (-880.393) (-881.337) * (-876.078) [-878.192] (-879.787) (-877.696) -- 0:00:45
413500 -- (-878.203) (-878.427) (-876.583) [-876.157] * [-882.951] (-878.867) (-878.934) (-877.585) -- 0:00:45
414000 -- [-876.618] (-878.842) (-877.808) (-876.627) * [-876.618] (-877.992) (-876.536) (-877.636) -- 0:00:45
414500 -- (-879.218) (-877.274) [-877.093] (-877.674) * (-879.386) [-877.987] (-877.805) (-880.870) -- 0:00:45
415000 -- [-877.211] (-876.281) (-877.915) (-877.580) * (-878.958) (-876.442) (-880.092) [-877.004] -- 0:00:45
Average standard deviation of split frequencies: 0.011451
415500 -- (-877.522) [-875.887] (-878.323) (-882.555) * [-877.510] (-880.083) (-875.922) (-877.078) -- 0:00:45
416000 -- (-876.815) (-879.220) (-877.846) [-877.479] * (-880.562) (-876.901) [-879.199] (-879.112) -- 0:00:44
416500 -- (-878.850) (-877.119) [-875.875] (-878.218) * (-877.674) (-878.083) [-880.555] (-877.609) -- 0:00:44
417000 -- (-881.550) (-878.013) (-876.743) [-877.289] * (-877.769) (-878.520) (-877.459) [-878.425] -- 0:00:44
417500 -- [-876.480] (-878.344) (-878.327) (-877.724) * (-876.813) (-879.048) [-878.698] (-878.616) -- 0:00:46
418000 -- (-876.367) (-876.439) (-878.679) [-878.618] * (-879.152) (-878.164) [-877.930] (-877.263) -- 0:00:45
418500 -- (-876.338) (-875.822) (-878.127) [-877.901] * (-880.563) (-876.040) [-876.369] (-888.451) -- 0:00:45
419000 -- (-878.998) (-875.923) (-876.925) [-876.749] * (-878.778) (-879.683) [-875.952] (-879.363) -- 0:00:45
419500 -- (-876.398) [-875.673] (-878.972) (-876.664) * (-881.028) [-877.296] (-878.479) (-879.413) -- 0:00:45
420000 -- (-877.843) (-875.909) [-878.183] (-878.968) * (-875.796) (-879.093) [-877.693] (-877.514) -- 0:00:45
Average standard deviation of split frequencies: 0.010023
420500 -- [-877.864] (-877.879) (-880.221) (-876.000) * (-878.250) [-876.509] (-877.354) (-876.331) -- 0:00:45
421000 -- [-879.225] (-876.737) (-880.306) (-875.904) * (-877.537) (-876.174) [-877.860] (-877.847) -- 0:00:45
421500 -- (-879.851) [-879.244] (-879.910) (-876.886) * (-877.317) [-877.462] (-878.413) (-876.649) -- 0:00:45
422000 -- (-878.661) [-875.825] (-877.509) (-876.104) * (-877.160) (-881.239) [-877.425] (-877.112) -- 0:00:45
422500 -- (-875.909) (-882.261) (-877.514) [-880.292] * [-880.711] (-876.518) (-876.627) (-877.454) -- 0:00:45
423000 -- (-877.308) [-884.350] (-878.029) (-880.516) * (-878.301) (-875.988) (-878.156) [-878.159] -- 0:00:45
423500 -- (-879.971) (-877.254) (-879.233) [-878.258] * [-876.497] (-876.654) (-876.524) (-876.624) -- 0:00:44
424000 -- (-878.996) (-877.211) [-876.434] (-881.109) * [-876.644] (-877.415) (-876.910) (-877.536) -- 0:00:44
424500 -- (-878.695) (-877.455) (-878.160) [-879.014] * (-877.656) [-876.326] (-877.821) (-876.697) -- 0:00:44
425000 -- (-877.347) [-877.461] (-876.794) (-880.291) * [-877.634] (-878.178) (-878.027) (-878.424) -- 0:00:44
Average standard deviation of split frequencies: 0.009590
425500 -- (-876.713) (-877.807) [-876.509] (-877.332) * (-877.799) (-877.297) (-877.297) [-882.002] -- 0:00:44
426000 -- (-880.741) [-878.092] (-880.117) (-876.012) * (-877.638) (-877.292) [-876.811] (-880.386) -- 0:00:44
426500 -- (-877.263) [-877.372] (-880.933) (-879.051) * (-880.460) (-880.016) (-878.470) [-881.688] -- 0:00:44
427000 -- (-879.793) (-876.687) (-878.534) [-876.751] * (-878.260) (-876.715) [-876.408] (-878.558) -- 0:00:44
427500 -- (-876.684) (-877.639) [-876.844] (-877.209) * [-877.481] (-878.509) (-876.437) (-877.899) -- 0:00:44
428000 -- (-877.851) (-885.286) [-879.215] (-878.562) * [-878.545] (-876.551) (-880.702) (-878.958) -- 0:00:44
428500 -- (-875.963) (-885.191) [-876.716] (-879.904) * (-879.780) (-876.183) [-878.188] (-876.310) -- 0:00:44
429000 -- (-879.550) (-880.524) [-877.114] (-878.140) * (-878.056) [-878.474] (-879.932) (-880.542) -- 0:00:43
429500 -- (-880.420) [-876.389] (-880.466) (-879.725) * (-880.477) (-879.733) (-877.455) [-877.490] -- 0:00:43
430000 -- (-878.021) [-877.251] (-880.565) (-879.510) * [-878.284] (-876.093) (-881.624) (-884.521) -- 0:00:43
Average standard deviation of split frequencies: 0.009973
430500 -- (-880.234) (-876.330) (-880.017) [-879.536] * [-877.657] (-875.949) (-882.121) (-883.919) -- 0:00:44
431000 -- (-876.309) [-876.979] (-879.689) (-878.285) * (-878.557) (-877.823) (-877.268) [-876.515] -- 0:00:44
431500 -- (-878.751) (-876.951) [-876.582] (-876.853) * (-877.451) (-877.182) (-876.775) [-878.474] -- 0:00:44
432000 -- (-879.544) (-879.539) [-877.693] (-876.489) * [-876.974] (-879.250) (-880.926) (-876.971) -- 0:00:44
432500 -- [-878.039] (-876.456) (-877.161) (-877.911) * (-875.716) (-878.673) [-875.833] (-875.716) -- 0:00:44
433000 -- (-881.042) (-878.678) [-878.094] (-877.176) * (-877.192) (-877.506) [-876.604] (-877.578) -- 0:00:44
433500 -- (-881.459) (-878.683) (-878.726) [-882.092] * (-877.361) (-886.331) (-877.333) [-877.833] -- 0:00:44
434000 -- [-876.458] (-876.384) (-877.490) (-879.161) * [-878.554] (-882.193) (-877.037) (-877.082) -- 0:00:44
434500 -- [-876.430] (-878.905) (-876.079) (-878.124) * (-880.646) (-879.980) (-883.019) [-876.407] -- 0:00:44
435000 -- (-876.627) (-876.696) [-878.828] (-876.827) * [-878.700] (-877.921) (-879.463) (-878.046) -- 0:00:44
Average standard deviation of split frequencies: 0.009349
435500 -- (-878.467) (-876.211) [-878.629] (-878.193) * (-877.406) (-878.710) (-876.551) [-877.199] -- 0:00:44
436000 -- (-880.516) [-878.157] (-880.505) (-877.007) * (-877.467) (-876.406) (-881.549) [-879.539] -- 0:00:43
436500 -- (-882.552) (-880.214) [-881.006] (-876.681) * (-876.365) (-876.743) (-879.238) [-879.008] -- 0:00:43
437000 -- (-875.938) [-876.440] (-877.155) (-879.342) * (-879.018) (-878.489) (-878.859) [-876.854] -- 0:00:43
437500 -- [-877.778] (-875.979) (-877.583) (-877.812) * (-877.434) (-876.938) [-880.893] (-878.239) -- 0:00:43
438000 -- (-883.085) [-877.683] (-879.239) (-878.845) * [-875.692] (-883.996) (-880.904) (-876.494) -- 0:00:43
438500 -- (-882.091) (-879.709) [-878.326] (-876.812) * [-876.823] (-879.664) (-876.569) (-876.160) -- 0:00:43
439000 -- (-881.468) (-880.871) [-881.644] (-876.496) * (-876.342) (-877.937) [-877.481] (-877.380) -- 0:00:43
439500 -- (-877.932) [-878.383] (-877.307) (-880.124) * (-878.526) (-876.959) [-875.572] (-879.300) -- 0:00:43
440000 -- [-877.782] (-882.825) (-878.430) (-875.707) * (-878.838) [-876.489] (-876.557) (-880.632) -- 0:00:43
Average standard deviation of split frequencies: 0.009691
440500 -- (-878.676) (-888.806) [-879.417] (-876.325) * (-875.669) (-877.048) [-877.127] (-880.202) -- 0:00:43
441000 -- (-882.274) (-878.816) [-878.243] (-880.505) * (-876.706) [-878.068] (-876.671) (-878.348) -- 0:00:43
441500 -- (-877.600) (-878.477) (-876.599) [-878.874] * [-878.634] (-877.993) (-876.370) (-877.029) -- 0:00:43
442000 -- (-875.908) (-877.409) [-876.086] (-877.449) * (-880.288) (-878.121) (-876.911) [-877.468] -- 0:00:42
442500 -- (-876.318) (-876.709) [-878.236] (-877.562) * (-876.532) (-877.564) (-876.682) [-878.588] -- 0:00:42
443000 -- (-879.044) (-876.823) (-879.167) [-876.146] * (-878.208) (-878.893) [-877.279] (-878.089) -- 0:00:42
443500 -- (-883.676) [-879.122] (-878.705) (-878.981) * (-876.027) [-880.202] (-877.603) (-878.279) -- 0:00:43
444000 -- (-877.160) [-879.470] (-879.550) (-875.906) * [-877.804] (-878.408) (-876.850) (-878.552) -- 0:00:43
444500 -- [-877.054] (-877.717) (-878.486) (-877.023) * [-876.704] (-878.855) (-878.546) (-879.290) -- 0:00:43
445000 -- (-877.175) (-877.989) [-876.492] (-877.169) * (-878.241) (-876.863) (-877.466) [-877.465] -- 0:00:43
Average standard deviation of split frequencies: 0.009219
445500 -- [-878.264] (-878.243) (-881.568) (-876.322) * [-877.100] (-878.943) (-879.290) (-875.727) -- 0:00:43
446000 -- (-878.290) (-877.049) (-877.302) [-877.740] * (-877.404) (-879.928) (-877.984) [-875.688] -- 0:00:43
446500 -- [-876.625] (-876.976) (-878.225) (-876.133) * (-878.147) (-880.658) [-875.581] (-880.688) -- 0:00:43
447000 -- [-879.039] (-877.292) (-880.131) (-875.891) * (-883.782) (-878.492) (-876.585) [-882.305] -- 0:00:43
447500 -- (-879.533) (-880.213) (-878.251) [-876.285] * [-879.697] (-876.650) (-878.505) (-877.610) -- 0:00:43
448000 -- (-882.798) (-877.221) (-876.174) [-880.453] * (-880.758) (-876.670) (-877.092) [-881.400] -- 0:00:43
448500 -- (-880.013) [-879.351] (-876.450) (-875.731) * [-880.669] (-876.104) (-878.434) (-877.398) -- 0:00:43
449000 -- (-882.664) (-879.373) (-877.681) [-875.938] * [-879.253] (-875.881) (-878.531) (-878.137) -- 0:00:42
449500 -- (-884.138) (-877.503) (-877.928) [-877.204] * (-880.035) [-876.850] (-876.413) (-876.003) -- 0:00:42
450000 -- [-879.861] (-877.423) (-876.320) (-876.551) * [-878.000] (-886.523) (-878.237) (-878.160) -- 0:00:42
Average standard deviation of split frequencies: 0.009106
450500 -- (-880.128) [-877.041] (-877.958) (-882.218) * [-876.271] (-878.587) (-877.821) (-877.784) -- 0:00:42
451000 -- (-877.913) (-878.821) (-877.494) [-880.285] * (-878.075) (-876.315) [-878.820] (-877.758) -- 0:00:42
451500 -- (-876.717) (-877.223) (-877.750) [-879.557] * (-877.531) [-877.530] (-878.056) (-877.261) -- 0:00:42
452000 -- [-878.320] (-879.057) (-877.705) (-877.243) * (-876.683) [-877.229] (-883.384) (-880.861) -- 0:00:42
452500 -- [-877.553] (-877.900) (-877.206) (-880.192) * (-880.668) [-877.458] (-880.816) (-876.592) -- 0:00:42
453000 -- [-876.031] (-878.119) (-880.252) (-878.503) * [-877.101] (-877.282) (-881.512) (-881.672) -- 0:00:42
453500 -- (-878.908) (-877.194) (-878.938) [-876.474] * (-876.654) (-878.857) [-877.054] (-879.415) -- 0:00:42
454000 -- (-883.943) (-879.045) [-876.497] (-876.473) * (-879.252) (-880.305) (-877.724) [-875.639] -- 0:00:42
454500 -- (-877.789) (-877.522) [-878.148] (-876.579) * (-876.026) (-878.183) [-878.102] (-877.018) -- 0:00:42
455000 -- [-878.937] (-885.980) (-877.506) (-876.913) * (-877.632) (-877.445) (-877.462) [-876.240] -- 0:00:41
Average standard deviation of split frequencies: 0.007784
455500 -- (-876.031) (-883.190) (-879.498) [-875.892] * (-883.321) (-878.545) [-879.339] (-875.907) -- 0:00:41
456000 -- (-889.296) (-884.127) [-877.744] (-876.497) * (-879.725) (-880.401) (-882.976) [-876.001] -- 0:00:42
456500 -- (-877.817) [-877.142] (-879.457) (-876.384) * [-876.841] (-876.358) (-876.240) (-876.453) -- 0:00:42
457000 -- (-877.529) (-876.539) (-877.690) [-878.139] * (-876.272) (-875.918) [-876.746] (-876.159) -- 0:00:42
457500 -- (-877.247) (-878.938) [-878.005] (-878.534) * (-875.806) (-878.068) [-877.261] (-875.846) -- 0:00:42
458000 -- (-876.726) (-879.854) [-880.505] (-876.346) * (-877.378) (-877.701) [-878.011] (-883.849) -- 0:00:42
458500 -- (-877.130) (-880.673) (-877.487) [-879.451] * (-879.978) (-883.646) (-878.649) [-878.492] -- 0:00:42
459000 -- (-877.539) (-881.978) (-876.965) [-879.722] * (-879.425) (-876.967) [-878.212] (-877.491) -- 0:00:42
459500 -- (-880.450) (-879.618) [-881.469] (-879.526) * [-876.092] (-877.085) (-877.290) (-879.618) -- 0:00:42
460000 -- (-877.987) [-876.985] (-878.022) (-877.881) * (-876.762) (-877.681) (-878.600) [-876.734] -- 0:00:42
Average standard deviation of split frequencies: 0.009150
460500 -- (-879.097) (-880.252) [-876.531] (-877.735) * [-877.311] (-877.179) (-879.435) (-876.918) -- 0:00:42
461000 -- (-878.555) [-878.784] (-878.487) (-877.679) * (-881.014) (-882.383) [-878.026] (-880.450) -- 0:00:42
461500 -- (-878.342) [-876.780] (-877.517) (-879.830) * (-876.883) [-876.085] (-878.017) (-879.705) -- 0:00:42
462000 -- [-880.107] (-877.291) (-880.989) (-881.209) * (-877.685) [-878.154] (-878.826) (-879.559) -- 0:00:41
462500 -- [-879.642] (-878.896) (-878.804) (-882.655) * (-877.127) (-877.173) [-876.225] (-877.048) -- 0:00:41
463000 -- (-877.043) (-876.821) (-880.429) [-880.459] * (-877.127) [-876.382] (-879.662) (-880.750) -- 0:00:41
463500 -- [-876.716] (-877.841) (-879.949) (-877.241) * (-879.499) (-877.227) [-878.748] (-880.047) -- 0:00:41
464000 -- (-876.730) [-876.040] (-878.903) (-878.107) * [-878.461] (-876.977) (-877.784) (-876.697) -- 0:00:41
464500 -- [-876.920] (-877.193) (-878.934) (-879.006) * (-876.793) [-879.484] (-880.947) (-879.108) -- 0:00:41
465000 -- (-876.940) [-878.253] (-880.288) (-879.596) * (-876.067) [-877.004] (-877.365) (-878.238) -- 0:00:41
Average standard deviation of split frequencies: 0.009997
465500 -- (-878.210) (-877.224) (-876.896) [-877.613] * [-878.931] (-876.462) (-875.608) (-881.030) -- 0:00:41
466000 -- (-877.923) (-877.849) [-876.514] (-879.778) * [-876.704] (-879.023) (-877.208) (-878.484) -- 0:00:41
466500 -- (-877.519) (-878.735) (-876.783) [-879.078] * (-879.963) (-877.847) (-877.639) [-877.025] -- 0:00:41
467000 -- (-877.384) (-878.667) [-875.654] (-878.765) * [-877.951] (-878.658) (-880.837) (-877.773) -- 0:00:41
467500 -- [-875.754] (-879.547) (-876.836) (-877.622) * (-879.287) [-877.081] (-877.251) (-879.140) -- 0:00:41
468000 -- (-877.611) [-875.477] (-878.404) (-879.785) * (-878.437) (-877.415) (-877.467) [-878.122] -- 0:00:40
468500 -- (-878.555) (-876.783) [-879.047] (-876.125) * (-877.899) (-876.017) [-881.951] (-876.665) -- 0:00:40
469000 -- [-879.311] (-878.355) (-876.986) (-877.432) * (-881.525) (-875.874) [-876.338] (-879.607) -- 0:00:41
469500 -- [-877.951] (-876.874) (-875.970) (-878.975) * (-876.616) [-875.868] (-876.486) (-876.522) -- 0:00:41
470000 -- (-881.539) (-878.181) (-882.256) [-879.135] * (-877.990) [-876.338] (-877.549) (-878.145) -- 0:00:41
Average standard deviation of split frequencies: 0.009544
470500 -- [-879.502] (-878.539) (-879.510) (-882.043) * (-876.616) (-876.539) [-876.397] (-875.823) -- 0:00:41
471000 -- (-876.878) [-879.581] (-880.711) (-881.635) * [-876.504] (-876.124) (-877.627) (-876.766) -- 0:00:41
471500 -- (-876.590) (-878.454) [-879.173] (-876.008) * (-877.034) (-876.350) [-876.526] (-880.259) -- 0:00:41
472000 -- (-878.042) [-877.767] (-878.193) (-876.867) * (-878.528) [-877.452] (-880.077) (-879.031) -- 0:00:41
472500 -- (-876.919) (-877.063) [-878.227] (-881.416) * [-877.145] (-878.953) (-878.280) (-878.824) -- 0:00:41
473000 -- (-878.741) (-876.762) (-878.202) [-878.222] * [-879.280] (-877.587) (-878.635) (-880.079) -- 0:00:41
473500 -- (-876.809) (-878.566) (-877.694) [-876.707] * (-879.465) [-877.605] (-881.510) (-878.016) -- 0:00:41
474000 -- (-878.123) (-879.268) (-880.755) [-878.039] * (-876.937) (-876.582) [-879.914] (-876.533) -- 0:00:41
474500 -- [-878.214] (-876.644) (-879.116) (-882.857) * (-877.328) [-875.611] (-878.997) (-877.856) -- 0:00:40
475000 -- [-877.397] (-879.003) (-878.608) (-877.852) * (-876.476) [-875.903] (-876.307) (-878.677) -- 0:00:40
Average standard deviation of split frequencies: 0.009845
475500 -- (-875.955) [-879.345] (-877.308) (-879.945) * [-876.476] (-878.148) (-876.405) (-876.702) -- 0:00:40
476000 -- [-878.396] (-877.267) (-877.644) (-876.988) * (-877.036) [-881.151] (-878.874) (-878.980) -- 0:00:40
476500 -- (-879.896) [-876.592] (-877.413) (-876.748) * [-878.374] (-879.140) (-876.763) (-879.459) -- 0:00:40
477000 -- (-877.039) (-883.991) [-877.410] (-879.698) * (-879.198) (-881.254) (-877.150) [-879.015] -- 0:00:40
477500 -- (-877.651) (-879.537) [-877.572] (-878.460) * (-875.938) (-879.560) [-878.941] (-876.415) -- 0:00:40
478000 -- (-879.612) (-879.071) [-877.819] (-879.616) * [-877.477] (-876.714) (-881.712) (-877.686) -- 0:00:40
478500 -- [-877.563] (-878.674) (-876.893) (-880.066) * (-878.478) (-878.360) [-879.240] (-876.975) -- 0:00:40
479000 -- (-876.593) (-878.107) (-880.525) [-879.204] * (-878.173) [-877.872] (-876.274) (-876.712) -- 0:00:40
479500 -- (-879.676) (-876.501) (-879.054) [-876.805] * [-877.665] (-880.248) (-883.521) (-878.240) -- 0:00:41
480000 -- (-884.204) [-877.581] (-877.984) (-879.401) * [-880.193] (-878.608) (-877.888) (-880.429) -- 0:00:41
Average standard deviation of split frequencies: 0.010038
480500 -- (-877.003) [-875.904] (-877.458) (-876.815) * [-877.223] (-877.948) (-878.554) (-877.968) -- 0:00:41
481000 -- (-875.956) (-877.010) (-876.761) [-875.744] * (-877.978) (-877.582) [-881.620] (-880.061) -- 0:00:41
481500 -- [-876.553] (-876.732) (-878.174) (-877.257) * (-879.096) [-878.595] (-877.268) (-876.767) -- 0:00:40
482000 -- (-876.261) (-880.287) [-879.606] (-875.895) * (-881.660) [-877.480] (-878.194) (-876.877) -- 0:00:40
482500 -- (-878.443) [-879.602] (-878.568) (-876.901) * (-877.721) (-877.142) (-882.696) [-877.689] -- 0:00:40
483000 -- (-876.723) (-876.342) (-878.230) [-878.190] * (-879.154) (-877.901) [-878.978] (-877.631) -- 0:00:40
483500 -- (-878.467) [-880.119] (-879.437) (-879.070) * (-879.134) [-875.979] (-875.631) (-876.466) -- 0:00:40
484000 -- (-882.758) (-886.973) (-877.682) [-879.703] * (-877.946) (-877.716) (-877.774) [-877.982] -- 0:00:40
484500 -- (-876.744) (-876.691) (-882.135) [-876.752] * [-876.454] (-879.798) (-875.784) (-882.913) -- 0:00:40
485000 -- [-877.573] (-882.567) (-877.005) (-876.723) * (-879.638) [-886.679] (-877.171) (-878.597) -- 0:00:40
Average standard deviation of split frequencies: 0.009807
485500 -- (-877.415) (-880.040) (-876.292) [-878.049] * (-879.023) [-877.925] (-877.438) (-880.238) -- 0:00:40
486000 -- (-877.874) (-877.798) [-879.499] (-875.781) * [-877.544] (-880.467) (-879.189) (-877.857) -- 0:00:40
486500 -- (-878.454) (-878.410) (-880.020) [-878.298] * (-878.041) (-878.317) (-878.329) [-877.439] -- 0:00:40
487000 -- (-882.187) [-876.793] (-876.935) (-878.388) * [-878.512] (-876.272) (-877.329) (-876.671) -- 0:00:40
487500 -- (-878.146) (-879.381) [-875.962] (-877.092) * (-876.581) [-876.035] (-878.772) (-878.708) -- 0:00:39
488000 -- (-881.270) [-879.811] (-879.023) (-876.871) * [-876.292] (-877.859) (-877.359) (-877.297) -- 0:00:39
488500 -- [-878.294] (-877.265) (-876.811) (-876.709) * [-876.469] (-878.413) (-876.299) (-878.394) -- 0:00:39
489000 -- (-877.843) (-877.056) [-876.990] (-878.818) * (-878.216) (-877.709) (-880.674) [-877.292] -- 0:00:39
489500 -- [-878.637] (-879.624) (-879.516) (-876.244) * (-882.752) [-879.795] (-883.494) (-878.000) -- 0:00:39
490000 -- (-876.898) (-878.884) (-877.799) [-876.226] * [-879.403] (-877.000) (-879.001) (-876.158) -- 0:00:39
Average standard deviation of split frequencies: 0.009664
490500 -- (-879.677) (-879.161) [-877.894] (-875.580) * (-876.991) [-877.358] (-882.905) (-879.718) -- 0:00:39
491000 -- (-878.872) (-878.848) [-876.027] (-876.597) * (-879.734) (-879.358) (-876.782) [-877.964] -- 0:00:39
491500 -- (-879.041) [-878.303] (-878.827) (-878.491) * (-880.269) (-879.032) (-876.676) [-881.373] -- 0:00:39
492000 -- [-879.184] (-877.142) (-877.459) (-878.958) * [-877.598] (-878.837) (-876.620) (-880.158) -- 0:00:40
492500 -- [-877.467] (-877.760) (-877.033) (-881.729) * (-877.353) (-879.135) (-879.672) [-880.165] -- 0:00:40
493000 -- (-876.408) [-878.130] (-878.246) (-878.329) * (-882.037) (-877.095) [-877.626] (-879.101) -- 0:00:40
493500 -- (-877.848) (-877.220) (-878.934) [-877.958] * (-881.605) [-879.231] (-878.301) (-879.651) -- 0:00:40
494000 -- (-877.759) (-879.914) [-884.305] (-882.977) * [-877.208] (-879.618) (-880.199) (-877.843) -- 0:00:39
494500 -- (-877.209) (-876.225) (-877.457) [-880.224] * (-878.662) (-877.239) (-876.440) [-881.550] -- 0:00:39
495000 -- (-877.095) (-878.127) (-877.108) [-877.762] * [-881.294] (-877.567) (-878.394) (-879.281) -- 0:00:39
Average standard deviation of split frequencies: 0.009504
495500 -- (-876.868) (-877.771) [-877.643] (-876.711) * (-878.392) [-876.741] (-880.930) (-877.561) -- 0:00:39
496000 -- (-880.205) [-876.613] (-877.084) (-877.978) * (-881.465) (-876.740) [-878.972] (-877.758) -- 0:00:39
496500 -- (-878.182) (-885.471) [-878.034] (-881.148) * (-880.921) (-882.411) [-878.427] (-878.979) -- 0:00:39
497000 -- (-878.477) (-876.305) [-879.104] (-878.685) * [-878.291] (-883.272) (-876.131) (-882.195) -- 0:00:39
497500 -- (-878.179) (-877.840) (-880.075) [-878.532] * (-876.156) (-878.843) (-876.408) [-875.972] -- 0:00:39
498000 -- (-878.133) (-879.272) [-875.734] (-879.775) * (-877.710) (-876.886) (-878.114) [-876.304] -- 0:00:39
498500 -- (-877.632) (-877.020) [-878.154] (-880.458) * (-877.239) (-878.134) [-877.352] (-876.931) -- 0:00:39
499000 -- (-876.226) (-876.479) (-875.948) [-877.620] * [-876.639] (-881.310) (-878.459) (-878.447) -- 0:00:39
499500 -- [-875.837] (-875.960) (-876.771) (-877.542) * [-878.099] (-878.370) (-875.623) (-877.016) -- 0:00:39
500000 -- (-876.359) [-875.955] (-880.498) (-876.511) * (-881.484) [-876.062] (-880.774) (-878.007) -- 0:00:39
Average standard deviation of split frequencies: 0.008806
500500 -- [-876.965] (-882.056) (-878.752) (-876.414) * (-876.069) [-876.775] (-876.608) (-878.544) -- 0:00:38
501000 -- (-875.613) (-876.824) (-877.668) [-876.901] * (-875.791) [-877.667] (-876.981) (-877.257) -- 0:00:38
501500 -- (-876.286) (-880.454) (-879.245) [-876.919] * (-876.345) [-876.861] (-879.630) (-875.905) -- 0:00:38
502000 -- (-877.946) (-877.265) [-876.722] (-878.818) * (-879.116) (-877.721) [-876.782] (-875.768) -- 0:00:38
502500 -- [-877.650] (-876.834) (-877.265) (-876.331) * [-879.754] (-879.785) (-877.400) (-875.768) -- 0:00:38
503000 -- (-880.366) (-876.530) (-876.689) [-879.746] * (-878.458) (-875.542) (-878.353) [-875.682] -- 0:00:38
503500 -- [-876.091] (-878.017) (-876.475) (-880.992) * (-882.433) (-877.173) (-877.432) [-876.434] -- 0:00:38
504000 -- (-876.444) [-878.723] (-878.115) (-876.860) * (-885.772) [-876.905] (-880.882) (-879.356) -- 0:00:38
504500 -- (-876.230) (-877.538) (-878.160) [-875.652] * (-878.249) [-877.239] (-881.871) (-877.929) -- 0:00:38
505000 -- (-880.410) [-878.020] (-876.979) (-877.099) * (-878.747) (-878.748) (-886.163) [-877.865] -- 0:00:39
Average standard deviation of split frequencies: 0.009472
505500 -- (-878.505) (-880.343) (-877.002) [-882.110] * (-876.606) [-879.041] (-880.655) (-876.862) -- 0:00:39
506000 -- (-876.370) (-878.568) (-876.443) [-878.606] * (-879.334) (-876.771) (-880.656) [-876.696] -- 0:00:39
506500 -- (-876.923) [-878.032] (-878.641) (-880.044) * (-880.295) (-876.194) [-878.007] (-877.075) -- 0:00:38
507000 -- (-876.728) [-876.547] (-877.142) (-876.606) * [-878.380] (-878.546) (-877.106) (-878.011) -- 0:00:38
507500 -- (-878.248) (-876.402) (-877.572) [-880.076] * (-877.751) (-878.595) (-876.558) [-879.099] -- 0:00:38
508000 -- [-876.782] (-876.412) (-879.642) (-877.668) * (-877.442) [-877.821] (-876.549) (-877.396) -- 0:00:38
508500 -- (-879.498) (-877.196) (-876.304) [-877.465] * (-877.960) (-877.198) [-876.683] (-883.604) -- 0:00:38
509000 -- (-876.548) (-876.688) (-876.177) [-878.049] * (-878.534) (-879.148) [-876.177] (-876.230) -- 0:00:38
509500 -- [-876.702] (-878.394) (-876.169) (-881.037) * (-881.749) (-877.552) [-875.550] (-876.887) -- 0:00:38
510000 -- [-876.533] (-877.331) (-882.027) (-878.146) * (-877.284) (-878.108) [-882.513] (-877.839) -- 0:00:38
Average standard deviation of split frequencies: 0.009744
510500 -- (-877.656) (-876.092) (-876.779) [-877.963] * (-879.072) (-881.690) [-875.968] (-877.633) -- 0:00:38
511000 -- (-876.456) (-877.422) [-875.987] (-881.882) * (-878.007) (-880.472) (-879.516) [-876.083] -- 0:00:38
511500 -- (-878.172) (-875.923) [-876.000] (-877.589) * (-877.450) (-877.028) [-876.449] (-876.600) -- 0:00:38
512000 -- [-877.515] (-878.065) (-878.996) (-878.848) * [-877.869] (-880.441) (-876.141) (-879.218) -- 0:00:38
512500 -- (-877.623) (-879.395) [-877.124] (-876.955) * [-876.717] (-880.972) (-877.939) (-877.834) -- 0:00:38
513000 -- [-876.113] (-878.519) (-877.727) (-877.019) * (-878.246) [-879.491] (-878.124) (-882.346) -- 0:00:37
513500 -- (-879.726) [-885.019] (-877.640) (-877.745) * (-878.062) [-876.683] (-879.820) (-879.408) -- 0:00:37
514000 -- (-878.954) (-880.378) [-877.738] (-880.482) * (-876.865) [-877.271] (-876.861) (-876.879) -- 0:00:37
514500 -- (-879.907) (-878.255) (-878.505) [-876.267] * (-876.589) (-878.336) [-879.459] (-877.597) -- 0:00:37
515000 -- (-876.926) (-876.768) [-879.081] (-877.253) * (-876.135) [-877.511] (-879.552) (-876.124) -- 0:00:37
Average standard deviation of split frequencies: 0.009694
515500 -- [-878.735] (-888.147) (-876.691) (-876.248) * [-876.930] (-879.086) (-876.879) (-879.712) -- 0:00:37
516000 -- (-879.157) (-884.023) [-876.935] (-881.907) * (-877.302) (-880.008) [-883.781] (-882.281) -- 0:00:37
516500 -- (-877.460) [-879.853] (-876.436) (-877.206) * (-881.827) [-877.045] (-876.924) (-876.558) -- 0:00:37
517000 -- (-881.999) (-876.144) (-878.713) [-880.814] * (-876.336) (-878.050) [-877.008] (-875.916) -- 0:00:37
517500 -- [-882.754] (-876.529) (-878.224) (-877.704) * (-877.821) (-882.775) [-879.064] (-877.566) -- 0:00:38
518000 -- (-879.699) [-876.607] (-880.299) (-878.612) * (-877.071) (-879.817) [-877.959] (-876.832) -- 0:00:38
518500 -- (-877.121) (-877.897) (-883.236) [-877.932] * (-879.020) [-876.310] (-876.704) (-878.566) -- 0:00:38
519000 -- (-877.120) (-878.356) (-876.566) [-878.921] * (-878.152) [-878.229] (-875.953) (-878.007) -- 0:00:37
519500 -- (-880.837) (-877.523) [-878.391] (-878.694) * (-875.698) [-877.904] (-876.588) (-876.843) -- 0:00:37
520000 -- (-876.983) [-878.848] (-878.128) (-883.324) * (-878.134) (-879.906) (-876.390) [-879.912] -- 0:00:37
Average standard deviation of split frequencies: 0.009107
520500 -- (-876.344) (-879.385) (-879.601) [-879.674] * [-876.072] (-877.332) (-877.568) (-877.474) -- 0:00:37
521000 -- (-881.002) [-878.082] (-877.028) (-876.315) * (-877.414) (-876.484) [-878.427] (-876.963) -- 0:00:37
521500 -- (-877.589) (-877.888) (-879.036) [-878.220] * (-877.674) (-876.822) [-877.817] (-877.869) -- 0:00:37
522000 -- [-876.684] (-876.241) (-876.583) (-882.931) * (-880.805) (-877.453) [-875.980] (-877.793) -- 0:00:37
522500 -- [-880.884] (-876.395) (-876.858) (-876.497) * (-878.727) (-876.719) [-877.144] (-879.073) -- 0:00:37
523000 -- (-880.330) (-877.747) (-876.230) [-876.264] * (-876.822) [-876.535] (-880.164) (-876.772) -- 0:00:37
523500 -- (-877.022) (-877.364) (-876.170) [-878.226] * (-875.823) (-881.069) [-876.070] (-876.458) -- 0:00:37
524000 -- [-878.082] (-880.205) (-876.143) (-876.781) * (-878.373) (-876.845) [-877.372] (-877.578) -- 0:00:37
524500 -- (-877.427) (-882.925) [-877.537] (-879.158) * (-879.151) (-877.670) [-877.293] (-876.206) -- 0:00:37
525000 -- [-875.697] (-878.319) (-876.747) (-878.779) * (-876.020) (-876.874) [-878.337] (-882.600) -- 0:00:37
Average standard deviation of split frequencies: 0.008435
525500 -- [-875.937] (-878.272) (-877.778) (-878.714) * (-878.884) (-876.784) [-876.975] (-877.524) -- 0:00:37
526000 -- [-875.564] (-878.302) (-875.567) (-878.301) * (-879.691) [-875.919] (-876.207) (-877.582) -- 0:00:36
526500 -- (-875.570) [-876.181] (-876.812) (-880.894) * (-878.920) (-875.877) [-878.769] (-879.741) -- 0:00:36
527000 -- (-876.314) (-876.348) (-877.445) [-878.179] * [-876.728] (-878.065) (-878.253) (-880.529) -- 0:00:36
527500 -- (-876.421) (-876.180) [-876.331] (-879.890) * (-876.692) [-879.004] (-876.906) (-879.857) -- 0:00:36
528000 -- (-877.209) (-877.850) (-880.347) [-876.556] * [-876.446] (-876.615) (-879.446) (-879.013) -- 0:00:36
528500 -- (-877.253) (-879.865) [-877.586] (-875.814) * [-880.792] (-878.328) (-877.865) (-876.809) -- 0:00:36
529000 -- (-879.105) (-877.937) (-882.689) [-876.772] * (-878.227) (-877.875) [-881.009] (-876.981) -- 0:00:36
529500 -- (-876.771) (-879.759) (-881.643) [-876.225] * (-876.602) (-876.379) (-879.688) [-877.535] -- 0:00:36
530000 -- [-876.999] (-876.394) (-879.844) (-877.302) * (-877.389) [-877.464] (-879.171) (-882.496) -- 0:00:36
Average standard deviation of split frequencies: 0.008328
530500 -- (-877.554) [-876.593] (-879.399) (-879.931) * (-877.646) (-877.315) (-878.578) [-876.232] -- 0:00:37
531000 -- (-878.044) (-876.805) [-876.616] (-878.715) * (-879.985) [-876.098] (-877.785) (-878.532) -- 0:00:37
531500 -- [-877.804] (-879.125) (-876.760) (-878.305) * [-877.484] (-878.835) (-877.827) (-877.322) -- 0:00:37
532000 -- (-879.952) (-876.864) [-876.574] (-881.245) * [-876.382] (-878.857) (-876.957) (-876.839) -- 0:00:36
532500 -- (-876.777) [-878.292] (-875.750) (-877.580) * (-882.096) (-877.917) (-879.058) [-877.125] -- 0:00:36
533000 -- (-876.878) [-880.818] (-876.560) (-876.514) * (-881.009) (-880.173) (-883.189) [-877.382] -- 0:00:36
533500 -- (-877.150) (-878.025) (-876.525) [-876.476] * (-878.971) (-877.068) [-876.877] (-878.808) -- 0:00:36
534000 -- (-877.295) (-877.606) (-878.291) [-881.998] * (-879.458) (-877.125) [-876.453] (-877.301) -- 0:00:36
534500 -- (-879.074) (-876.873) [-876.507] (-877.995) * (-879.942) (-880.759) [-876.401] (-876.908) -- 0:00:36
535000 -- (-881.640) [-878.035] (-877.643) (-878.890) * (-876.935) (-878.615) (-876.344) [-882.856] -- 0:00:36
Average standard deviation of split frequencies: 0.008520
535500 -- (-877.112) (-875.752) [-877.527] (-876.495) * [-876.542] (-878.260) (-876.035) (-877.965) -- 0:00:36
536000 -- (-876.903) [-876.545] (-879.745) (-877.134) * (-879.112) [-878.797] (-876.670) (-878.068) -- 0:00:36
536500 -- [-876.945] (-879.015) (-879.742) (-879.945) * (-878.868) (-879.169) (-877.027) [-876.669] -- 0:00:36
537000 -- (-880.412) [-877.297] (-876.388) (-878.565) * [-876.563] (-881.060) (-878.315) (-876.855) -- 0:00:36
537500 -- [-876.146] (-877.064) (-876.299) (-878.202) * [-875.456] (-878.302) (-876.716) (-876.183) -- 0:00:36
538000 -- (-883.979) (-877.373) [-876.694] (-876.708) * (-881.644) (-878.871) [-876.197] (-876.540) -- 0:00:36
538500 -- (-876.599) (-877.443) [-876.093] (-876.319) * (-877.190) [-879.189] (-877.546) (-876.275) -- 0:00:35
539000 -- [-882.063] (-876.516) (-876.396) (-880.852) * (-877.395) (-877.672) (-877.778) [-876.924] -- 0:00:35
539500 -- (-877.012) (-876.970) [-880.502] (-883.693) * [-878.428] (-877.573) (-876.353) (-877.898) -- 0:00:35
540000 -- (-876.836) [-877.798] (-876.595) (-883.808) * (-876.419) (-877.703) [-876.905] (-878.983) -- 0:00:35
Average standard deviation of split frequencies: 0.008828
540500 -- (-876.610) (-877.933) [-877.132] (-877.835) * (-877.651) [-877.033] (-880.534) (-877.431) -- 0:00:35
541000 -- (-877.123) [-877.311] (-877.139) (-879.417) * [-877.437] (-880.841) (-879.932) (-876.297) -- 0:00:35
541500 -- (-877.874) [-876.416] (-876.719) (-878.379) * [-878.035] (-880.852) (-876.422) (-876.239) -- 0:00:35
542000 -- (-878.683) [-876.777] (-877.031) (-877.396) * (-876.303) (-879.708) (-880.534) [-876.757] -- 0:00:35
542500 -- (-879.018) [-877.475] (-877.432) (-876.792) * (-876.490) (-880.788) (-878.607) [-878.329] -- 0:00:35
543000 -- (-880.288) (-880.714) [-877.642] (-881.006) * (-876.870) (-877.094) [-878.908] (-877.222) -- 0:00:35
543500 -- (-877.846) [-880.670] (-878.461) (-880.166) * (-875.958) (-876.059) (-876.774) [-876.811] -- 0:00:36
544000 -- [-876.139] (-877.674) (-876.566) (-879.358) * (-877.839) (-882.502) [-876.316] (-878.627) -- 0:00:36
544500 -- (-878.567) (-876.302) (-878.190) [-876.317] * (-878.947) (-880.913) [-876.018] (-878.574) -- 0:00:35
545000 -- (-876.868) (-877.674) (-876.548) [-877.066] * (-879.066) (-884.737) [-876.924] (-880.359) -- 0:00:35
Average standard deviation of split frequencies: 0.008850
545500 -- (-876.690) [-877.380] (-876.063) (-880.707) * [-882.123] (-877.872) (-877.958) (-877.362) -- 0:00:35
546000 -- [-876.518] (-877.429) (-878.838) (-877.927) * (-877.145) (-877.533) (-878.590) [-879.975] -- 0:00:35
546500 -- (-877.621) (-878.700) (-879.212) [-876.105] * [-876.337] (-879.587) (-881.844) (-881.831) -- 0:00:35
547000 -- (-877.715) (-877.110) (-884.473) [-876.467] * [-876.452] (-876.958) (-880.204) (-877.555) -- 0:00:35
547500 -- (-876.533) (-879.515) [-879.136] (-878.270) * [-879.237] (-877.041) (-876.088) (-876.823) -- 0:00:35
548000 -- [-876.303] (-878.238) (-880.891) (-878.192) * (-880.346) (-880.190) [-876.859] (-880.692) -- 0:00:35
548500 -- (-875.581) (-880.884) [-877.467] (-878.271) * (-878.031) (-877.228) (-876.533) [-876.223] -- 0:00:35
549000 -- [-881.032] (-879.246) (-878.376) (-876.963) * (-878.259) (-878.540) (-875.397) [-877.608] -- 0:00:35
549500 -- (-876.715) (-877.885) [-875.954] (-880.352) * [-879.908] (-879.289) (-875.474) (-880.101) -- 0:00:35
550000 -- [-879.699] (-876.514) (-878.440) (-876.859) * (-876.921) (-880.337) [-876.365] (-877.896) -- 0:00:35
Average standard deviation of split frequencies: 0.008561
550500 -- (-875.888) (-880.803) (-878.834) [-876.985] * [-876.683] (-877.977) (-877.295) (-876.397) -- 0:00:35
551000 -- [-877.426] (-878.740) (-880.661) (-877.236) * [-877.980] (-880.761) (-878.529) (-877.170) -- 0:00:35
551500 -- (-878.526) (-877.267) (-883.109) [-877.682] * (-880.351) [-884.508] (-877.149) (-877.407) -- 0:00:34
552000 -- (-879.513) (-878.038) [-880.387] (-876.323) * (-878.600) (-880.915) (-881.521) [-877.985] -- 0:00:34
552500 -- (-878.525) (-878.649) [-877.726] (-880.173) * (-876.838) (-876.552) [-877.179] (-879.602) -- 0:00:34
553000 -- [-879.338] (-878.427) (-876.402) (-877.382) * (-876.846) [-877.764] (-878.894) (-883.993) -- 0:00:34
553500 -- (-878.350) (-877.557) [-877.745] (-878.351) * (-884.071) (-877.746) (-880.136) [-883.016] -- 0:00:34
554000 -- (-882.571) (-876.409) [-877.989] (-877.527) * (-877.231) (-879.160) [-877.237] (-880.128) -- 0:00:34
554500 -- (-881.275) [-877.110] (-881.622) (-876.397) * (-876.350) (-877.491) (-877.999) [-879.047] -- 0:00:34
555000 -- (-876.300) (-879.067) (-879.441) [-878.552] * (-876.556) (-877.248) [-878.552] (-876.880) -- 0:00:34
Average standard deviation of split frequencies: 0.009376
555500 -- [-875.712] (-879.168) (-886.953) (-876.306) * (-880.958) (-877.124) [-881.751] (-877.066) -- 0:00:34
556000 -- (-876.495) (-876.635) (-880.581) [-875.955] * (-877.549) (-877.130) (-876.086) [-877.307] -- 0:00:34
556500 -- (-876.447) [-876.174] (-879.788) (-878.619) * (-876.073) (-879.567) (-876.936) [-877.318] -- 0:00:35
557000 -- (-877.919) (-879.559) (-884.623) [-877.230] * (-877.026) (-879.516) (-876.794) [-879.640] -- 0:00:34
557500 -- (-876.618) (-880.831) (-881.953) [-877.949] * (-878.543) (-879.248) [-879.507] (-878.288) -- 0:00:34
558000 -- [-878.339] (-876.259) (-876.728) (-880.634) * (-877.547) [-877.887] (-880.455) (-876.486) -- 0:00:34
558500 -- (-878.824) [-879.326] (-879.757) (-876.709) * (-876.066) [-877.718] (-879.466) (-879.742) -- 0:00:34
559000 -- (-879.316) (-879.147) (-877.507) [-877.989] * (-880.978) (-876.176) (-878.004) [-880.158] -- 0:00:34
559500 -- (-877.050) (-876.629) (-876.163) [-876.063] * (-877.143) [-877.400] (-879.544) (-880.896) -- 0:00:34
560000 -- (-878.698) [-877.991] (-880.312) (-882.507) * [-877.194] (-879.219) (-879.509) (-879.515) -- 0:00:34
Average standard deviation of split frequencies: 0.009641
560500 -- [-879.056] (-877.696) (-879.707) (-879.106) * [-878.226] (-882.194) (-879.235) (-877.383) -- 0:00:34
561000 -- (-878.361) (-880.566) [-878.297] (-876.691) * (-879.359) [-877.118] (-877.133) (-880.049) -- 0:00:34
561500 -- (-877.657) (-877.097) (-878.542) [-877.979] * (-876.997) [-877.173] (-877.043) (-878.684) -- 0:00:34
562000 -- (-880.442) (-879.054) (-877.140) [-881.174] * (-875.955) (-877.362) (-877.060) [-879.763] -- 0:00:34
562500 -- (-879.959) (-879.933) [-877.644] (-877.213) * (-878.189) (-877.626) (-876.779) [-875.400] -- 0:00:34
563000 -- (-877.841) (-877.035) [-878.112] (-877.217) * (-875.986) [-876.319] (-881.471) (-875.978) -- 0:00:34
563500 -- (-877.536) (-878.477) [-878.780] (-876.325) * (-877.799) (-877.836) [-880.298] (-877.543) -- 0:00:34
564000 -- [-878.295] (-879.475) (-886.873) (-878.641) * [-876.886] (-877.249) (-878.331) (-876.820) -- 0:00:34
564500 -- (-878.673) [-878.390] (-880.311) (-879.030) * (-876.885) (-877.240) (-878.241) [-877.398] -- 0:00:33
565000 -- (-877.915) [-880.558] (-877.756) (-884.419) * (-876.746) (-876.754) [-878.049] (-878.807) -- 0:00:33
Average standard deviation of split frequencies: 0.009162
565500 -- [-878.222] (-880.479) (-880.006) (-876.209) * [-877.196] (-877.868) (-876.734) (-879.492) -- 0:00:33
566000 -- [-876.960] (-879.013) (-878.795) (-876.420) * [-877.207] (-879.840) (-880.115) (-876.744) -- 0:00:33
566500 -- [-877.501] (-878.623) (-880.118) (-876.765) * [-877.037] (-877.288) (-878.104) (-878.898) -- 0:00:33
567000 -- (-876.798) [-877.309] (-877.417) (-882.222) * (-877.920) [-876.252] (-878.729) (-880.793) -- 0:00:33
567500 -- (-876.087) (-878.087) [-876.244] (-877.833) * (-878.701) [-878.345] (-879.575) (-878.520) -- 0:00:33
568000 -- (-878.053) [-878.765] (-875.787) (-877.953) * (-876.425) [-876.406] (-877.564) (-876.525) -- 0:00:33
568500 -- (-876.837) [-876.803] (-877.344) (-876.747) * (-876.495) (-877.638) [-877.441] (-875.889) -- 0:00:33
569000 -- (-878.870) [-876.950] (-880.617) (-877.848) * (-877.969) (-878.137) (-881.934) [-876.713] -- 0:00:33
569500 -- (-877.985) (-878.590) [-878.492] (-880.649) * (-879.122) (-878.202) (-878.127) [-877.393] -- 0:00:34
570000 -- (-876.690) [-880.955] (-877.071) (-879.387) * (-880.327) (-876.750) [-878.679] (-876.540) -- 0:00:33
Average standard deviation of split frequencies: 0.008415
570500 -- (-876.883) (-877.476) [-880.332] (-880.774) * (-884.478) (-876.488) [-877.448] (-876.132) -- 0:00:33
571000 -- [-876.376] (-877.572) (-881.957) (-879.929) * (-879.055) (-877.141) [-876.740] (-878.283) -- 0:00:33
571500 -- (-879.102) (-879.592) [-879.537] (-876.394) * (-880.461) (-875.765) [-876.739] (-879.505) -- 0:00:33
572000 -- [-876.496] (-880.647) (-881.916) (-880.779) * [-877.024] (-880.772) (-876.746) (-880.527) -- 0:00:33
572500 -- (-878.651) [-876.297] (-879.283) (-877.954) * [-878.086] (-877.499) (-883.100) (-878.046) -- 0:00:33
573000 -- (-879.488) (-876.613) [-878.851] (-876.948) * (-880.968) (-877.041) (-878.334) [-876.392] -- 0:00:33
573500 -- (-880.794) [-879.755] (-876.523) (-879.024) * [-878.315] (-876.094) (-876.346) (-876.897) -- 0:00:33
574000 -- (-879.803) (-876.131) (-877.178) [-875.822] * (-881.957) (-876.212) (-877.178) [-877.935] -- 0:00:33
574500 -- (-882.309) (-876.398) (-879.223) [-876.229] * (-879.649) (-881.330) [-878.439] (-876.238) -- 0:00:33
575000 -- (-887.348) [-876.033] (-881.900) (-875.958) * (-881.423) [-877.473] (-877.553) (-879.748) -- 0:00:33
Average standard deviation of split frequencies: 0.008133
575500 -- (-876.621) (-879.698) [-877.484] (-877.373) * (-877.856) [-876.676] (-878.677) (-877.211) -- 0:00:33
576000 -- [-876.550] (-878.325) (-885.386) (-877.128) * [-876.765] (-878.018) (-877.654) (-879.634) -- 0:00:33
576500 -- (-877.175) (-878.638) (-878.306) [-880.372] * [-877.759] (-875.573) (-881.667) (-882.061) -- 0:00:33
577000 -- [-877.807] (-876.717) (-876.961) (-878.352) * (-876.013) [-876.834] (-877.871) (-877.039) -- 0:00:32
577500 -- (-878.149) (-877.070) (-880.274) [-877.517] * [-875.712] (-878.660) (-876.856) (-880.890) -- 0:00:32
578000 -- (-876.640) [-879.888] (-881.477) (-876.774) * (-877.703) [-878.923] (-876.103) (-878.547) -- 0:00:32
578500 -- (-877.656) [-876.667] (-875.695) (-879.577) * (-879.076) (-878.923) (-877.902) [-877.560] -- 0:00:32
579000 -- [-876.279] (-876.665) (-877.056) (-881.274) * [-878.759] (-881.589) (-879.906) (-878.074) -- 0:00:32
579500 -- (-876.599) (-876.979) [-877.119] (-879.731) * (-879.385) (-881.607) [-877.019] (-877.807) -- 0:00:32
580000 -- [-877.099] (-875.925) (-879.468) (-886.551) * (-877.140) (-876.588) (-876.386) [-877.148] -- 0:00:32
Average standard deviation of split frequencies: 0.008372
580500 -- [-877.019] (-878.570) (-876.866) (-881.028) * (-877.251) (-877.610) [-875.831] (-883.813) -- 0:00:32
581000 -- [-878.054] (-877.929) (-877.375) (-877.499) * (-876.519) (-877.241) (-877.539) [-877.004] -- 0:00:32
581500 -- [-876.747] (-875.706) (-879.479) (-880.081) * (-877.428) (-876.796) (-876.349) [-880.110] -- 0:00:32
582000 -- [-881.187] (-876.401) (-880.306) (-879.331) * (-877.641) [-879.432] (-876.682) (-884.010) -- 0:00:32
582500 -- (-877.481) (-879.186) (-876.592) [-879.735] * [-878.930] (-878.261) (-875.508) (-878.428) -- 0:00:32
583000 -- [-876.188] (-877.709) (-876.467) (-878.939) * (-879.303) (-877.797) (-875.795) [-877.161] -- 0:00:32
583500 -- (-877.940) (-876.931) [-875.992] (-880.304) * [-878.963] (-879.688) (-878.144) (-880.963) -- 0:00:32
584000 -- (-879.182) (-877.065) (-881.721) [-876.186] * (-877.199) [-877.485] (-879.152) (-877.833) -- 0:00:32
584500 -- [-877.105] (-876.715) (-878.524) (-876.186) * [-878.164] (-879.300) (-877.716) (-877.508) -- 0:00:32
585000 -- (-876.654) [-876.467] (-876.297) (-878.191) * (-877.917) [-878.650] (-876.715) (-880.029) -- 0:00:32
Average standard deviation of split frequencies: 0.008497
585500 -- (-876.057) [-879.193] (-876.446) (-879.509) * (-877.155) (-876.370) (-878.517) [-878.597] -- 0:00:32
586000 -- (-876.532) (-879.348) (-878.671) [-877.086] * (-877.111) (-880.419) (-880.428) [-878.542] -- 0:00:32
586500 -- [-876.455] (-884.122) (-879.100) (-878.696) * [-876.954] (-877.015) (-881.328) (-875.859) -- 0:00:32
587000 -- (-876.284) (-879.001) (-876.839) [-879.067] * (-878.256) [-875.643] (-878.239) (-877.711) -- 0:00:32
587500 -- [-876.031] (-878.504) (-876.464) (-879.693) * (-876.478) (-878.128) (-877.506) [-879.386] -- 0:00:32
588000 -- (-876.165) (-881.295) (-878.224) [-876.515] * (-876.452) [-877.558] (-876.844) (-877.265) -- 0:00:32
588500 -- (-876.099) (-877.667) (-879.672) [-877.389] * (-876.572) (-876.289) (-877.720) [-876.348] -- 0:00:32
589000 -- [-877.618] (-877.264) (-876.323) (-876.050) * (-875.734) (-879.535) [-878.496] (-876.925) -- 0:00:32
589500 -- [-878.008] (-878.509) (-876.772) (-879.081) * (-879.719) (-879.054) (-878.985) [-877.845] -- 0:00:32
590000 -- [-876.987] (-876.760) (-879.660) (-875.626) * [-876.590] (-878.470) (-881.748) (-877.726) -- 0:00:31
Average standard deviation of split frequencies: 0.008679
590500 -- (-877.605) (-877.825) (-876.206) [-878.392] * [-878.777] (-877.499) (-878.747) (-880.108) -- 0:00:31
591000 -- (-878.941) (-877.200) [-879.676] (-875.959) * (-877.839) (-879.440) [-875.961] (-882.825) -- 0:00:31
591500 -- (-881.495) (-882.060) [-881.088] (-880.669) * (-877.794) (-879.912) [-876.656] (-876.314) -- 0:00:31
592000 -- [-878.858] (-878.499) (-878.351) (-877.051) * (-879.680) (-878.886) (-877.458) [-877.279] -- 0:00:31
592500 -- (-883.085) [-879.313] (-877.156) (-877.631) * (-879.637) (-879.993) [-878.042] (-878.510) -- 0:00:31
593000 -- [-878.662] (-877.006) (-878.586) (-878.615) * (-879.608) (-877.366) [-877.826] (-877.418) -- 0:00:31
593500 -- [-878.452] (-877.296) (-881.212) (-877.195) * [-880.291] (-878.118) (-876.693) (-877.608) -- 0:00:31
594000 -- (-879.688) (-877.568) (-878.706) [-877.445] * [-878.258] (-879.691) (-877.211) (-877.843) -- 0:00:31
594500 -- [-876.342] (-875.522) (-877.166) (-879.000) * (-877.934) (-878.635) (-876.003) [-876.963] -- 0:00:31
595000 -- (-876.966) [-876.113] (-877.003) (-880.094) * [-877.540] (-878.170) (-876.149) (-878.053) -- 0:00:31
Average standard deviation of split frequencies: 0.009491
595500 -- (-876.053) (-876.562) (-878.282) [-876.312] * (-878.263) (-877.522) [-876.469] (-876.898) -- 0:00:31
596000 -- (-877.825) [-876.885] (-876.089) (-880.735) * (-881.580) [-876.505] (-878.473) (-881.689) -- 0:00:31
596500 -- [-877.456] (-877.734) (-876.836) (-882.920) * (-879.196) (-876.296) (-880.256) [-880.005] -- 0:00:31
597000 -- [-875.932] (-879.167) (-877.891) (-878.129) * (-876.485) [-877.761] (-878.159) (-879.492) -- 0:00:31
597500 -- (-877.760) (-878.075) [-880.942] (-881.418) * (-881.117) (-877.452) [-878.163] (-877.988) -- 0:00:31
598000 -- (-880.299) [-876.341] (-878.659) (-882.759) * (-876.748) (-875.982) (-877.710) [-880.844] -- 0:00:31
598500 -- [-875.875] (-876.658) (-879.015) (-877.614) * (-876.226) (-880.261) (-878.294) [-883.800] -- 0:00:31
599000 -- [-878.537] (-884.632) (-877.680) (-879.249) * [-876.196] (-876.713) (-876.689) (-883.458) -- 0:00:31
599500 -- (-879.031) (-876.117) [-876.408] (-879.921) * (-880.139) (-878.820) [-878.599] (-880.997) -- 0:00:31
600000 -- [-877.609] (-878.637) (-881.775) (-878.040) * (-878.348) [-877.906] (-876.938) (-876.683) -- 0:00:31
Average standard deviation of split frequencies: 0.009627
600500 -- (-877.161) [-876.163] (-880.751) (-877.031) * (-881.953) (-877.475) (-876.517) [-876.281] -- 0:00:31
601000 -- (-882.691) [-881.732] (-876.925) (-876.400) * (-880.480) (-879.380) (-877.686) [-879.728] -- 0:00:31
601500 -- [-876.455] (-880.125) (-877.152) (-877.163) * [-875.853] (-875.841) (-877.686) (-880.083) -- 0:00:31
602000 -- (-875.431) [-882.338] (-878.161) (-876.372) * (-875.950) (-875.490) (-880.573) [-879.158] -- 0:00:31
602500 -- (-876.458) (-879.303) [-878.025] (-876.659) * (-877.289) (-876.367) [-879.558] (-880.974) -- 0:00:31
603000 -- [-878.800] (-876.524) (-879.277) (-877.374) * [-877.184] (-875.607) (-876.257) (-879.223) -- 0:00:30
603500 -- [-878.847] (-876.733) (-876.861) (-876.516) * [-876.668] (-876.700) (-880.971) (-877.037) -- 0:00:30
604000 -- (-878.907) [-876.494] (-876.776) (-878.616) * (-876.317) (-876.782) [-878.925] (-878.821) -- 0:00:30
604500 -- (-878.762) (-876.881) [-879.251] (-883.657) * (-876.934) (-879.586) (-877.779) [-878.079] -- 0:00:30
605000 -- [-876.886] (-876.922) (-876.879) (-881.223) * (-879.607) (-877.825) (-881.395) [-877.892] -- 0:00:30
Average standard deviation of split frequencies: 0.009383
605500 -- [-875.499] (-876.111) (-875.679) (-876.278) * (-881.090) (-876.976) [-877.722] (-876.768) -- 0:00:30
606000 -- (-877.286) (-876.182) (-878.291) [-877.090] * (-880.160) (-876.981) (-877.887) [-878.179] -- 0:00:30
606500 -- [-877.637] (-879.667) (-880.148) (-876.839) * (-881.522) (-879.460) (-882.051) [-879.721] -- 0:00:30
607000 -- (-878.651) [-876.085] (-880.885) (-878.464) * [-877.296] (-876.673) (-882.887) (-877.274) -- 0:00:30
607500 -- [-877.704] (-879.465) (-876.030) (-880.895) * (-876.811) (-878.222) (-886.275) [-877.033] -- 0:00:30
608000 -- [-879.686] (-878.627) (-879.797) (-880.348) * (-877.574) (-879.214) [-885.270] (-878.614) -- 0:00:30
608500 -- (-880.755) [-880.760] (-877.781) (-878.925) * (-880.191) [-875.901] (-880.788) (-876.453) -- 0:00:30
609000 -- (-877.668) (-878.728) (-876.433) [-876.102] * (-876.607) (-876.948) [-880.635] (-879.985) -- 0:00:30
609500 -- (-878.572) (-880.317) [-877.536] (-878.083) * (-878.776) [-877.641] (-877.501) (-879.086) -- 0:00:30
610000 -- (-876.368) (-878.632) [-879.658] (-881.719) * (-887.457) (-877.740) (-880.727) [-877.458] -- 0:00:30
Average standard deviation of split frequencies: 0.010087
610500 -- (-877.628) [-877.807] (-879.845) (-877.121) * (-879.253) (-876.846) (-877.546) [-879.169] -- 0:00:30
611000 -- (-879.530) [-875.908] (-877.262) (-883.665) * (-878.500) [-877.421] (-880.430) (-876.863) -- 0:00:30
611500 -- (-876.125) (-880.078) [-876.192] (-877.844) * (-881.087) [-876.853] (-877.961) (-876.408) -- 0:00:30
612000 -- [-877.861] (-879.097) (-882.134) (-880.204) * (-876.532) [-876.615] (-880.659) (-877.119) -- 0:00:30
612500 -- [-876.244] (-878.841) (-876.975) (-876.223) * (-877.804) (-875.782) [-878.065] (-876.575) -- 0:00:30
613000 -- (-879.622) (-878.749) [-878.716] (-883.377) * (-877.349) (-875.760) [-879.598] (-876.144) -- 0:00:30
613500 -- (-883.164) [-880.410] (-877.065) (-877.336) * (-878.360) [-875.671] (-882.530) (-877.412) -- 0:00:30
614000 -- (-876.630) (-876.608) (-876.345) [-877.693] * (-876.481) (-883.093) [-876.808] (-878.474) -- 0:00:30
614500 -- [-878.149] (-876.426) (-875.699) (-877.628) * (-876.798) (-876.060) (-875.785) [-878.574] -- 0:00:30
615000 -- (-878.249) [-877.489] (-877.665) (-877.570) * (-877.865) (-879.680) (-875.808) [-876.342] -- 0:00:30
Average standard deviation of split frequencies: 0.009999
615500 -- [-882.921] (-879.604) (-881.236) (-877.489) * (-878.172) (-879.016) (-881.934) [-878.807] -- 0:00:29
616000 -- [-877.551] (-876.673) (-876.663) (-878.540) * (-877.211) (-877.619) [-876.338] (-878.752) -- 0:00:29
616500 -- (-878.759) [-877.489] (-879.278) (-882.311) * (-877.984) (-881.072) [-876.982] (-877.012) -- 0:00:29
617000 -- (-879.808) (-876.893) [-876.284] (-881.352) * (-879.019) (-878.815) (-880.010) [-875.900] -- 0:00:29
617500 -- [-880.287] (-877.721) (-878.243) (-880.822) * [-877.260] (-880.041) (-879.668) (-875.895) -- 0:00:29
618000 -- (-878.985) (-880.754) [-878.041] (-878.906) * (-876.433) (-876.307) [-875.811] (-877.401) -- 0:00:29
618500 -- [-875.483] (-879.595) (-880.869) (-880.397) * [-877.879] (-877.641) (-875.748) (-878.554) -- 0:00:29
619000 -- (-878.208) [-876.608] (-878.043) (-879.134) * (-879.578) (-878.375) (-876.762) [-876.036] -- 0:00:29
619500 -- (-879.157) (-877.297) (-877.152) [-882.394] * [-881.439] (-878.354) (-880.438) (-877.482) -- 0:00:29
620000 -- (-876.748) (-877.101) [-876.637] (-878.807) * [-878.390] (-877.267) (-877.521) (-878.481) -- 0:00:29
Average standard deviation of split frequencies: 0.009469
620500 -- (-877.951) (-876.244) [-876.266] (-877.023) * (-876.685) [-878.456] (-880.486) (-876.132) -- 0:00:29
621000 -- [-877.415] (-879.993) (-879.171) (-882.648) * (-876.753) [-878.755] (-876.384) (-877.864) -- 0:00:29
621500 -- (-878.526) (-877.828) [-876.510] (-876.117) * (-876.506) (-876.397) [-879.042] (-877.518) -- 0:00:29
622000 -- [-878.390] (-877.704) (-875.970) (-878.697) * (-876.022) (-877.534) (-877.199) [-878.081] -- 0:00:29
622500 -- (-878.680) (-877.375) (-879.036) [-880.739] * [-879.097] (-875.829) (-877.007) (-877.724) -- 0:00:29
623000 -- (-879.794) (-877.301) (-875.978) [-876.228] * (-880.373) [-875.470] (-875.915) (-878.339) -- 0:00:29
623500 -- (-879.764) [-878.634] (-882.057) (-877.113) * (-878.855) [-876.463] (-878.132) (-878.139) -- 0:00:29
624000 -- (-881.789) (-876.228) (-878.534) [-876.376] * (-879.104) (-876.032) [-876.701] (-883.403) -- 0:00:29
624500 -- [-876.358] (-878.555) (-878.144) (-875.591) * (-878.915) [-877.045] (-877.983) (-879.711) -- 0:00:29
625000 -- (-877.767) (-877.171) (-876.861) [-875.742] * (-878.551) (-878.018) (-885.693) [-880.487] -- 0:00:29
Average standard deviation of split frequencies: 0.009589
625500 -- (-877.515) [-878.009] (-876.015) (-876.923) * [-877.020] (-881.326) (-876.936) (-879.467) -- 0:00:29
626000 -- (-878.629) (-880.534) (-877.242) [-875.352] * [-876.838] (-881.566) (-875.872) (-877.765) -- 0:00:29
626500 -- (-882.340) (-878.630) (-875.535) [-876.420] * (-878.618) [-877.234] (-877.575) (-877.641) -- 0:00:29
627000 -- (-879.590) (-877.714) (-875.510) [-877.803] * (-882.609) (-876.650) [-876.343] (-877.690) -- 0:00:29
627500 -- (-878.066) (-877.876) (-876.165) [-877.018] * (-879.277) (-879.099) (-876.395) [-880.171] -- 0:00:29
628000 -- [-877.213] (-878.024) (-876.960) (-878.274) * (-876.974) [-878.803] (-877.840) (-877.437) -- 0:00:29
628500 -- (-877.968) (-877.698) (-881.746) [-878.198] * (-878.506) [-878.501] (-878.618) (-880.447) -- 0:00:28
629000 -- (-876.664) [-879.839] (-880.637) (-879.602) * [-877.038] (-880.645) (-878.496) (-877.394) -- 0:00:28
629500 -- [-877.207] (-879.649) (-877.831) (-878.232) * (-877.215) (-877.880) (-878.223) [-876.381] -- 0:00:28
630000 -- (-876.273) [-879.341] (-878.470) (-877.043) * (-878.666) (-877.060) [-876.693] (-878.666) -- 0:00:28
Average standard deviation of split frequencies: 0.009368
630500 -- (-878.571) (-880.664) (-876.793) [-880.644] * (-877.114) (-877.338) (-880.568) [-877.105] -- 0:00:28
631000 -- (-876.211) [-878.842] (-882.353) (-876.554) * (-879.017) (-876.455) [-878.356] (-879.413) -- 0:00:28
631500 -- (-875.972) (-880.539) (-876.655) [-878.612] * (-880.396) (-877.454) (-877.731) [-880.216] -- 0:00:28
632000 -- (-877.131) (-877.866) (-878.328) [-877.205] * (-876.921) (-878.779) (-880.962) [-876.343] -- 0:00:28
632500 -- (-877.234) [-877.302] (-877.787) (-877.815) * (-878.025) (-877.465) (-878.090) [-876.806] -- 0:00:28
633000 -- [-878.175] (-878.287) (-877.646) (-881.636) * (-877.642) [-880.082] (-880.534) (-876.610) -- 0:00:28
633500 -- (-880.426) [-880.218] (-880.620) (-877.623) * [-875.935] (-878.829) (-880.080) (-877.409) -- 0:00:28
634000 -- (-878.425) (-878.791) (-883.294) [-877.753] * [-877.702] (-878.318) (-877.792) (-875.715) -- 0:00:28
634500 -- (-879.900) [-876.318] (-878.634) (-876.596) * [-878.535] (-877.447) (-879.956) (-876.521) -- 0:00:28
635000 -- (-882.476) (-878.073) [-877.227] (-881.504) * [-881.873] (-878.753) (-879.136) (-876.743) -- 0:00:28
Average standard deviation of split frequencies: 0.009589
635500 -- (-877.627) (-878.961) (-876.655) [-877.001] * (-876.571) (-878.930) [-882.627] (-875.756) -- 0:00:28
636000 -- (-876.428) (-877.727) [-877.610] (-876.470) * (-878.988) (-882.568) [-881.815] (-876.907) -- 0:00:28
636500 -- (-877.754) (-876.871) [-877.389] (-876.962) * (-880.019) (-876.037) [-877.701] (-876.695) -- 0:00:28
637000 -- (-881.007) [-879.118] (-876.719) (-876.509) * [-876.669] (-876.124) (-879.172) (-877.127) -- 0:00:28
637500 -- [-877.150] (-877.204) (-875.865) (-877.776) * [-878.874] (-875.919) (-878.253) (-876.818) -- 0:00:28
638000 -- (-879.517) [-878.157] (-879.682) (-883.501) * [-878.031] (-879.240) (-879.437) (-876.115) -- 0:00:28
638500 -- (-878.461) [-875.689] (-879.040) (-881.378) * (-877.426) (-876.872) (-877.228) [-877.132] -- 0:00:28
639000 -- (-878.558) (-877.358) [-876.839] (-877.260) * (-877.853) [-876.953] (-875.996) (-877.992) -- 0:00:28
639500 -- (-877.000) (-875.446) (-877.003) [-877.258] * [-877.962] (-876.530) (-876.677) (-878.965) -- 0:00:28
640000 -- (-876.749) (-875.800) (-877.021) [-876.545] * (-877.227) (-877.585) (-877.114) [-875.680] -- 0:00:28
Average standard deviation of split frequencies: 0.009749
640500 -- (-875.763) (-878.313) [-877.755] (-876.873) * (-876.747) (-879.187) [-877.444] (-878.808) -- 0:00:28
641000 -- [-877.842] (-877.021) (-876.748) (-880.706) * (-876.583) (-879.910) [-877.328] (-877.950) -- 0:00:28
641500 -- [-879.434] (-876.431) (-876.280) (-878.709) * (-876.629) (-878.990) [-876.145] (-880.441) -- 0:00:27
642000 -- (-879.546) [-876.400] (-876.286) (-878.095) * [-877.407] (-877.610) (-876.425) (-879.634) -- 0:00:27
642500 -- (-878.077) (-876.448) (-876.472) [-876.866] * [-877.309] (-877.755) (-876.448) (-877.433) -- 0:00:27
643000 -- (-880.294) (-876.691) [-877.744] (-878.035) * [-877.094] (-878.285) (-881.533) (-878.970) -- 0:00:27
643500 -- [-880.808] (-876.677) (-879.065) (-878.834) * (-877.171) (-876.459) [-878.905] (-876.538) -- 0:00:27
644000 -- (-877.735) [-876.082] (-877.703) (-877.964) * (-881.037) [-876.524] (-877.723) (-877.999) -- 0:00:27
644500 -- [-876.743] (-875.702) (-876.704) (-877.202) * (-880.732) (-876.364) [-875.683] (-876.911) -- 0:00:27
645000 -- (-878.249) (-879.193) (-878.159) [-877.591] * (-878.052) (-875.675) [-875.789] (-875.923) -- 0:00:27
Average standard deviation of split frequencies: 0.010070
645500 -- [-882.454] (-877.472) (-877.082) (-877.148) * (-877.212) [-876.226] (-877.790) (-876.926) -- 0:00:27
646000 -- [-878.358] (-876.035) (-876.290) (-876.574) * (-877.020) (-879.331) [-876.820] (-879.740) -- 0:00:27
646500 -- (-879.828) [-877.775] (-878.270) (-877.500) * (-877.071) (-877.491) [-876.071] (-876.933) -- 0:00:27
647000 -- [-876.618] (-876.402) (-876.494) (-875.797) * (-878.123) [-877.787] (-878.993) (-882.761) -- 0:00:27
647500 -- (-876.943) [-877.203] (-878.332) (-875.963) * [-877.456] (-879.497) (-878.039) (-877.511) -- 0:00:27
648000 -- (-877.408) [-877.230] (-876.769) (-877.711) * (-877.377) (-878.418) (-877.491) [-875.907] -- 0:00:27
648500 -- (-877.146) (-876.935) [-876.261] (-877.736) * [-878.592] (-876.079) (-879.863) (-876.434) -- 0:00:27
649000 -- [-875.758] (-877.474) (-878.730) (-875.900) * (-876.783) [-877.143] (-876.039) (-878.597) -- 0:00:27
649500 -- [-877.857] (-881.484) (-876.981) (-877.025) * (-876.152) (-876.257) (-881.025) [-878.265] -- 0:00:27
650000 -- [-876.578] (-879.133) (-878.241) (-876.360) * [-876.616] (-882.834) (-876.844) (-883.239) -- 0:00:27
Average standard deviation of split frequencies: 0.009962
650500 -- (-878.438) (-880.421) (-877.859) [-876.939] * [-879.099] (-876.934) (-879.267) (-882.348) -- 0:00:27
651000 -- (-878.857) (-876.357) [-877.810] (-876.523) * (-880.323) [-877.932] (-880.506) (-878.781) -- 0:00:27
651500 -- (-878.331) [-877.485] (-877.760) (-879.254) * (-878.207) (-878.161) [-876.447] (-879.913) -- 0:00:27
652000 -- [-877.181] (-879.031) (-876.710) (-877.571) * (-876.678) (-877.822) [-877.043] (-877.698) -- 0:00:27
652500 -- [-877.248] (-878.681) (-880.752) (-877.740) * (-878.856) (-876.902) (-878.238) [-878.084] -- 0:00:27
653000 -- (-876.876) (-878.245) [-883.092] (-877.195) * (-881.329) [-877.537] (-877.915) (-880.078) -- 0:00:27
653500 -- (-876.995) (-881.097) [-877.754] (-879.659) * (-877.564) (-875.772) (-876.055) [-881.413] -- 0:00:27
654000 -- [-875.605] (-879.639) (-876.554) (-880.742) * (-876.839) (-875.786) [-877.505] (-883.062) -- 0:00:26
654500 -- (-876.231) (-876.641) (-878.562) [-879.872] * [-878.584] (-878.114) (-877.045) (-880.265) -- 0:00:26
655000 -- (-877.501) (-877.464) (-877.337) [-877.713] * (-880.614) (-878.531) [-876.916] (-875.751) -- 0:00:26
Average standard deviation of split frequencies: 0.010348
655500 -- [-878.709] (-877.483) (-876.024) (-876.486) * (-878.880) (-879.435) [-879.665] (-876.127) -- 0:00:26
656000 -- [-878.341] (-876.345) (-875.985) (-878.760) * [-878.243] (-877.687) (-877.838) (-876.922) -- 0:00:26
656500 -- (-878.722) (-877.190) (-877.127) [-877.115] * (-876.609) (-885.815) (-881.469) [-877.299] -- 0:00:26
657000 -- (-878.972) (-878.402) (-875.958) [-879.853] * [-876.565] (-879.165) (-875.715) (-877.161) -- 0:00:26
657500 -- (-876.910) [-877.715] (-876.680) (-877.380) * (-876.991) (-877.174) [-875.673] (-876.628) -- 0:00:26
658000 -- (-876.348) [-876.784] (-876.546) (-880.797) * (-876.973) [-875.869] (-877.825) (-875.999) -- 0:00:26
658500 -- (-877.792) (-876.835) [-877.276] (-882.344) * (-880.211) (-877.964) [-875.964] (-875.898) -- 0:00:26
659000 -- [-877.977] (-876.424) (-878.964) (-882.144) * (-876.559) [-878.790] (-875.911) (-876.650) -- 0:00:26
659500 -- (-880.035) (-876.474) [-877.409] (-877.992) * (-876.904) (-879.115) (-880.010) [-878.655] -- 0:00:26
660000 -- (-879.587) (-880.500) [-877.015] (-878.876) * (-876.765) (-879.821) [-878.765] (-879.035) -- 0:00:26
Average standard deviation of split frequencies: 0.010322
660500 -- [-880.327] (-881.353) (-877.619) (-885.834) * [-877.542] (-880.019) (-883.208) (-879.124) -- 0:00:26
661000 -- (-882.380) [-882.398] (-879.994) (-877.934) * (-877.847) (-880.290) (-877.546) [-877.167] -- 0:00:26
661500 -- (-879.922) [-881.206] (-877.458) (-877.240) * (-876.518) (-884.685) [-880.607] (-877.177) -- 0:00:26
662000 -- (-879.884) (-878.955) [-877.137] (-876.744) * (-875.574) (-878.826) [-881.936] (-879.705) -- 0:00:26
662500 -- (-876.023) (-877.787) [-876.819] (-876.396) * (-876.457) (-877.330) [-877.894] (-880.584) -- 0:00:26
663000 -- (-875.700) (-880.351) [-878.282] (-876.081) * (-875.899) [-876.149] (-877.870) (-883.030) -- 0:00:26
663500 -- (-877.798) [-878.024] (-880.829) (-881.025) * (-881.488) [-876.020] (-881.874) (-880.465) -- 0:00:26
664000 -- [-877.689] (-880.294) (-875.972) (-877.212) * (-879.663) (-877.211) [-877.963] (-878.161) -- 0:00:26
664500 -- [-877.340] (-876.752) (-877.282) (-880.464) * (-880.088) (-876.401) (-877.278) [-875.868] -- 0:00:26
665000 -- (-881.031) [-877.123] (-879.398) (-877.634) * (-879.935) (-876.600) (-876.078) [-876.811] -- 0:00:26
Average standard deviation of split frequencies: 0.010485
665500 -- (-877.297) [-879.667] (-876.742) (-877.113) * (-878.284) [-877.018] (-880.260) (-876.983) -- 0:00:26
666000 -- (-875.479) [-877.805] (-876.251) (-878.311) * (-875.787) (-877.622) [-878.843] (-880.039) -- 0:00:26
666500 -- (-875.471) (-879.661) (-880.070) [-875.986] * (-877.410) (-880.802) [-878.742] (-876.963) -- 0:00:26
667000 -- [-879.616] (-876.418) (-880.054) (-876.717) * (-876.893) (-876.899) (-878.235) [-876.271] -- 0:00:25
667500 -- (-877.769) (-878.134) [-878.044] (-877.732) * (-877.309) (-878.498) (-879.021) [-876.882] -- 0:00:25
668000 -- (-879.440) [-878.935] (-879.016) (-877.580) * [-876.806] (-879.733) (-883.989) (-878.298) -- 0:00:25
668500 -- (-880.173) (-878.347) (-876.930) [-876.876] * (-876.794) [-880.141] (-877.872) (-879.210) -- 0:00:25
669000 -- (-877.580) (-880.074) [-877.021] (-876.411) * (-878.570) [-878.543] (-880.170) (-877.717) -- 0:00:25
669500 -- (-877.300) (-878.870) [-877.646] (-881.249) * (-877.466) (-876.283) (-878.712) [-876.576] -- 0:00:25
670000 -- (-880.099) [-878.869] (-876.991) (-876.427) * [-876.608] (-879.503) (-877.748) (-876.284) -- 0:00:25
Average standard deviation of split frequencies: 0.009091
670500 -- [-875.662] (-880.020) (-880.842) (-880.132) * (-879.177) (-875.729) [-877.401] (-879.785) -- 0:00:25
671000 -- (-881.227) (-881.045) [-878.641] (-878.014) * [-882.013] (-875.726) (-881.088) (-879.530) -- 0:00:25
671500 -- (-876.209) (-877.830) [-877.106] (-878.140) * (-880.410) [-876.459] (-881.662) (-879.572) -- 0:00:25
672000 -- (-875.595) (-876.326) (-878.175) [-877.762] * (-878.176) [-876.361] (-878.531) (-877.649) -- 0:00:25
672500 -- (-879.348) (-876.793) (-880.577) [-880.911] * (-878.295) (-878.070) [-880.109] (-881.850) -- 0:00:25
673000 -- (-879.878) [-876.661] (-880.357) (-877.255) * (-878.612) [-877.612] (-880.181) (-878.743) -- 0:00:25
673500 -- (-879.716) [-876.213] (-878.176) (-877.604) * (-878.366) [-878.233] (-881.141) (-877.636) -- 0:00:25
674000 -- (-877.130) (-876.898) (-877.685) [-879.116] * (-878.286) (-877.847) (-877.363) [-878.766] -- 0:00:25
674500 -- (-878.581) [-876.526] (-877.140) (-877.777) * (-877.536) (-878.023) [-877.349] (-882.995) -- 0:00:25
675000 -- (-876.678) (-876.732) (-881.199) [-876.055] * [-878.222] (-876.775) (-878.340) (-884.347) -- 0:00:25
Average standard deviation of split frequencies: 0.009937
675500 -- [-881.277] (-880.990) (-878.938) (-878.085) * (-878.806) [-877.655] (-877.482) (-880.901) -- 0:00:25
676000 -- (-880.098) [-877.163] (-879.244) (-879.557) * (-879.088) (-875.859) (-877.128) [-877.277] -- 0:00:25
676500 -- [-879.148] (-877.312) (-876.602) (-877.733) * (-878.146) [-877.070] (-880.386) (-876.017) -- 0:00:25
677000 -- (-876.315) [-877.130] (-876.912) (-878.830) * (-878.649) [-878.666] (-879.110) (-879.316) -- 0:00:25
677500 -- (-876.280) (-876.757) [-876.834] (-878.322) * (-877.432) [-879.466] (-877.458) (-876.544) -- 0:00:25
678000 -- (-879.446) (-877.832) [-878.088] (-876.639) * (-877.441) (-878.797) [-877.090] (-881.113) -- 0:00:25
678500 -- (-877.608) (-878.014) [-879.901] (-879.813) * (-877.116) [-876.977] (-878.828) (-881.997) -- 0:00:25
679000 -- (-878.749) (-877.125) [-881.922] (-878.009) * (-878.710) (-876.672) [-876.373] (-876.333) -- 0:00:25
679500 -- (-875.769) [-876.395] (-878.969) (-879.465) * (-881.305) [-877.534] (-879.373) (-877.308) -- 0:00:24
680000 -- (-876.488) (-878.442) (-877.777) [-878.068] * (-879.122) [-878.287] (-877.905) (-879.459) -- 0:00:24
Average standard deviation of split frequencies: 0.010475
680500 -- (-879.382) (-879.317) [-877.157] (-880.548) * (-877.754) [-881.032] (-879.107) (-877.629) -- 0:00:24
681000 -- (-883.334) (-878.448) [-879.765] (-880.988) * (-877.125) (-877.754) [-877.933] (-876.397) -- 0:00:24
681500 -- (-876.046) (-877.855) (-882.579) [-879.086] * (-876.989) (-890.076) (-880.112) [-876.187] -- 0:00:24
682000 -- (-875.770) (-877.103) (-880.063) [-879.262] * (-878.349) (-885.010) (-877.553) [-878.318] -- 0:00:24
682500 -- [-876.278] (-880.131) (-878.607) (-880.296) * [-877.274] (-878.862) (-877.523) (-876.107) -- 0:00:24
683000 -- (-876.279) [-877.987] (-876.948) (-877.664) * (-876.769) [-876.925] (-880.007) (-877.664) -- 0:00:24
683500 -- (-876.268) (-876.532) (-876.121) [-876.954] * (-881.679) (-876.618) (-877.598) [-878.236] -- 0:00:24
684000 -- (-876.795) (-880.232) [-878.597] (-876.360) * [-877.646] (-879.516) (-879.933) (-880.292) -- 0:00:24
684500 -- (-878.327) (-878.490) [-881.644] (-878.262) * (-879.379) (-878.626) [-879.861] (-877.336) -- 0:00:24
685000 -- (-878.671) (-876.111) (-879.161) [-877.346] * (-877.634) (-878.051) (-877.490) [-878.654] -- 0:00:24
Average standard deviation of split frequencies: 0.009903
685500 -- (-876.506) (-877.355) [-877.374] (-878.068) * (-878.220) (-877.142) [-878.664] (-879.690) -- 0:00:24
686000 -- (-879.409) (-878.361) [-875.812] (-881.874) * (-877.286) [-876.470] (-880.476) (-877.505) -- 0:00:24
686500 -- (-878.891) [-878.012] (-876.951) (-876.690) * (-879.151) [-876.650] (-877.803) (-876.563) -- 0:00:24
687000 -- (-875.808) (-879.771) (-876.792) [-879.867] * (-882.085) (-878.357) (-877.265) [-877.120] -- 0:00:24
687500 -- (-876.727) (-878.917) [-879.257] (-877.138) * (-878.374) (-876.509) [-877.991] (-877.241) -- 0:00:24
688000 -- (-879.249) (-878.222) (-878.668) [-876.268] * (-876.905) (-876.375) (-878.164) [-881.342] -- 0:00:24
688500 -- (-876.858) (-879.887) [-877.937] (-877.367) * (-876.339) (-875.658) [-879.062] (-877.609) -- 0:00:24
689000 -- (-875.858) [-880.199] (-880.392) (-876.769) * (-878.611) (-875.441) (-878.924) [-879.229] -- 0:00:24
689500 -- (-877.135) (-880.168) [-877.547] (-877.792) * (-879.322) [-877.140] (-878.544) (-876.669) -- 0:00:24
690000 -- (-882.671) [-876.832] (-879.144) (-876.190) * (-878.467) [-876.813] (-878.358) (-878.841) -- 0:00:24
Average standard deviation of split frequencies: 0.010358
690500 -- (-876.311) [-878.000] (-879.005) (-879.530) * (-878.537) (-877.151) (-878.358) [-877.413] -- 0:00:24
691000 -- (-876.968) (-877.126) [-878.219] (-876.804) * [-876.276] (-877.329) (-877.384) (-876.990) -- 0:00:24
691500 -- (-878.283) (-877.499) (-878.613) [-876.805] * (-876.267) [-877.561] (-876.994) (-879.446) -- 0:00:24
692000 -- [-877.191] (-878.000) (-879.248) (-876.955) * [-879.727] (-876.981) (-877.368) (-878.980) -- 0:00:24
692500 -- [-878.329] (-877.899) (-877.202) (-877.595) * (-881.744) (-878.128) (-877.688) [-879.326] -- 0:00:23
693000 -- (-879.162) (-876.411) [-879.555] (-876.733) * (-887.029) (-875.648) [-876.735] (-876.746) -- 0:00:23
693500 -- (-879.303) [-876.350] (-880.357) (-876.419) * (-877.773) (-877.372) (-876.718) [-879.467] -- 0:00:23
694000 -- (-876.148) (-877.694) (-882.709) [-876.886] * (-877.800) (-876.623) [-876.786] (-877.003) -- 0:00:23
694500 -- (-875.635) (-876.953) (-879.686) [-876.049] * (-876.444) (-876.793) [-876.862] (-876.574) -- 0:00:23
695000 -- (-877.955) (-876.804) (-879.999) [-877.101] * [-875.658] (-875.979) (-879.245) (-877.318) -- 0:00:23
Average standard deviation of split frequencies: 0.010319
695500 -- (-875.665) (-876.615) (-878.921) [-877.368] * (-877.329) (-881.553) [-878.812] (-876.584) -- 0:00:23
696000 -- (-876.825) (-876.394) (-882.546) [-878.185] * (-877.009) (-875.847) [-880.433] (-879.026) -- 0:00:23
696500 -- (-877.870) [-875.531] (-880.578) (-880.360) * [-877.175] (-877.065) (-879.722) (-879.556) -- 0:00:23
697000 -- (-880.043) (-876.948) (-879.871) [-876.435] * (-883.876) [-876.028] (-879.426) (-880.372) -- 0:00:23
697500 -- (-878.549) (-875.663) [-881.337] (-876.742) * (-876.426) (-878.447) (-880.656) [-879.844] -- 0:00:23
698000 -- (-877.028) [-877.469] (-879.385) (-875.807) * (-879.621) (-877.647) [-877.706] (-879.327) -- 0:00:23
698500 -- [-880.737] (-876.811) (-879.346) (-875.783) * (-878.252) (-876.905) [-876.075] (-880.700) -- 0:00:23
699000 -- (-877.364) [-875.981] (-879.996) (-878.796) * [-878.198] (-876.870) (-878.565) (-878.346) -- 0:00:23
699500 -- (-880.565) (-876.132) (-877.442) [-879.887] * (-877.607) [-877.381] (-880.992) (-880.164) -- 0:00:23
700000 -- (-882.722) (-876.374) (-876.800) [-879.144] * (-879.234) (-876.311) (-878.478) [-877.080] -- 0:00:23
Average standard deviation of split frequencies: 0.009335
700500 -- (-879.168) (-875.918) (-879.697) [-881.118] * [-876.921] (-878.214) (-876.592) (-877.001) -- 0:00:23
701000 -- (-877.386) (-883.566) (-881.433) [-878.013] * [-881.162] (-879.150) (-882.574) (-875.582) -- 0:00:23
701500 -- [-877.184] (-876.710) (-880.067) (-877.218) * (-887.414) [-879.853] (-878.829) (-876.677) -- 0:00:23
702000 -- [-879.237] (-878.461) (-876.031) (-876.562) * (-878.094) (-876.204) [-877.801] (-878.441) -- 0:00:23
702500 -- (-877.955) (-877.892) [-877.244] (-880.321) * (-879.211) [-877.556] (-879.304) (-880.847) -- 0:00:23
703000 -- [-877.295] (-877.144) (-877.895) (-875.681) * (-879.234) [-878.366] (-876.885) (-876.502) -- 0:00:23
703500 -- (-878.143) [-877.213] (-876.421) (-876.458) * (-880.811) (-878.021) [-876.107] (-876.656) -- 0:00:23
704000 -- (-879.582) (-876.553) [-878.652] (-879.072) * (-876.378) [-876.422] (-875.845) (-876.690) -- 0:00:23
704500 -- (-879.802) [-876.639] (-878.075) (-876.456) * (-877.914) (-884.574) (-876.029) [-877.797] -- 0:00:23
705000 -- [-877.184] (-877.033) (-877.894) (-877.307) * (-877.183) [-877.061] (-880.755) (-877.553) -- 0:00:23
Average standard deviation of split frequencies: 0.009098
705500 -- (-883.471) (-877.731) (-879.860) [-875.786] * (-878.641) [-877.460] (-878.184) (-875.554) -- 0:00:22
706000 -- (-879.237) [-879.321] (-877.145) (-876.496) * (-877.529) (-877.629) [-877.795] (-876.684) -- 0:00:22
706500 -- (-878.285) [-882.483] (-876.289) (-878.197) * [-881.288] (-876.845) (-877.156) (-877.886) -- 0:00:22
707000 -- (-877.915) (-876.725) [-877.939] (-877.316) * (-876.509) (-879.397) [-876.456] (-876.667) -- 0:00:22
707500 -- (-877.079) (-877.811) (-880.521) [-877.061] * (-877.140) (-880.498) (-876.949) [-877.597] -- 0:00:22
708000 -- [-878.555] (-879.795) (-876.685) (-880.321) * (-877.969) [-877.051] (-877.832) (-876.781) -- 0:00:22
708500 -- [-877.170] (-876.090) (-877.993) (-884.545) * [-877.043] (-877.775) (-878.134) (-881.393) -- 0:00:22
709000 -- (-875.671) (-880.043) (-877.170) [-879.436] * (-879.594) (-878.658) [-880.060] (-880.761) -- 0:00:22
709500 -- [-875.857] (-878.520) (-880.175) (-877.140) * (-878.098) [-875.744] (-880.810) (-880.787) -- 0:00:22
710000 -- (-877.996) [-877.501] (-878.246) (-876.920) * (-879.104) [-877.559] (-877.141) (-878.402) -- 0:00:22
Average standard deviation of split frequencies: 0.008748
710500 -- [-876.314] (-879.448) (-876.817) (-880.645) * (-881.022) (-876.987) (-876.873) [-876.772] -- 0:00:22
711000 -- [-879.260] (-878.265) (-878.183) (-884.494) * (-878.812) (-876.885) (-876.841) [-877.242] -- 0:00:22
711500 -- (-880.022) [-882.555] (-876.453) (-878.016) * [-881.479] (-877.515) (-876.547) (-876.462) -- 0:00:22
712000 -- (-878.891) [-877.768] (-877.274) (-878.900) * (-876.194) (-877.482) (-878.265) [-877.489] -- 0:00:22
712500 -- (-879.100) (-878.436) (-878.468) [-878.743] * [-876.937] (-877.665) (-878.161) (-882.277) -- 0:00:22
713000 -- [-877.097] (-876.435) (-876.026) (-875.896) * [-877.526] (-877.829) (-881.342) (-877.185) -- 0:00:22
713500 -- (-876.285) (-879.564) (-877.690) [-876.123] * (-877.669) (-879.234) [-880.465] (-881.550) -- 0:00:22
714000 -- [-879.020] (-878.218) (-878.590) (-879.652) * (-879.982) [-877.745] (-879.978) (-879.229) -- 0:00:22
714500 -- (-878.957) (-878.413) [-876.397] (-880.945) * (-879.135) (-878.851) [-876.641] (-876.430) -- 0:00:22
715000 -- (-880.532) (-878.804) [-878.255] (-881.219) * (-879.135) (-878.123) (-879.472) [-877.722] -- 0:00:22
Average standard deviation of split frequencies: 0.008600
715500 -- (-876.314) (-877.920) [-880.411] (-885.410) * [-878.813] (-880.458) (-879.300) (-878.754) -- 0:00:22
716000 -- [-876.089] (-876.350) (-876.486) (-876.949) * (-881.194) (-877.541) [-878.960] (-877.078) -- 0:00:22
716500 -- (-881.049) (-876.234) [-876.503] (-875.978) * (-877.809) [-877.957] (-881.628) (-877.321) -- 0:00:22
717000 -- [-878.183] (-877.978) (-877.486) (-882.478) * [-877.259] (-881.014) (-881.761) (-879.217) -- 0:00:22
717500 -- (-882.058) [-876.533] (-876.762) (-878.447) * [-876.532] (-883.207) (-877.092) (-877.504) -- 0:00:22
718000 -- (-879.903) [-877.980] (-886.188) (-880.796) * (-879.195) (-882.735) (-876.849) [-876.755] -- 0:00:21
718500 -- (-876.107) (-879.148) [-879.011] (-877.041) * (-880.030) (-882.092) (-877.115) [-877.612] -- 0:00:21
719000 -- [-876.543] (-876.071) (-877.229) (-876.784) * (-876.170) [-876.691] (-878.041) (-876.620) -- 0:00:21
719500 -- (-880.828) [-875.997] (-877.109) (-878.795) * (-877.648) (-876.582) (-879.536) [-877.264] -- 0:00:21
720000 -- (-877.152) [-879.333] (-877.973) (-878.662) * (-878.086) [-875.964] (-877.653) (-876.789) -- 0:00:21
Average standard deviation of split frequencies: 0.008217
720500 -- (-879.286) (-876.834) [-877.731] (-877.049) * (-879.043) [-875.824] (-875.906) (-875.526) -- 0:00:21
721000 -- (-879.541) [-876.542] (-877.844) (-876.356) * (-878.454) (-875.824) (-877.875) [-876.033] -- 0:00:21
721500 -- (-880.148) [-875.816] (-877.760) (-876.621) * (-877.734) [-875.607] (-877.095) (-878.388) -- 0:00:21
722000 -- [-879.634] (-878.548) (-875.754) (-877.874) * [-876.414] (-876.971) (-876.570) (-876.124) -- 0:00:21
722500 -- (-879.156) [-877.493] (-877.422) (-878.484) * (-881.508) [-877.416] (-878.724) (-876.767) -- 0:00:21
723000 -- (-877.000) (-878.411) [-876.385] (-878.282) * [-878.263] (-876.859) (-877.377) (-876.187) -- 0:00:21
723500 -- (-879.152) (-877.586) (-878.173) [-878.657] * (-875.926) (-878.548) [-879.037] (-876.806) -- 0:00:21
724000 -- (-877.091) [-879.244] (-877.870) (-877.674) * [-878.447] (-879.936) (-877.063) (-876.065) -- 0:00:21
724500 -- (-876.921) [-876.433] (-878.530) (-877.627) * (-878.602) (-879.793) (-877.606) [-877.921] -- 0:00:21
725000 -- (-884.290) (-876.617) [-879.693] (-877.672) * (-877.393) (-880.104) (-876.986) [-876.699] -- 0:00:21
Average standard deviation of split frequencies: 0.007914
725500 -- [-876.302] (-877.110) (-875.612) (-878.596) * [-877.199] (-878.057) (-876.788) (-878.469) -- 0:00:21
726000 -- [-878.660] (-877.501) (-878.495) (-877.637) * (-877.195) (-876.526) [-876.765] (-876.519) -- 0:00:21
726500 -- (-880.967) (-877.188) (-876.527) [-877.041] * (-878.208) (-880.161) [-881.141] (-876.292) -- 0:00:21
727000 -- (-880.134) [-875.948] (-878.430) (-880.398) * (-881.846) [-876.862] (-878.384) (-878.447) -- 0:00:21
727500 -- [-876.688] (-877.370) (-878.108) (-881.851) * (-877.977) (-875.599) (-880.818) [-876.463] -- 0:00:21
728000 -- (-876.845) (-876.856) (-877.329) [-877.038] * (-876.214) (-875.896) (-877.240) [-878.241] -- 0:00:21
728500 -- (-876.924) (-876.951) (-878.074) [-878.054] * (-876.714) (-879.910) [-879.174] (-877.812) -- 0:00:21
729000 -- (-876.259) (-875.941) (-880.116) [-877.322] * (-878.191) (-879.858) (-878.025) [-877.920] -- 0:00:21
729500 -- (-877.505) [-876.701] (-879.235) (-876.016) * [-875.623] (-880.172) (-878.222) (-876.570) -- 0:00:21
730000 -- (-879.406) (-877.878) (-878.786) [-876.796] * (-876.804) (-876.868) (-875.815) [-876.954] -- 0:00:21
Average standard deviation of split frequencies: 0.007702
730500 -- [-877.206] (-879.367) (-877.638) (-876.511) * (-879.471) (-876.924) (-880.039) [-877.447] -- 0:00:21
731000 -- (-878.743) (-878.490) (-880.151) [-878.304] * (-880.729) [-879.430] (-876.415) (-878.453) -- 0:00:20
731500 -- [-876.310] (-888.448) (-879.007) (-880.156) * (-878.012) [-879.743] (-877.383) (-880.332) -- 0:00:20
732000 -- (-878.888) (-880.992) (-876.744) [-878.480] * (-876.124) (-880.816) (-882.458) [-877.908] -- 0:00:20
732500 -- (-879.698) (-877.240) (-877.382) [-875.863] * (-876.676) [-876.394] (-878.155) (-876.993) -- 0:00:20
733000 -- (-880.477) [-881.935] (-877.341) (-880.364) * (-878.539) [-878.249] (-878.571) (-878.006) -- 0:00:20
733500 -- (-876.545) [-878.269] (-876.084) (-878.930) * (-876.982) (-876.070) (-879.105) [-876.984] -- 0:00:20
734000 -- (-877.232) (-877.910) [-875.890] (-880.429) * (-876.690) (-879.843) [-876.963] (-877.105) -- 0:00:20
734500 -- [-876.167] (-879.520) (-876.103) (-877.589) * (-876.360) [-878.501] (-876.294) (-876.344) -- 0:00:20
735000 -- [-876.152] (-877.924) (-876.418) (-883.372) * (-879.481) (-880.018) [-877.013] (-877.133) -- 0:00:20
Average standard deviation of split frequencies: 0.007085
735500 -- [-876.088] (-876.297) (-878.358) (-879.082) * (-879.099) [-877.524] (-876.404) (-877.373) -- 0:00:20
736000 -- (-877.939) [-878.911] (-878.574) (-877.930) * (-877.382) [-877.716] (-877.298) (-876.196) -- 0:00:20
736500 -- (-879.089) (-877.874) (-879.058) [-877.433] * (-878.444) [-876.643] (-877.026) (-878.334) -- 0:00:20
737000 -- (-879.179) (-877.101) (-878.562) [-878.131] * (-878.748) (-881.426) (-877.222) [-880.924] -- 0:00:20
737500 -- [-879.503] (-881.152) (-878.969) (-877.921) * (-880.635) [-878.174] (-881.114) (-877.688) -- 0:00:20
738000 -- [-880.223] (-880.182) (-877.467) (-877.857) * [-879.677] (-876.931) (-876.770) (-878.270) -- 0:00:20
738500 -- (-879.426) (-877.971) [-878.659] (-878.515) * [-878.787] (-878.637) (-876.911) (-878.307) -- 0:00:20
739000 -- (-879.116) (-876.586) [-876.527] (-878.157) * (-878.502) [-879.000] (-877.180) (-879.664) -- 0:00:20
739500 -- [-876.182] (-878.399) (-876.415) (-877.165) * (-878.646) (-879.529) [-876.824] (-879.558) -- 0:00:20
740000 -- (-879.414) (-877.807) (-880.413) [-877.878] * (-878.118) (-878.311) (-876.577) [-877.014] -- 0:00:20
Average standard deviation of split frequencies: 0.007200
740500 -- (-879.734) [-876.271] (-878.583) (-877.439) * (-879.813) (-881.282) (-878.338) [-876.935] -- 0:00:20
741000 -- (-876.432) [-877.213] (-878.540) (-875.703) * (-876.725) (-876.279) [-876.316] (-877.968) -- 0:00:20
741500 -- (-876.363) (-877.049) (-877.862) [-877.079] * (-876.037) (-877.262) (-877.742) [-879.154] -- 0:00:20
742000 -- (-877.197) [-877.684] (-878.230) (-879.869) * [-875.979] (-876.532) (-875.841) (-876.450) -- 0:00:20
742500 -- (-876.257) (-878.373) (-878.302) [-879.280] * [-876.489] (-882.295) (-877.154) (-879.544) -- 0:00:20
743000 -- [-876.931] (-877.825) (-878.622) (-878.228) * (-877.257) (-876.980) [-878.399] (-879.037) -- 0:00:20
743500 -- (-879.193) (-878.653) (-879.146) [-876.750] * (-880.017) (-878.727) [-876.054] (-881.274) -- 0:00:20
744000 -- (-881.803) [-877.566] (-878.107) (-878.049) * (-882.120) [-878.091] (-882.578) (-879.805) -- 0:00:19
744500 -- (-877.055) [-877.112] (-879.212) (-877.964) * (-877.526) (-876.704) (-878.251) [-876.826] -- 0:00:19
745000 -- (-878.082) (-877.041) (-878.425) [-876.907] * (-880.558) (-876.519) [-876.341] (-876.744) -- 0:00:19
Average standard deviation of split frequencies: 0.007069
745500 -- (-877.284) (-877.423) (-877.682) [-876.966] * (-876.021) [-877.929] (-877.725) (-876.514) -- 0:00:19
746000 -- (-878.700) (-878.447) (-875.650) [-877.905] * (-881.256) (-880.213) (-880.526) [-877.479] -- 0:00:19
746500 -- (-878.891) (-878.719) [-877.311] (-877.690) * (-876.292) (-877.695) (-876.919) [-877.902] -- 0:00:19
747000 -- (-881.712) [-876.015] (-877.619) (-878.040) * (-878.304) (-878.647) [-876.920] (-878.408) -- 0:00:19
747500 -- [-877.230] (-880.305) (-877.825) (-877.351) * (-875.552) (-879.686) [-876.745] (-876.300) -- 0:00:19
748000 -- (-878.320) (-879.125) [-877.853] (-879.123) * (-876.881) (-877.726) [-877.333] (-877.039) -- 0:00:19
748500 -- (-877.742) (-878.035) [-878.279] (-878.785) * (-876.610) (-880.481) (-880.562) [-879.084] -- 0:00:19
749000 -- [-876.454] (-876.741) (-878.281) (-877.332) * [-875.987] (-880.480) (-878.240) (-875.882) -- 0:00:19
749500 -- (-878.372) [-878.507] (-876.779) (-875.766) * (-878.641) (-876.467) [-876.660] (-878.084) -- 0:00:19
750000 -- (-877.809) [-880.151] (-876.988) (-877.523) * (-879.129) [-878.205] (-878.603) (-877.363) -- 0:00:19
Average standard deviation of split frequencies: 0.006947
750500 -- (-879.181) [-881.037] (-878.306) (-876.882) * (-876.659) (-882.789) [-878.120] (-877.617) -- 0:00:19
751000 -- (-876.241) [-875.843] (-876.221) (-878.576) * (-879.446) (-876.175) [-877.413] (-877.172) -- 0:00:19
751500 -- (-878.106) (-876.436) [-876.221] (-879.434) * (-878.054) [-878.482] (-879.869) (-877.376) -- 0:00:19
752000 -- (-879.430) (-876.022) [-878.595] (-878.369) * (-877.303) (-877.627) [-880.327] (-876.100) -- 0:00:19
752500 -- (-880.620) (-876.293) (-880.991) [-878.071] * (-877.548) (-877.555) (-877.303) [-876.542] -- 0:00:19
753000 -- (-878.120) (-877.398) (-879.896) [-879.065] * (-876.724) (-879.292) (-879.880) [-879.408] -- 0:00:19
753500 -- [-878.845] (-877.406) (-878.871) (-877.870) * [-877.930] (-880.619) (-878.133) (-876.868) -- 0:00:19
754000 -- (-877.594) [-880.195] (-880.887) (-878.018) * (-877.930) (-877.769) [-877.769] (-883.355) -- 0:00:19
754500 -- (-880.337) (-879.128) (-879.033) [-876.936] * (-876.715) (-877.923) (-878.939) [-877.715] -- 0:00:19
755000 -- (-880.285) (-875.965) (-876.953) [-877.200] * [-878.070] (-876.894) (-878.428) (-880.229) -- 0:00:19
Average standard deviation of split frequencies: 0.006703
755500 -- (-876.911) (-875.965) [-876.760] (-880.181) * (-880.269) (-877.004) [-877.647] (-877.985) -- 0:00:19
756000 -- (-882.605) [-876.669] (-877.699) (-877.800) * [-878.487] (-881.319) (-877.865) (-878.489) -- 0:00:19
756500 -- [-877.636] (-876.649) (-878.889) (-877.416) * (-876.868) (-877.301) [-879.545] (-879.955) -- 0:00:18
757000 -- [-879.282] (-878.248) (-877.883) (-877.674) * (-878.516) (-877.873) (-879.835) [-884.010] -- 0:00:18
757500 -- (-876.677) (-877.260) (-878.348) [-876.972] * (-880.760) (-879.959) [-876.666] (-881.320) -- 0:00:18
758000 -- (-877.323) (-876.742) [-880.574] (-875.923) * (-882.652) (-878.905) [-876.934] (-881.621) -- 0:00:18
758500 -- (-876.416) [-876.560] (-881.378) (-879.656) * (-880.634) [-877.861] (-878.088) (-878.815) -- 0:00:18
759000 -- (-877.335) (-876.871) [-877.961] (-877.741) * (-880.071) [-878.078] (-880.410) (-878.321) -- 0:00:18
759500 -- (-879.862) [-877.564] (-878.256) (-875.949) * (-876.568) (-879.214) [-877.094] (-877.929) -- 0:00:18
760000 -- (-876.951) (-878.684) (-877.326) [-878.318] * (-879.762) (-878.592) [-878.921] (-880.028) -- 0:00:18
Average standard deviation of split frequencies: 0.007049
760500 -- [-876.169] (-879.818) (-879.885) (-879.937) * [-880.166] (-878.047) (-877.685) (-878.247) -- 0:00:18
761000 -- (-878.307) [-878.952] (-879.286) (-878.804) * (-878.647) (-877.281) (-877.551) [-877.012] -- 0:00:18
761500 -- (-877.059) [-877.515] (-878.873) (-877.750) * (-882.323) (-877.090) (-877.636) [-879.049] -- 0:00:18
762000 -- (-881.455) (-878.894) (-878.254) [-876.249] * (-878.225) (-877.180) (-876.141) [-877.412] -- 0:00:18
762500 -- [-877.031] (-877.049) (-877.667) (-876.403) * (-882.520) [-877.147] (-878.550) (-877.610) -- 0:00:18
763000 -- (-876.608) (-878.482) [-877.514] (-876.026) * [-877.914] (-876.884) (-876.174) (-877.878) -- 0:00:18
763500 -- [-876.142] (-880.141) (-882.012) (-876.260) * (-875.901) (-878.928) [-875.874] (-879.363) -- 0:00:18
764000 -- (-876.142) (-878.946) (-876.822) [-878.337] * (-877.971) (-881.149) [-877.348] (-877.919) -- 0:00:18
764500 -- (-878.555) [-880.595] (-876.880) (-877.317) * (-876.463) (-880.168) (-877.433) [-877.373] -- 0:00:18
765000 -- [-879.453] (-878.099) (-877.599) (-879.903) * [-877.161] (-879.849) (-878.319) (-875.842) -- 0:00:18
Average standard deviation of split frequencies: 0.007039
765500 -- (-878.639) (-880.273) [-878.659] (-879.611) * (-879.958) (-878.464) (-877.740) [-876.001] -- 0:00:18
766000 -- [-876.509] (-879.853) (-878.041) (-878.019) * [-877.521] (-879.008) (-877.543) (-875.918) -- 0:00:18
766500 -- (-876.023) (-876.049) [-877.401] (-877.883) * (-878.670) [-877.543] (-875.956) (-877.783) -- 0:00:18
767000 -- (-881.436) [-875.902] (-876.915) (-877.556) * (-878.570) [-879.136] (-876.307) (-876.536) -- 0:00:18
767500 -- [-876.569] (-876.925) (-877.684) (-877.007) * [-876.099] (-881.636) (-877.028) (-875.816) -- 0:00:18
768000 -- [-875.813] (-877.354) (-875.847) (-879.095) * [-877.559] (-883.685) (-877.184) (-877.254) -- 0:00:18
768500 -- [-879.384] (-880.149) (-877.557) (-884.123) * (-880.911) [-876.185] (-877.791) (-877.799) -- 0:00:18
769000 -- (-876.573) (-885.966) [-878.464] (-880.283) * [-879.172] (-877.041) (-876.404) (-878.208) -- 0:00:18
769500 -- (-878.399) (-883.460) (-877.420) [-880.007] * (-880.928) [-880.110] (-877.993) (-880.210) -- 0:00:17
770000 -- (-878.353) [-878.279] (-880.402) (-876.834) * (-879.869) (-882.684) [-877.255] (-880.485) -- 0:00:17
Average standard deviation of split frequencies: 0.007493
770500 -- (-877.533) [-877.804] (-876.502) (-876.715) * (-876.014) (-881.986) [-882.414] (-878.255) -- 0:00:17
771000 -- (-876.607) (-880.600) [-876.749] (-877.076) * (-875.950) [-880.520] (-877.076) (-876.312) -- 0:00:17
771500 -- (-876.607) [-878.609] (-880.539) (-877.079) * (-877.928) (-877.370) [-876.164] (-876.878) -- 0:00:17
772000 -- (-878.126) (-879.251) [-878.415] (-878.221) * (-876.182) [-881.647] (-879.686) (-876.435) -- 0:00:17
772500 -- (-876.528) (-878.536) (-876.948) [-876.325] * (-875.731) (-881.187) (-881.500) [-877.176] -- 0:00:17
773000 -- (-876.420) (-879.157) (-879.126) [-877.142] * (-877.242) (-879.597) (-876.633) [-877.115] -- 0:00:17
773500 -- [-877.804] (-876.729) (-879.858) (-875.864) * (-877.052) [-876.211] (-878.553) (-876.560) -- 0:00:17
774000 -- (-879.001) (-877.082) [-877.681] (-877.807) * (-877.004) (-878.504) (-875.520) [-877.297] -- 0:00:17
774500 -- (-879.917) (-879.371) (-877.843) [-879.689] * (-878.186) (-878.370) (-875.520) [-881.193] -- 0:00:17
775000 -- (-880.074) (-878.954) [-876.230] (-877.409) * (-878.944) (-881.020) (-876.393) [-877.178] -- 0:00:17
Average standard deviation of split frequencies: 0.007745
775500 -- (-877.701) (-879.729) [-877.323] (-876.145) * (-877.824) (-877.679) (-879.906) [-878.901] -- 0:00:17
776000 -- (-878.252) (-877.548) (-877.819) [-878.001] * [-884.896] (-878.235) (-878.145) (-877.478) -- 0:00:17
776500 -- [-880.003] (-877.957) (-876.575) (-880.368) * (-880.178) (-880.242) [-877.069] (-876.361) -- 0:00:17
777000 -- (-878.087) [-876.148] (-877.892) (-878.414) * (-877.775) (-881.017) [-875.688] (-878.224) -- 0:00:17
777500 -- (-880.616) (-878.174) [-878.045] (-881.508) * (-881.180) (-883.754) [-876.997] (-878.357) -- 0:00:17
778000 -- (-879.848) (-875.957) (-877.762) [-876.026] * (-879.671) (-881.091) [-878.191] (-877.597) -- 0:00:17
778500 -- [-878.365] (-876.758) (-876.388) (-876.284) * [-879.049] (-880.759) (-876.808) (-877.870) -- 0:00:17
779000 -- (-879.489) [-878.188] (-877.887) (-876.022) * (-878.545) (-876.745) [-883.240] (-877.636) -- 0:00:17
779500 -- (-879.259) [-879.439] (-880.201) (-879.835) * (-877.016) [-877.193] (-885.667) (-879.219) -- 0:00:17
780000 -- [-877.844] (-876.784) (-878.393) (-878.928) * (-878.002) (-879.498) (-882.128) [-877.403] -- 0:00:17
Average standard deviation of split frequencies: 0.008152
780500 -- [-877.272] (-878.856) (-881.390) (-876.414) * (-882.729) (-879.714) (-877.857) [-876.756] -- 0:00:17
781000 -- (-876.179) [-880.991] (-878.062) (-876.918) * (-879.278) [-881.579] (-879.192) (-875.740) -- 0:00:17
781500 -- (-878.797) (-875.812) (-878.641) [-879.353] * (-879.085) (-878.792) (-877.370) [-875.907] -- 0:00:17
782000 -- (-875.675) (-878.228) [-879.313] (-877.302) * (-878.445) (-878.145) [-877.478] (-877.424) -- 0:00:17
782500 -- (-879.576) (-881.811) [-881.654] (-879.904) * (-880.884) [-876.454] (-878.612) (-876.433) -- 0:00:16
783000 -- (-878.227) (-878.620) (-877.384) [-876.977] * (-880.347) (-878.271) (-877.630) [-876.904] -- 0:00:16
783500 -- (-876.583) (-878.644) (-877.941) [-880.281] * (-877.874) (-878.802) [-877.213] (-877.999) -- 0:00:16
784000 -- (-876.615) [-878.367] (-876.900) (-881.864) * (-879.460) (-876.392) [-876.756] (-876.105) -- 0:00:16
784500 -- (-880.109) (-876.024) (-876.992) [-877.728] * (-878.921) [-876.122] (-876.105) (-878.220) -- 0:00:16
785000 -- [-877.444] (-878.492) (-877.871) (-876.667) * [-876.462] (-878.350) (-879.091) (-881.343) -- 0:00:16
Average standard deviation of split frequencies: 0.008359
785500 -- [-876.581] (-875.775) (-877.565) (-878.324) * (-877.869) [-876.911] (-880.736) (-877.286) -- 0:00:16
786000 -- [-877.496] (-877.187) (-877.592) (-876.400) * (-878.661) (-878.058) (-886.606) [-878.412] -- 0:00:16
786500 -- (-879.301) (-879.404) [-878.899] (-882.094) * [-878.273] (-878.358) (-881.420) (-876.304) -- 0:00:16
787000 -- (-879.636) (-879.356) [-878.239] (-878.683) * (-877.808) [-877.810] (-878.166) (-876.124) -- 0:00:16
787500 -- (-876.611) (-879.227) [-877.633] (-875.737) * [-876.487] (-878.345) (-877.252) (-879.349) -- 0:00:16
788000 -- (-879.935) (-876.542) (-877.436) [-877.948] * (-877.228) (-878.636) [-877.258] (-877.852) -- 0:00:16
788500 -- (-877.801) (-876.126) (-877.725) [-878.569] * [-877.626] (-879.729) (-877.534) (-880.842) -- 0:00:16
789000 -- (-879.013) [-880.393] (-876.662) (-876.654) * [-876.131] (-877.182) (-877.656) (-878.462) -- 0:00:16
789500 -- (-878.648) [-879.403] (-876.317) (-876.805) * [-876.721] (-878.719) (-876.701) (-878.284) -- 0:00:16
790000 -- [-881.611] (-880.060) (-876.288) (-878.999) * [-877.679] (-879.137) (-876.335) (-878.115) -- 0:00:16
Average standard deviation of split frequencies: 0.008571
790500 -- [-878.900] (-877.883) (-876.976) (-882.787) * (-876.913) (-878.625) [-879.927] (-881.308) -- 0:00:16
791000 -- (-878.138) (-879.857) [-877.491] (-880.168) * [-879.252] (-878.061) (-882.400) (-877.374) -- 0:00:16
791500 -- (-879.211) [-879.952] (-883.935) (-881.609) * (-879.270) (-877.782) (-876.104) [-876.027] -- 0:00:16
792000 -- (-877.544) (-882.723) (-884.234) [-878.202] * (-877.813) [-877.596] (-878.610) (-876.499) -- 0:00:16
792500 -- (-877.481) [-877.132] (-880.442) (-881.116) * [-878.826] (-878.618) (-879.239) (-879.208) -- 0:00:16
793000 -- (-876.020) [-878.136] (-878.536) (-880.496) * [-876.857] (-877.480) (-876.292) (-879.850) -- 0:00:16
793500 -- (-876.020) (-884.625) [-879.329] (-877.807) * (-878.067) (-877.922) [-878.531] (-878.885) -- 0:00:16
794000 -- (-879.965) [-880.473] (-884.435) (-877.645) * (-878.861) [-880.713] (-876.689) (-880.510) -- 0:00:16
794500 -- (-876.552) (-877.943) (-877.856) [-878.816] * (-879.717) (-879.482) [-878.350] (-875.891) -- 0:00:16
795000 -- (-877.378) (-880.728) [-881.238] (-879.176) * (-879.892) [-877.946] (-876.780) (-876.621) -- 0:00:15
Average standard deviation of split frequencies: 0.008661
795500 -- (-875.449) (-876.419) [-878.084] (-878.896) * (-881.573) (-877.330) [-876.761] (-876.482) -- 0:00:15
796000 -- [-877.717] (-875.619) (-877.507) (-881.258) * (-881.387) (-878.905) [-876.486] (-876.888) -- 0:00:15
796500 -- (-876.118) (-877.126) (-880.156) [-882.835] * [-877.586] (-879.492) (-876.149) (-879.060) -- 0:00:15
797000 -- [-877.151] (-877.781) (-877.301) (-878.520) * (-876.470) (-877.150) [-877.457] (-880.399) -- 0:00:15
797500 -- (-877.198) [-875.879] (-877.966) (-880.931) * (-885.794) (-877.578) [-877.325] (-876.895) -- 0:00:15
798000 -- [-876.533] (-877.800) (-878.377) (-878.420) * [-879.223] (-876.876) (-877.939) (-876.774) -- 0:00:15
798500 -- (-876.583) (-881.588) (-877.111) [-879.664] * (-881.970) (-875.903) (-876.316) [-878.496] -- 0:00:15
799000 -- (-877.163) (-876.131) [-876.872] (-878.158) * [-877.551] (-878.582) (-875.674) (-875.972) -- 0:00:15
799500 -- (-877.032) [-876.635] (-878.282) (-877.863) * (-881.279) (-877.220) (-876.594) [-878.416] -- 0:00:15
800000 -- (-876.748) (-875.752) [-882.110] (-878.051) * (-881.198) [-875.729] (-876.762) (-880.051) -- 0:00:15
Average standard deviation of split frequencies: 0.009052
800500 -- [-875.989] (-876.816) (-883.638) (-881.468) * (-877.107) (-875.416) [-878.379] (-879.282) -- 0:00:15
801000 -- (-877.875) [-878.479] (-881.640) (-877.673) * (-879.138) [-880.094] (-880.139) (-876.919) -- 0:00:15
801500 -- [-878.473] (-878.798) (-875.847) (-876.393) * (-879.361) (-880.935) (-877.077) [-877.232] -- 0:00:15
802000 -- (-877.788) (-878.009) [-876.099] (-878.765) * (-877.071) [-876.348] (-880.554) (-878.419) -- 0:00:15
802500 -- (-879.111) (-882.511) (-876.430) [-878.272] * [-877.003] (-878.241) (-879.589) (-879.123) -- 0:00:15
803000 -- (-877.027) [-875.572] (-881.002) (-877.272) * (-878.251) [-879.999] (-877.147) (-880.522) -- 0:00:15
803500 -- (-878.097) (-875.773) (-878.268) [-876.921] * [-876.627] (-880.068) (-876.168) (-877.118) -- 0:00:15
804000 -- (-876.926) (-877.062) [-881.725] (-876.659) * (-878.150) (-880.068) [-877.018] (-880.076) -- 0:00:15
804500 -- [-876.803] (-877.417) (-880.459) (-877.505) * (-878.018) (-877.891) (-876.428) [-876.058] -- 0:00:15
805000 -- (-877.844) [-877.056] (-878.262) (-876.370) * (-876.813) [-879.184] (-880.125) (-880.678) -- 0:00:15
Average standard deviation of split frequencies: 0.008700
805500 -- (-878.117) [-876.135] (-877.603) (-877.477) * (-877.875) [-878.822] (-877.446) (-877.390) -- 0:00:15
806000 -- (-880.720) [-879.413] (-884.114) (-876.397) * [-879.148] (-876.869) (-876.627) (-877.784) -- 0:00:15
806500 -- (-880.359) (-876.863) (-877.325) [-876.302] * [-881.504] (-878.479) (-875.717) (-880.424) -- 0:00:15
807000 -- (-880.891) [-876.428] (-877.924) (-876.649) * (-877.940) [-877.417] (-876.348) (-876.750) -- 0:00:15
807500 -- (-881.387) (-880.780) [-876.545] (-877.345) * (-876.185) (-877.194) [-880.384] (-879.297) -- 0:00:15
808000 -- (-877.398) (-877.524) (-876.695) [-876.715] * [-878.541] (-878.057) (-879.919) (-876.064) -- 0:00:14
808500 -- (-881.545) (-877.142) (-877.991) [-878.241] * (-882.833) (-879.804) (-877.734) [-876.751] -- 0:00:14
809000 -- (-880.740) (-876.511) (-876.757) [-876.833] * [-878.228] (-878.187) (-878.589) (-879.319) -- 0:00:14
809500 -- [-877.964] (-879.983) (-877.228) (-876.058) * (-877.759) (-880.223) (-876.805) [-876.576] -- 0:00:14
810000 -- [-876.033] (-878.501) (-878.119) (-879.552) * (-881.787) (-879.458) [-878.387] (-877.191) -- 0:00:14
Average standard deviation of split frequencies: 0.008468
810500 -- (-878.860) [-876.606] (-875.745) (-877.618) * (-878.157) (-880.545) [-878.226] (-876.564) -- 0:00:14
811000 -- (-876.972) [-878.330] (-875.684) (-876.262) * (-876.402) (-878.616) (-877.768) [-876.081] -- 0:00:14
811500 -- [-877.329] (-877.642) (-877.104) (-875.963) * (-880.253) (-880.095) [-877.171] (-877.724) -- 0:00:14
812000 -- (-877.998) [-877.060] (-875.924) (-877.075) * [-878.257] (-879.389) (-884.115) (-881.621) -- 0:00:14
812500 -- [-879.219] (-875.564) (-876.988) (-877.083) * (-878.844) (-878.888) [-876.677] (-878.446) -- 0:00:14
813000 -- (-879.006) (-876.369) (-877.770) [-876.305] * [-880.034] (-876.513) (-876.966) (-877.041) -- 0:00:14
813500 -- (-876.707) [-879.311] (-877.368) (-880.566) * (-879.562) (-878.283) [-876.251] (-878.102) -- 0:00:14
814000 -- (-876.360) (-875.613) [-876.599] (-878.402) * (-879.429) (-879.418) (-877.786) [-877.111] -- 0:00:14
814500 -- (-880.393) [-879.526] (-876.752) (-876.662) * (-876.449) (-876.455) [-879.388] (-877.413) -- 0:00:14
815000 -- (-877.039) (-878.344) (-878.445) [-878.042] * (-880.134) (-879.449) (-877.535) [-878.003] -- 0:00:14
Average standard deviation of split frequencies: 0.009282
815500 -- (-877.287) [-876.162] (-879.742) (-878.852) * (-880.155) (-878.728) (-875.943) [-879.651] -- 0:00:14
816000 -- (-876.583) (-876.110) [-879.352] (-877.581) * (-879.900) (-878.412) [-875.579] (-876.778) -- 0:00:14
816500 -- [-877.085] (-877.029) (-877.703) (-878.018) * (-880.109) (-876.226) [-877.796] (-879.124) -- 0:00:14
817000 -- [-876.357] (-877.679) (-880.126) (-877.194) * (-878.166) (-878.623) [-879.416] (-879.201) -- 0:00:14
817500 -- (-877.797) (-878.293) [-878.916] (-877.367) * (-877.020) (-879.475) [-879.545] (-878.371) -- 0:00:14
818000 -- [-877.253] (-876.643) (-877.662) (-879.639) * [-880.522] (-875.628) (-876.152) (-879.573) -- 0:00:14
818500 -- (-878.147) (-877.591) (-876.601) [-876.820] * (-876.746) (-876.703) [-877.974] (-876.334) -- 0:00:14
819000 -- (-883.985) [-878.481] (-877.094) (-877.367) * (-875.829) [-877.220] (-879.533) (-877.253) -- 0:00:14
819500 -- (-880.416) [-876.615] (-882.276) (-879.952) * (-878.611) (-878.087) [-879.760] (-877.121) -- 0:00:14
820000 -- (-876.660) (-878.334) [-878.007] (-877.274) * [-878.153] (-876.797) (-877.647) (-878.566) -- 0:00:14
Average standard deviation of split frequencies: 0.009191
820500 -- (-877.956) (-876.725) [-879.744] (-877.967) * (-876.775) (-878.666) [-876.549] (-878.654) -- 0:00:14
821000 -- (-876.445) (-877.980) (-881.434) [-878.323] * [-877.263] (-876.625) (-879.696) (-877.000) -- 0:00:13
821500 -- (-878.783) [-876.929] (-878.045) (-879.120) * (-875.918) (-878.399) [-878.208] (-875.755) -- 0:00:13
822000 -- (-884.783) (-882.973) (-878.668) [-876.688] * (-880.854) (-878.520) [-877.197] (-879.538) -- 0:00:13
822500 -- (-881.102) (-880.824) (-879.214) [-876.422] * (-876.695) [-877.441] (-880.669) (-876.267) -- 0:00:13
823000 -- [-877.926] (-876.181) (-878.223) (-876.116) * [-876.011] (-878.951) (-878.102) (-876.039) -- 0:00:13
823500 -- (-881.935) (-878.525) [-880.978] (-876.460) * [-879.292] (-877.012) (-876.859) (-881.323) -- 0:00:13
824000 -- (-879.862) [-877.181] (-881.306) (-877.410) * (-878.633) (-879.062) (-878.633) [-877.379] -- 0:00:13
824500 -- (-879.386) (-876.851) (-881.281) [-876.988] * (-882.923) [-877.109] (-878.021) (-877.135) -- 0:00:13
825000 -- [-879.758] (-879.345) (-879.913) (-876.073) * (-881.244) (-877.141) [-876.915] (-876.114) -- 0:00:13
Average standard deviation of split frequencies: 0.008775
825500 -- (-879.085) (-878.355) (-878.140) [-876.071] * (-880.748) (-879.041) (-878.490) [-877.031] -- 0:00:13
826000 -- (-880.169) [-876.071] (-876.413) (-875.811) * (-880.454) (-877.935) (-877.157) [-877.039] -- 0:00:13
826500 -- [-877.431] (-879.118) (-883.959) (-877.878) * [-876.122] (-878.160) (-878.053) (-877.323) -- 0:00:13
827000 -- [-875.787] (-879.723) (-878.284) (-878.939) * (-877.383) (-876.704) (-876.254) [-876.735] -- 0:00:13
827500 -- [-876.911] (-879.901) (-876.616) (-877.828) * (-875.761) [-876.980] (-876.620) (-876.876) -- 0:00:13
828000 -- (-877.285) (-878.938) (-876.288) [-879.303] * (-875.537) (-879.154) [-876.049] (-880.407) -- 0:00:13
828500 -- (-877.511) (-878.284) [-876.207] (-878.303) * (-875.456) [-876.765] (-876.117) (-879.465) -- 0:00:13
829000 -- (-878.554) [-878.628] (-876.678) (-877.369) * (-877.269) [-876.416] (-882.309) (-876.692) -- 0:00:13
829500 -- (-878.839) [-877.231] (-876.571) (-879.208) * (-877.726) [-876.568] (-879.949) (-876.741) -- 0:00:13
830000 -- [-878.122] (-880.107) (-877.455) (-876.724) * [-877.950] (-884.184) (-879.120) (-877.462) -- 0:00:13
Average standard deviation of split frequencies: 0.008477
830500 -- (-877.306) (-878.438) (-879.179) [-877.560] * (-877.589) (-879.243) [-880.422] (-878.632) -- 0:00:13
831000 -- (-878.051) [-878.652] (-879.883) (-879.976) * (-876.921) (-875.929) (-877.396) [-879.239] -- 0:00:13
831500 -- (-878.301) (-877.589) (-876.434) [-879.359] * (-879.363) (-876.880) (-877.874) [-876.588] -- 0:00:13
832000 -- (-876.530) (-878.534) [-880.014] (-878.954) * (-880.454) (-876.966) (-877.578) [-877.287] -- 0:00:13
832500 -- (-876.894) (-877.778) [-880.356] (-878.473) * (-878.839) [-879.055] (-877.965) (-879.163) -- 0:00:13
833000 -- (-881.129) (-879.363) (-878.899) [-877.561] * (-880.195) (-877.884) [-877.973] (-876.050) -- 0:00:13
833500 -- (-880.486) (-877.751) (-877.719) [-876.485] * (-877.298) (-876.421) (-876.763) [-876.872] -- 0:00:12
834000 -- [-883.782] (-878.730) (-877.440) (-880.398) * [-876.512] (-876.985) (-877.478) (-877.459) -- 0:00:12
834500 -- (-877.835) (-879.555) (-880.021) [-876.444] * [-877.925] (-878.222) (-877.994) (-877.644) -- 0:00:12
835000 -- (-877.618) (-881.053) (-876.269) [-879.526] * (-876.769) [-877.329] (-878.415) (-877.777) -- 0:00:12
Average standard deviation of split frequencies: 0.008811
835500 -- (-878.455) (-876.549) [-877.103] (-881.585) * (-876.123) [-879.352] (-877.518) (-878.150) -- 0:00:12
836000 -- (-880.372) (-879.035) (-875.748) [-876.389] * [-877.787] (-876.846) (-876.283) (-877.008) -- 0:00:12
836500 -- (-876.429) (-887.605) (-877.575) [-879.072] * (-877.496) [-878.046] (-877.448) (-877.662) -- 0:00:12
837000 -- (-876.458) (-878.420) (-880.046) [-877.990] * (-880.400) (-878.764) (-876.722) [-879.979] -- 0:00:12
837500 -- (-879.155) [-881.040] (-879.679) (-876.951) * (-875.744) [-876.367] (-876.537) (-876.571) -- 0:00:12
838000 -- (-887.334) (-879.823) [-877.077] (-876.218) * (-878.087) (-882.296) [-879.853] (-877.156) -- 0:00:12
838500 -- (-879.461) [-876.957] (-877.077) (-876.089) * [-877.983] (-881.916) (-876.871) (-876.588) -- 0:00:12
839000 -- (-877.881) (-879.137) (-881.453) [-876.306] * (-878.285) [-878.907] (-877.868) (-877.013) -- 0:00:12
839500 -- (-880.061) [-875.566] (-877.311) (-877.385) * [-881.343] (-876.884) (-880.307) (-879.254) -- 0:00:12
840000 -- (-877.630) (-877.423) [-876.143] (-879.237) * [-878.483] (-881.130) (-876.340) (-877.326) -- 0:00:12
Average standard deviation of split frequencies: 0.008657
840500 -- (-878.628) (-877.493) (-878.154) [-880.006] * (-878.977) [-877.195] (-876.100) (-877.352) -- 0:00:12
841000 -- [-879.933] (-879.257) (-881.799) (-877.225) * [-882.966] (-878.826) (-880.357) (-877.208) -- 0:00:12
841500 -- (-877.214) [-875.739] (-878.947) (-877.382) * (-881.720) [-877.015] (-877.674) (-877.372) -- 0:00:12
842000 -- [-875.825] (-877.487) (-879.301) (-875.868) * [-880.777] (-881.053) (-877.978) (-877.307) -- 0:00:12
842500 -- (-876.871) (-878.100) (-878.668) [-877.619] * (-880.455) (-877.597) (-877.311) [-877.502] -- 0:00:12
843000 -- (-876.084) (-877.307) (-876.818) [-878.233] * (-877.491) (-879.765) (-880.475) [-880.197] -- 0:00:12
843500 -- (-876.091) (-876.728) (-878.461) [-878.281] * (-878.007) [-877.937] (-882.516) (-881.894) -- 0:00:12
844000 -- (-879.625) [-876.859] (-877.846) (-879.807) * (-879.962) [-880.939] (-876.417) (-880.861) -- 0:00:12
844500 -- (-878.443) (-876.625) [-877.963] (-877.721) * [-877.804] (-880.036) (-876.885) (-878.613) -- 0:00:12
845000 -- (-882.119) (-879.644) (-875.636) [-879.278] * (-877.225) (-883.005) [-875.815] (-877.063) -- 0:00:12
Average standard deviation of split frequencies: 0.008741
845500 -- (-877.897) (-876.645) (-877.802) [-883.737] * (-877.623) (-882.605) (-877.334) [-879.402] -- 0:00:12
846000 -- (-876.034) (-877.225) (-879.154) [-878.067] * (-879.427) (-879.883) (-878.733) [-876.819] -- 0:00:12
846500 -- (-876.890) (-876.594) (-878.179) [-878.375] * (-875.744) [-877.409] (-879.799) (-883.481) -- 0:00:11
847000 -- (-878.642) (-875.636) [-879.692] (-876.252) * (-878.987) (-876.652) [-877.020] (-880.296) -- 0:00:11
847500 -- (-881.022) [-876.470] (-881.651) (-878.559) * [-876.732] (-876.125) (-880.155) (-877.111) -- 0:00:11
848000 -- (-883.002) [-877.949] (-881.903) (-879.777) * (-879.085) [-877.645] (-881.040) (-879.789) -- 0:00:11
848500 -- (-875.745) (-877.848) [-878.043] (-878.391) * (-878.066) [-876.910] (-884.014) (-877.618) -- 0:00:11
849000 -- (-875.633) (-877.358) (-875.903) [-876.092] * (-879.646) (-877.192) (-883.723) [-877.761] -- 0:00:11
849500 -- [-876.873] (-875.656) (-877.413) (-875.921) * (-876.898) (-875.693) (-880.599) [-875.881] -- 0:00:11
850000 -- (-877.808) (-877.971) (-879.094) [-876.157] * [-876.342] (-877.025) (-877.069) (-877.859) -- 0:00:11
Average standard deviation of split frequencies: 0.008901
850500 -- (-881.101) [-876.062] (-880.351) (-883.386) * (-879.914) (-876.876) (-876.881) [-879.981] -- 0:00:11
851000 -- (-881.805) (-878.064) (-878.532) [-881.486] * [-878.655] (-880.627) (-877.531) (-878.718) -- 0:00:11
851500 -- (-879.677) (-876.217) [-878.721] (-880.848) * (-879.347) (-876.290) (-875.681) [-876.949] -- 0:00:11
852000 -- (-877.073) (-878.648) (-877.710) [-878.750] * [-876.619] (-876.224) (-876.536) (-876.896) -- 0:00:11
852500 -- (-876.293) (-877.486) [-877.639] (-877.579) * (-877.257) (-877.206) (-877.585) [-877.035] -- 0:00:11
853000 -- [-879.063] (-879.186) (-877.334) (-877.900) * [-876.293] (-878.264) (-875.932) (-877.738) -- 0:00:11
853500 -- (-875.779) [-882.377] (-880.669) (-875.759) * [-881.612] (-877.064) (-876.069) (-878.653) -- 0:00:11
854000 -- (-876.381) [-879.807] (-880.933) (-879.219) * [-875.376] (-878.904) (-877.337) (-877.285) -- 0:00:11
854500 -- (-876.721) [-879.220] (-882.263) (-876.133) * (-875.957) (-877.996) [-877.233] (-877.968) -- 0:00:11
855000 -- [-878.094] (-879.148) (-882.078) (-876.685) * [-876.250] (-876.154) (-876.220) (-877.935) -- 0:00:11
Average standard deviation of split frequencies: 0.008777
855500 -- [-876.503] (-878.729) (-878.837) (-878.102) * (-878.190) (-878.043) [-878.410] (-877.715) -- 0:00:11
856000 -- (-875.619) (-878.848) (-881.543) [-878.863] * [-876.665] (-881.280) (-879.947) (-877.611) -- 0:00:11
856500 -- [-875.594] (-878.423) (-882.349) (-879.563) * (-879.882) (-879.054) [-877.948] (-876.874) -- 0:00:11
857000 -- (-876.395) (-877.929) [-877.552] (-878.369) * [-881.001] (-879.126) (-877.240) (-880.605) -- 0:00:11
857500 -- [-878.142] (-875.859) (-877.548) (-879.679) * [-878.316] (-880.141) (-876.323) (-878.332) -- 0:00:11
858000 -- (-883.679) (-879.612) (-877.845) [-878.955] * (-877.566) (-878.287) [-877.972] (-876.286) -- 0:00:11
858500 -- (-876.459) (-877.568) (-875.819) [-878.491] * (-876.485) (-878.715) [-876.190] (-878.258) -- 0:00:11
859000 -- (-878.952) (-876.952) [-876.084] (-878.543) * (-877.834) [-877.505] (-875.875) (-876.512) -- 0:00:10
859500 -- (-879.140) (-878.324) [-878.146] (-876.238) * (-878.348) (-878.428) (-877.890) [-878.273] -- 0:00:10
860000 -- (-877.285) (-876.900) (-879.066) [-877.475] * (-877.114) (-878.197) [-878.246] (-879.273) -- 0:00:10
Average standard deviation of split frequencies: 0.008729
860500 -- (-880.287) (-877.643) (-876.917) [-878.154] * (-876.948) [-877.500] (-881.508) (-878.759) -- 0:00:10
861000 -- (-876.881) (-876.851) (-881.637) [-878.819] * [-876.740] (-877.479) (-876.222) (-879.547) -- 0:00:10
861500 -- (-877.856) [-875.529] (-878.681) (-878.428) * (-876.811) [-877.047] (-879.082) (-879.892) -- 0:00:10
862000 -- (-879.606) [-876.349] (-878.037) (-877.753) * (-876.832) [-877.135] (-879.157) (-878.816) -- 0:00:10
862500 -- (-878.470) (-880.510) (-879.261) [-876.186] * (-876.900) [-876.623] (-877.188) (-876.742) -- 0:00:10
863000 -- (-875.850) (-879.680) (-877.111) [-877.414] * [-875.784] (-885.649) (-878.297) (-876.321) -- 0:00:10
863500 -- (-876.559) (-878.378) (-876.980) [-878.590] * (-876.099) [-882.297] (-883.105) (-876.484) -- 0:00:10
864000 -- (-880.234) [-878.405] (-879.087) (-876.910) * (-878.284) (-883.892) (-876.715) [-876.800] -- 0:00:10
864500 -- (-880.304) (-877.931) (-879.415) [-879.124] * (-878.173) (-880.738) [-877.970] (-877.949) -- 0:00:10
865000 -- (-881.269) (-878.974) [-880.090] (-877.692) * (-876.545) [-878.570] (-876.613) (-877.721) -- 0:00:10
Average standard deviation of split frequencies: 0.008437
865500 -- (-878.960) [-878.888] (-878.958) (-878.161) * (-876.341) (-877.391) (-880.359) [-876.855] -- 0:00:10
866000 -- [-876.347] (-880.730) (-880.536) (-878.401) * (-876.874) (-875.574) (-881.573) [-876.756] -- 0:00:10
866500 -- (-877.988) (-878.889) [-876.731] (-876.491) * (-876.984) (-877.372) (-876.139) [-878.746] -- 0:00:10
867000 -- [-877.881] (-881.928) (-876.638) (-878.128) * (-879.048) (-877.491) (-876.870) [-877.828] -- 0:00:10
867500 -- (-877.905) [-877.910] (-876.721) (-876.119) * (-876.363) [-878.145] (-876.884) (-877.039) -- 0:00:10
868000 -- (-879.836) (-879.219) [-877.128] (-877.735) * [-879.958] (-878.585) (-877.304) (-877.248) -- 0:00:10
868500 -- (-882.152) (-879.962) [-876.994] (-880.645) * [-876.388] (-880.615) (-875.824) (-881.612) -- 0:00:10
869000 -- [-881.965] (-877.980) (-876.887) (-883.560) * [-876.937] (-878.290) (-879.157) (-880.042) -- 0:00:10
869500 -- (-876.306) [-878.697] (-876.229) (-877.214) * (-877.722) (-876.970) [-877.429] (-878.795) -- 0:00:10
870000 -- (-879.604) (-878.325) (-876.235) [-876.427] * [-877.302] (-877.981) (-877.050) (-876.086) -- 0:00:10
Average standard deviation of split frequencies: 0.008528
870500 -- (-880.591) (-879.266) (-878.032) [-876.151] * (-878.173) (-881.433) [-876.563] (-880.114) -- 0:00:10
871000 -- [-878.900] (-879.053) (-883.705) (-876.617) * (-877.371) [-876.841] (-880.046) (-881.742) -- 0:00:10
871500 -- (-878.559) [-875.414] (-879.879) (-876.292) * (-877.948) [-876.752] (-879.059) (-878.703) -- 0:00:10
872000 -- [-876.523] (-875.811) (-876.364) (-878.002) * (-878.471) [-875.689] (-877.804) (-878.597) -- 0:00:09
872500 -- (-877.245) (-879.239) (-877.724) [-877.879] * (-879.866) [-876.280] (-877.151) (-877.167) -- 0:00:09
873000 -- (-878.148) (-879.191) [-879.012] (-877.002) * (-879.729) (-876.117) [-876.943] (-876.705) -- 0:00:09
873500 -- (-877.258) [-876.711] (-877.781) (-879.296) * (-876.995) (-875.508) (-879.039) [-876.367] -- 0:00:09
874000 -- [-875.786] (-876.950) (-876.814) (-878.649) * (-876.472) (-875.676) (-876.267) [-876.468] -- 0:00:09
874500 -- (-875.917) [-878.242] (-878.540) (-881.573) * [-875.760] (-880.734) (-876.622) (-878.391) -- 0:00:09
875000 -- (-878.551) (-879.026) (-879.394) [-877.120] * [-875.759] (-875.741) (-883.159) (-876.206) -- 0:00:09
Average standard deviation of split frequencies: 0.008543
875500 -- [-877.346] (-878.664) (-876.713) (-879.032) * (-877.530) (-876.062) (-877.661) [-878.021] -- 0:00:09
876000 -- (-877.442) (-878.828) [-877.164] (-879.377) * [-876.284] (-876.385) (-877.677) (-878.381) -- 0:00:09
876500 -- (-876.377) (-878.540) (-877.545) [-879.215] * (-880.920) (-875.927) [-877.429] (-878.228) -- 0:00:09
877000 -- (-876.762) [-878.930] (-878.032) (-878.865) * (-876.080) (-875.927) (-878.612) [-879.873] -- 0:00:09
877500 -- (-879.711) [-876.593] (-876.208) (-877.105) * [-880.706] (-879.500) (-877.669) (-876.742) -- 0:00:09
878000 -- (-880.928) (-876.687) (-876.760) [-876.981] * (-878.215) (-878.786) (-884.874) [-876.334] -- 0:00:09
878500 -- (-879.451) (-876.456) [-876.678] (-879.420) * [-881.096] (-879.333) (-876.166) (-878.626) -- 0:00:09
879000 -- (-878.613) (-876.105) (-877.691) [-879.420] * [-877.641] (-876.278) (-876.164) (-878.592) -- 0:00:09
879500 -- (-881.003) (-876.820) (-880.643) [-876.515] * (-877.071) [-878.297] (-877.713) (-877.720) -- 0:00:09
880000 -- (-880.587) (-876.103) (-883.424) [-878.052] * (-880.988) (-878.673) (-880.282) [-876.694] -- 0:00:09
Average standard deviation of split frequencies: 0.008899
880500 -- (-877.816) [-879.073] (-880.933) (-878.416) * (-878.613) [-875.953] (-876.399) (-878.903) -- 0:00:09
881000 -- (-878.367) [-878.275] (-878.138) (-875.582) * (-880.324) [-875.837] (-881.080) (-878.491) -- 0:00:09
881500 -- (-877.203) (-883.172) [-879.011] (-881.562) * (-879.567) (-875.726) (-877.445) [-877.415] -- 0:00:09
882000 -- (-880.276) (-877.752) [-878.230] (-876.918) * (-878.054) [-877.350] (-876.283) (-877.578) -- 0:00:09
882500 -- (-877.378) [-876.888] (-879.908) (-876.211) * (-876.562) (-880.048) [-877.753] (-879.611) -- 0:00:09
883000 -- (-882.457) [-879.533] (-881.311) (-876.462) * (-876.095) (-879.044) (-876.109) [-877.677] -- 0:00:09
883500 -- (-880.846) (-879.466) [-878.548] (-875.983) * (-876.269) (-876.417) [-877.852] (-877.251) -- 0:00:09
884000 -- (-878.333) [-876.352] (-877.624) (-877.416) * (-876.273) (-877.086) [-886.423] (-878.304) -- 0:00:09
884500 -- (-878.467) (-878.437) (-877.449) [-876.436] * (-877.500) (-876.613) [-878.028] (-877.544) -- 0:00:09
885000 -- (-878.712) [-880.572] (-882.403) (-876.652) * (-876.821) (-879.111) (-878.454) [-878.477] -- 0:00:08
Average standard deviation of split frequencies: 0.008845
885500 -- [-878.712] (-879.563) (-879.349) (-883.897) * (-878.557) [-877.767] (-877.115) (-876.932) -- 0:00:08
886000 -- (-876.472) (-876.161) [-878.683] (-879.427) * (-878.441) (-879.648) (-880.083) [-877.870] -- 0:00:08
886500 -- (-878.050) (-878.019) [-876.770] (-876.822) * (-878.162) [-884.115] (-877.344) (-876.961) -- 0:00:08
887000 -- [-878.752] (-877.627) (-877.448) (-878.194) * (-877.909) (-882.792) (-885.000) [-877.484] -- 0:00:08
887500 -- (-878.316) [-877.430] (-879.268) (-875.795) * (-878.908) (-880.365) [-879.754] (-875.639) -- 0:00:08
888000 -- (-877.068) [-877.306] (-876.672) (-875.829) * (-878.065) (-878.511) (-880.045) [-878.738] -- 0:00:08
888500 -- (-877.232) (-877.678) (-877.800) [-875.811] * (-876.176) (-878.440) [-876.918] (-878.517) -- 0:00:08
889000 -- (-878.163) (-879.473) [-877.964] (-877.678) * (-877.659) (-883.496) [-877.153] (-876.470) -- 0:00:08
889500 -- [-876.752] (-877.446) (-877.496) (-877.422) * (-877.851) (-883.271) (-878.224) [-877.149] -- 0:00:08
890000 -- (-877.331) (-875.876) [-877.608] (-879.123) * (-877.926) [-877.801] (-877.101) (-876.277) -- 0:00:08
Average standard deviation of split frequencies: 0.008832
890500 -- [-880.235] (-879.594) (-878.458) (-879.433) * (-878.241) (-877.444) [-875.835] (-876.951) -- 0:00:08
891000 -- (-876.255) (-878.177) (-876.817) [-881.433] * (-877.138) (-877.389) (-876.283) [-878.654] -- 0:00:08
891500 -- (-876.617) (-879.069) (-879.818) [-881.993] * [-876.169] (-877.808) (-876.242) (-878.266) -- 0:00:08
892000 -- (-875.653) [-876.153] (-878.826) (-879.683) * [-876.015] (-877.784) (-876.621) (-876.503) -- 0:00:08
892500 -- [-876.278] (-878.275) (-878.101) (-878.084) * [-879.515] (-877.769) (-877.623) (-878.952) -- 0:00:08
893000 -- (-884.706) (-877.163) (-876.688) [-879.520] * [-876.330] (-878.556) (-876.576) (-877.156) -- 0:00:08
893500 -- [-876.282] (-878.026) (-877.215) (-876.329) * (-876.744) (-877.002) (-878.020) [-879.859] -- 0:00:08
894000 -- (-876.252) [-877.500] (-876.218) (-876.245) * [-875.889] (-876.721) (-881.875) (-880.238) -- 0:00:08
894500 -- [-875.553] (-878.060) (-878.331) (-876.629) * [-879.643] (-876.238) (-879.576) (-879.907) -- 0:00:08
895000 -- (-877.984) (-877.165) (-878.924) [-878.089] * [-877.217] (-876.374) (-877.631) (-877.594) -- 0:00:08
Average standard deviation of split frequencies: 0.008582
895500 -- (-877.536) (-876.289) (-877.609) [-876.238] * [-877.522] (-877.575) (-877.109) (-876.287) -- 0:00:08
896000 -- (-877.529) (-877.038) [-877.136] (-877.022) * (-879.046) [-879.935] (-876.823) (-877.529) -- 0:00:08
896500 -- (-876.627) (-881.869) [-880.987] (-878.236) * (-879.383) (-877.300) [-875.825] (-877.179) -- 0:00:08
897000 -- (-878.119) (-879.054) (-880.433) [-878.294] * (-880.632) [-876.644] (-876.572) (-876.888) -- 0:00:08
897500 -- (-883.402) [-876.015] (-877.641) (-877.500) * [-878.836] (-877.197) (-878.913) (-879.654) -- 0:00:07
898000 -- (-882.576) (-878.277) [-876.863] (-876.580) * (-880.926) [-877.237] (-879.178) (-878.477) -- 0:00:07
898500 -- (-877.100) (-879.248) (-877.559) [-878.188] * (-877.281) (-876.410) (-877.891) [-877.361] -- 0:00:07
899000 -- (-877.216) (-879.896) [-877.316] (-879.337) * (-877.343) (-877.037) [-877.837] (-876.359) -- 0:00:07
899500 -- (-877.310) [-876.933] (-878.143) (-877.689) * (-877.492) [-876.123] (-877.167) (-880.073) -- 0:00:07
900000 -- (-878.755) (-875.465) [-875.878] (-877.889) * [-877.091] (-877.921) (-878.769) (-878.922) -- 0:00:07
Average standard deviation of split frequencies: 0.008538
900500 -- (-886.411) (-875.465) [-876.003] (-877.545) * (-878.876) (-876.945) [-877.762] (-879.942) -- 0:00:07
901000 -- [-878.948] (-880.464) (-876.819) (-883.222) * (-877.899) (-878.800) (-879.764) [-877.976] -- 0:00:07
901500 -- (-881.126) [-881.814] (-886.110) (-877.096) * (-877.594) [-878.077] (-877.745) (-882.275) -- 0:00:07
902000 -- [-879.636] (-879.371) (-882.702) (-876.724) * [-877.612] (-878.277) (-877.500) (-876.426) -- 0:00:07
902500 -- (-878.761) (-878.652) (-881.029) [-879.399] * [-876.572] (-881.569) (-878.893) (-876.625) -- 0:00:07
903000 -- [-879.105] (-882.154) (-876.958) (-879.737) * [-880.273] (-876.911) (-876.041) (-876.629) -- 0:00:07
903500 -- (-877.290) (-881.385) (-877.737) [-878.342] * (-877.869) (-876.776) (-876.410) [-879.007] -- 0:00:07
904000 -- [-880.398] (-877.430) (-877.805) (-880.087) * [-881.747] (-877.282) (-879.705) (-880.103) -- 0:00:07
904500 -- (-876.655) (-880.100) (-880.983) [-876.667] * [-876.329] (-879.065) (-877.716) (-876.752) -- 0:00:07
905000 -- (-876.063) [-877.709] (-878.827) (-878.052) * [-876.334] (-877.288) (-877.934) (-877.877) -- 0:00:07
Average standard deviation of split frequencies: 0.008618
905500 -- (-875.682) (-877.658) [-877.319] (-878.215) * (-876.978) (-875.823) (-879.411) [-876.401] -- 0:00:07
906000 -- (-882.363) (-877.354) [-876.141] (-878.671) * [-881.970] (-877.783) (-878.672) (-876.003) -- 0:00:07
906500 -- (-879.116) (-876.379) (-877.074) [-879.486] * [-877.926] (-878.388) (-877.025) (-875.931) -- 0:00:07
907000 -- [-877.219] (-878.399) (-876.749) (-881.909) * (-878.714) [-876.648] (-877.902) (-877.921) -- 0:00:07
907500 -- (-880.185) (-880.048) (-877.187) [-879.431] * [-877.402] (-876.481) (-878.271) (-877.888) -- 0:00:07
908000 -- [-878.178] (-877.905) (-886.287) (-876.130) * (-876.908) [-880.336] (-876.650) (-876.667) -- 0:00:07
908500 -- (-879.075) (-877.021) (-878.064) [-875.623] * [-878.478] (-876.951) (-878.738) (-876.401) -- 0:00:07
909000 -- (-880.089) (-876.764) (-879.583) [-878.889] * [-876.809] (-877.912) (-877.171) (-875.825) -- 0:00:07
909500 -- (-877.074) (-876.336) [-878.527] (-877.495) * (-877.623) (-876.907) [-878.120] (-877.033) -- 0:00:07
910000 -- (-877.782) (-878.547) (-877.423) [-876.399] * (-877.685) (-884.110) (-877.236) [-877.919] -- 0:00:07
Average standard deviation of split frequencies: 0.008185
910500 -- (-876.748) (-876.811) [-875.819] (-877.619) * (-877.357) (-878.456) (-877.010) [-877.356] -- 0:00:06
911000 -- (-876.037) [-877.207] (-878.435) (-879.939) * (-879.038) (-880.451) [-879.647] (-877.368) -- 0:00:06
911500 -- (-876.037) [-878.578] (-879.275) (-880.291) * (-878.383) [-877.767] (-878.840) (-878.275) -- 0:00:06
912000 -- (-876.855) (-878.225) [-876.378] (-877.912) * (-876.925) (-877.527) (-877.483) [-876.509] -- 0:00:06
912500 -- (-877.643) (-876.702) (-876.390) [-878.603] * [-877.688] (-877.898) (-876.528) (-876.283) -- 0:00:06
913000 -- [-877.682] (-878.330) (-876.469) (-878.886) * (-879.225) (-877.414) [-876.064] (-876.344) -- 0:00:06
913500 -- (-877.173) (-878.254) (-879.791) [-879.836] * [-877.465] (-876.071) (-876.906) (-876.818) -- 0:00:06
914000 -- (-877.590) [-879.489] (-876.690) (-878.348) * (-877.558) (-876.095) [-876.426] (-877.783) -- 0:00:06
914500 -- (-876.496) [-877.675] (-883.149) (-882.957) * (-877.221) (-877.315) [-876.514] (-876.844) -- 0:00:06
915000 -- (-877.213) (-876.054) [-879.249] (-878.964) * (-877.572) (-880.073) (-876.681) [-875.453] -- 0:00:06
Average standard deviation of split frequencies: 0.007816
915500 -- (-878.862) (-876.374) [-878.601] (-877.087) * (-879.160) (-879.098) (-877.361) [-875.919] -- 0:00:06
916000 -- [-876.827] (-881.628) (-882.629) (-878.181) * (-880.396) (-877.164) (-876.262) [-878.659] -- 0:00:06
916500 -- (-878.128) (-878.888) [-879.891] (-878.716) * (-877.789) (-879.427) [-876.728] (-877.648) -- 0:00:06
917000 -- [-877.073] (-878.476) (-880.350) (-881.193) * [-879.401] (-882.018) (-877.608) (-881.013) -- 0:00:06
917500 -- [-876.517] (-876.433) (-876.972) (-878.809) * (-878.535) (-879.275) (-877.113) [-881.121] -- 0:00:06
918000 -- (-877.724) (-880.645) [-877.553] (-881.930) * (-887.315) (-879.165) (-879.572) [-876.325] -- 0:00:06
918500 -- (-879.428) [-876.335] (-877.723) (-878.910) * [-878.113] (-876.901) (-877.821) (-875.898) -- 0:00:06
919000 -- (-878.759) [-876.041] (-879.300) (-878.076) * (-877.270) [-876.228] (-878.197) (-876.890) -- 0:00:06
919500 -- [-876.387] (-876.741) (-877.290) (-878.566) * (-880.896) (-876.324) [-879.365] (-877.271) -- 0:00:06
920000 -- (-880.381) (-883.273) [-877.644] (-878.592) * (-877.196) (-876.051) [-875.841] (-877.174) -- 0:00:06
Average standard deviation of split frequencies: 0.007936
920500 -- (-877.108) (-878.297) (-877.864) [-878.359] * (-881.865) (-877.590) (-876.183) [-879.562] -- 0:00:06
921000 -- [-876.920] (-877.175) (-877.062) (-878.324) * [-876.862] (-876.499) (-878.795) (-879.461) -- 0:00:06
921500 -- (-877.283) (-877.578) [-877.405] (-880.218) * (-877.226) (-878.199) [-876.487] (-878.012) -- 0:00:06
922000 -- (-876.101) (-881.121) [-883.376] (-882.003) * (-876.721) (-877.658) [-877.428] (-878.535) -- 0:00:06
922500 -- (-875.629) [-876.801] (-888.167) (-875.752) * (-876.492) [-875.843] (-879.667) (-879.900) -- 0:00:06
923000 -- (-876.442) (-878.795) (-882.642) [-878.679] * [-877.490] (-877.474) (-879.619) (-877.997) -- 0:00:06
923500 -- [-877.523] (-880.326) (-879.195) (-876.937) * (-879.403) (-877.835) [-876.261] (-876.987) -- 0:00:05
924000 -- (-878.025) (-878.695) (-880.987) [-877.198] * (-876.742) [-876.712] (-880.202) (-877.474) -- 0:00:05
924500 -- (-876.853) (-878.669) [-880.854] (-876.606) * (-876.402) [-875.915] (-881.936) (-879.748) -- 0:00:05
925000 -- (-877.920) (-880.972) [-877.872] (-880.766) * (-879.038) (-876.048) (-876.789) [-883.106] -- 0:00:05
Average standard deviation of split frequencies: 0.007604
925500 -- (-879.773) [-880.542] (-878.856) (-882.274) * (-877.277) (-878.568) (-876.471) [-879.233] -- 0:00:05
926000 -- [-880.651] (-883.193) (-877.170) (-882.128) * (-878.029) (-876.898) (-877.901) [-880.723] -- 0:00:05
926500 -- (-876.823) (-879.646) (-876.957) [-879.675] * (-877.767) [-880.226] (-878.655) (-876.228) -- 0:00:05
927000 -- (-877.761) (-881.149) (-878.741) [-878.190] * (-877.530) [-877.897] (-878.601) (-876.867) -- 0:00:05
927500 -- (-878.625) [-883.080] (-877.757) (-877.459) * (-876.596) [-875.655] (-878.097) (-880.625) -- 0:00:05
928000 -- [-878.346] (-884.067) (-876.893) (-876.165) * (-877.178) [-877.669] (-877.043) (-880.492) -- 0:00:05
928500 -- (-878.944) [-877.822] (-876.701) (-878.515) * (-877.366) [-876.342] (-878.506) (-879.331) -- 0:00:05
929000 -- (-876.400) (-876.089) [-878.244] (-879.975) * (-879.953) (-885.461) [-878.521] (-879.353) -- 0:00:05
929500 -- (-877.266) (-875.889) (-878.363) [-875.913] * (-880.784) (-878.089) [-878.025] (-881.919) -- 0:00:05
930000 -- (-877.812) (-877.239) (-879.311) [-876.600] * [-880.431] (-880.073) (-877.335) (-881.736) -- 0:00:05
Average standard deviation of split frequencies: 0.007724
930500 -- (-877.404) (-878.361) [-882.301] (-876.979) * (-876.814) [-878.134] (-877.329) (-879.385) -- 0:00:05
931000 -- (-877.930) (-881.987) [-877.830] (-881.845) * [-878.313] (-879.781) (-876.467) (-875.711) -- 0:00:05
931500 -- (-877.481) (-883.431) [-877.339] (-880.299) * [-876.170] (-878.823) (-881.096) (-876.095) -- 0:00:05
932000 -- [-878.888] (-881.999) (-876.814) (-882.845) * (-875.852) (-878.879) (-888.499) [-876.275] -- 0:00:05
932500 -- [-879.399] (-879.206) (-876.930) (-876.893) * (-878.259) (-877.935) (-879.148) [-878.048] -- 0:00:05
933000 -- [-878.959] (-881.611) (-879.984) (-876.444) * (-877.376) [-877.547] (-876.405) (-878.875) -- 0:00:05
933500 -- (-878.093) [-876.315] (-880.056) (-877.583) * (-879.505) (-877.711) (-877.551) [-879.362] -- 0:00:05
934000 -- (-878.063) (-877.775) [-876.489] (-877.777) * [-879.449] (-880.686) (-878.532) (-877.878) -- 0:00:05
934500 -- (-886.224) (-879.490) (-877.086) [-876.169] * (-880.571) (-880.269) [-876.453] (-878.684) -- 0:00:05
935000 -- (-880.281) [-877.799] (-878.670) (-879.038) * (-885.534) (-880.583) [-880.045] (-878.776) -- 0:00:05
Average standard deviation of split frequencies: 0.007366
935500 -- (-877.259) (-876.218) (-877.825) [-877.675] * (-880.224) [-878.221] (-878.172) (-881.377) -- 0:00:05
936000 -- (-878.426) (-875.718) [-881.393] (-877.240) * (-880.397) (-875.804) [-878.723] (-879.874) -- 0:00:04
936500 -- (-877.606) (-877.055) [-877.585] (-882.168) * (-882.056) (-878.403) (-876.095) [-881.015] -- 0:00:04
937000 -- (-877.451) [-881.685] (-880.271) (-883.302) * [-878.741] (-875.732) (-876.250) (-881.633) -- 0:00:04
937500 -- (-879.066) (-876.436) [-876.755] (-876.634) * (-877.751) (-878.622) [-877.692] (-877.978) -- 0:00:04
938000 -- [-877.234] (-876.949) (-878.355) (-878.720) * [-879.525] (-881.296) (-881.534) (-879.178) -- 0:00:04
938500 -- [-876.977] (-878.314) (-876.047) (-876.545) * (-888.383) (-877.910) (-878.803) [-877.444] -- 0:00:04
939000 -- (-880.914) [-877.174] (-880.226) (-878.281) * (-880.621) (-878.045) [-879.406] (-876.732) -- 0:00:04
939500 -- (-885.853) [-878.166] (-879.213) (-877.665) * (-878.661) (-880.015) [-876.825] (-877.469) -- 0:00:04
940000 -- (-879.489) (-879.590) (-877.144) [-879.824] * (-877.643) [-881.624] (-877.334) (-876.950) -- 0:00:04
Average standard deviation of split frequencies: 0.007924
940500 -- [-880.059] (-880.235) (-876.126) (-876.234) * [-879.021] (-876.676) (-878.026) (-876.786) -- 0:00:04
941000 -- [-877.484] (-882.310) (-877.175) (-879.711) * (-877.434) (-876.843) [-877.467] (-877.045) -- 0:00:04
941500 -- (-876.258) (-881.376) [-879.495] (-878.918) * [-875.864] (-877.672) (-876.973) (-877.274) -- 0:00:04
942000 -- (-878.893) (-882.906) [-879.345] (-880.803) * (-876.648) (-877.629) [-877.748] (-876.366) -- 0:00:04
942500 -- (-879.076) (-880.736) (-879.622) [-881.584] * (-877.273) [-878.670] (-877.900) (-877.942) -- 0:00:04
943000 -- (-879.061) [-880.837] (-880.846) (-881.768) * [-878.484] (-877.893) (-877.037) (-877.201) -- 0:00:04
943500 -- [-878.858] (-880.976) (-876.598) (-879.041) * (-877.797) (-879.367) (-878.077) [-877.871] -- 0:00:04
944000 -- (-882.968) (-883.865) [-876.465] (-878.501) * (-877.810) [-875.814] (-876.989) (-877.911) -- 0:00:04
944500 -- [-876.653] (-877.077) (-876.596) (-877.145) * (-875.820) (-876.238) (-878.123) [-878.700] -- 0:00:04
945000 -- (-878.338) (-876.686) [-876.250] (-876.600) * (-881.633) [-876.237] (-876.038) (-877.632) -- 0:00:04
Average standard deviation of split frequencies: 0.008253
945500 -- (-877.952) (-878.017) [-877.362] (-877.806) * (-879.743) (-877.013) [-876.661] (-880.361) -- 0:00:04
946000 -- (-877.114) (-878.255) (-876.647) [-879.136] * [-877.080] (-877.667) (-880.564) (-876.232) -- 0:00:04
946500 -- (-881.682) (-877.120) (-883.868) [-878.254] * (-880.004) (-878.698) (-876.307) [-876.653] -- 0:00:04
947000 -- (-881.386) (-876.869) (-879.343) [-878.182] * (-879.387) (-877.643) (-878.194) [-879.502] -- 0:00:04
947500 -- (-879.084) (-879.477) (-878.957) [-876.094] * (-877.970) [-879.675] (-878.097) (-879.951) -- 0:00:04
948000 -- (-877.080) (-879.979) [-879.079] (-875.503) * (-876.572) (-884.402) [-877.969] (-876.216) -- 0:00:04
948500 -- (-878.759) [-877.597] (-877.917) (-875.772) * (-877.415) (-878.326) (-879.463) [-876.602] -- 0:00:04
949000 -- [-881.524] (-876.892) (-877.842) (-876.827) * [-876.051] (-876.799) (-878.719) (-875.871) -- 0:00:03
949500 -- (-878.306) (-877.084) (-876.380) [-877.559] * [-876.627] (-876.798) (-878.534) (-876.855) -- 0:00:03
950000 -- (-877.975) [-877.391] (-877.300) (-883.621) * [-877.375] (-877.093) (-876.763) (-884.951) -- 0:00:03
Average standard deviation of split frequencies: 0.008492
950500 -- (-878.242) (-878.550) [-877.999] (-878.137) * (-879.034) (-877.414) (-878.914) [-878.715] -- 0:00:03
951000 -- (-879.973) (-882.217) (-879.665) [-877.012] * (-877.139) [-878.228] (-879.997) (-876.816) -- 0:00:03
951500 -- (-877.698) (-880.206) [-879.923] (-876.331) * (-876.643) (-876.845) (-882.407) [-879.422] -- 0:00:03
952000 -- (-878.292) (-876.601) [-877.505] (-882.194) * [-877.525] (-879.626) (-879.952) (-876.322) -- 0:00:03
952500 -- (-877.984) [-876.507] (-878.314) (-880.842) * (-879.022) (-878.505) (-882.253) [-877.918] -- 0:00:03
953000 -- (-879.164) (-877.538) (-878.246) [-881.972] * (-877.810) (-880.098) [-880.687] (-880.367) -- 0:00:03
953500 -- (-878.794) [-876.831] (-880.296) (-882.048) * (-877.970) (-877.760) (-883.968) [-876.123] -- 0:00:03
954000 -- (-877.512) (-880.149) (-880.237) [-877.646] * (-879.372) (-877.713) [-882.973] (-880.382) -- 0:00:03
954500 -- (-878.536) (-879.933) (-878.866) [-877.378] * (-876.681) [-876.552] (-878.778) (-876.311) -- 0:00:03
955000 -- (-876.829) [-878.393] (-878.024) (-876.088) * (-878.906) [-879.590] (-877.487) (-878.482) -- 0:00:03
Average standard deviation of split frequencies: 0.008753
955500 -- [-877.171] (-880.386) (-881.409) (-876.811) * (-879.886) (-879.290) [-876.143] (-878.017) -- 0:00:03
956000 -- (-879.009) [-877.215] (-875.624) (-877.443) * (-877.466) (-876.151) [-876.387] (-880.763) -- 0:00:03
956500 -- (-876.474) (-875.731) [-878.179] (-878.087) * (-876.639) [-877.186] (-880.296) (-881.468) -- 0:00:03
957000 -- (-875.690) [-877.602] (-885.908) (-876.762) * (-879.396) (-877.178) (-879.661) [-878.306] -- 0:00:03
957500 -- [-876.507] (-878.273) (-879.344) (-880.272) * (-875.747) (-877.777) [-879.312] (-876.703) -- 0:00:03
958000 -- (-878.303) [-877.975] (-880.463) (-879.420) * (-879.841) [-877.040] (-877.220) (-876.923) -- 0:00:03
958500 -- [-878.594] (-880.420) (-878.376) (-880.839) * (-876.208) [-877.985] (-876.297) (-880.068) -- 0:00:03
959000 -- [-877.998] (-877.446) (-878.877) (-878.675) * (-877.697) (-880.665) [-876.791] (-876.933) -- 0:00:03
959500 -- (-877.430) [-876.203] (-878.222) (-882.941) * (-879.403) (-881.653) (-875.750) [-879.154] -- 0:00:03
960000 -- (-879.738) (-876.745) (-876.693) [-877.299] * (-876.829) (-878.445) (-877.085) [-877.313] -- 0:00:03
Average standard deviation of split frequencies: 0.009047
960500 -- (-881.085) (-876.925) [-877.471] (-879.062) * (-878.224) (-881.267) (-876.487) [-878.159] -- 0:00:03
961000 -- (-878.198) (-877.646) (-876.951) [-876.790] * (-878.223) (-877.764) (-877.406) [-880.674] -- 0:00:03
961500 -- (-876.937) [-876.476] (-878.191) (-877.544) * [-880.819] (-878.111) (-879.710) (-878.284) -- 0:00:03
962000 -- (-880.121) (-877.936) [-876.661] (-878.647) * (-877.580) (-878.679) (-878.846) [-878.691] -- 0:00:02
962500 -- [-876.724] (-880.269) (-877.888) (-876.567) * (-881.457) [-876.434] (-876.866) (-877.544) -- 0:00:02
963000 -- (-876.731) (-878.970) (-876.043) [-876.863] * [-878.026] (-876.677) (-877.298) (-880.052) -- 0:00:02
963500 -- (-881.454) (-880.123) (-879.325) [-877.921] * (-879.989) (-877.134) [-876.635] (-881.804) -- 0:00:02
964000 -- (-876.590) (-877.215) [-880.360] (-876.045) * (-877.151) [-876.812] (-876.808) (-879.502) -- 0:00:02
964500 -- [-876.914] (-876.820) (-878.565) (-881.878) * (-875.882) (-878.288) [-876.098] (-877.151) -- 0:00:02
965000 -- (-877.363) (-877.677) [-876.942] (-878.906) * (-878.356) [-878.053] (-876.159) (-877.548) -- 0:00:02
Average standard deviation of split frequencies: 0.009272
965500 -- [-879.712] (-877.926) (-880.313) (-878.260) * (-876.622) [-881.045] (-882.424) (-877.053) -- 0:00:02
966000 -- [-876.116] (-876.743) (-881.168) (-876.090) * (-884.125) [-875.828] (-884.214) (-877.440) -- 0:00:02
966500 -- [-876.580] (-877.839) (-878.832) (-877.217) * [-876.745] (-875.903) (-877.946) (-877.876) -- 0:00:02
967000 -- (-878.892) (-877.376) (-876.253) [-879.071] * (-876.334) [-877.066] (-877.826) (-879.391) -- 0:00:02
967500 -- [-876.678] (-878.155) (-876.006) (-877.808) * (-881.987) (-877.031) [-878.887] (-878.096) -- 0:00:02
968000 -- (-875.669) [-877.388] (-877.923) (-881.544) * (-877.540) (-878.558) (-878.053) [-878.491] -- 0:00:02
968500 -- (-877.842) [-877.515] (-882.460) (-879.542) * (-878.078) (-881.030) [-876.794] (-880.463) -- 0:00:02
969000 -- (-879.331) [-877.197] (-877.944) (-881.335) * (-876.589) [-878.966] (-877.166) (-880.099) -- 0:00:02
969500 -- (-879.891) (-882.102) (-879.298) [-878.704] * [-877.086] (-879.306) (-880.196) (-880.604) -- 0:00:02
970000 -- (-878.330) [-878.617] (-878.448) (-878.238) * [-878.826] (-876.429) (-878.537) (-877.388) -- 0:00:02
Average standard deviation of split frequencies: 0.009136
970500 -- [-876.237] (-877.181) (-877.464) (-878.708) * [-878.867] (-877.406) (-876.502) (-878.721) -- 0:00:02
971000 -- (-877.674) [-877.980] (-882.053) (-880.704) * (-879.245) (-878.876) [-876.016] (-877.398) -- 0:00:02
971500 -- [-879.088] (-879.430) (-881.019) (-877.218) * (-880.099) (-878.694) [-876.351] (-877.461) -- 0:00:02
972000 -- [-877.098] (-880.364) (-877.513) (-876.756) * (-876.496) (-876.401) (-880.610) [-876.942] -- 0:00:02
972500 -- (-877.993) (-876.549) (-879.846) [-876.293] * [-877.272] (-882.827) (-881.632) (-877.764) -- 0:00:02
973000 -- (-877.617) [-878.023] (-886.819) (-878.256) * (-878.420) (-877.949) [-878.313] (-881.080) -- 0:00:02
973500 -- (-876.687) [-878.531] (-880.476) (-880.243) * (-877.834) (-876.357) [-879.133] (-880.507) -- 0:00:02
974000 -- (-876.829) [-877.668] (-880.064) (-879.990) * (-878.347) (-875.724) (-877.327) [-877.580] -- 0:00:02
974500 -- (-879.040) (-876.584) (-884.230) [-877.504] * (-881.388) (-876.299) (-876.091) [-877.550] -- 0:00:01
975000 -- (-877.315) [-881.794] (-877.921) (-878.692) * (-881.684) [-877.157] (-876.104) (-877.127) -- 0:00:01
Average standard deviation of split frequencies: 0.009328
975500 -- (-880.750) (-882.078) [-876.371] (-877.671) * (-877.426) (-877.920) (-875.619) [-877.230] -- 0:00:01
976000 -- (-880.215) (-878.807) [-876.130] (-876.750) * (-877.205) [-876.857] (-876.435) (-875.942) -- 0:00:01
976500 -- (-879.083) (-877.327) [-876.232] (-876.584) * (-876.085) (-877.007) (-879.329) [-875.692] -- 0:00:01
977000 -- [-878.862] (-877.456) (-876.398) (-876.527) * (-876.883) (-877.747) [-877.038] (-875.867) -- 0:00:01
977500 -- [-876.350] (-878.295) (-884.371) (-875.793) * (-877.833) (-876.057) [-880.262] (-876.001) -- 0:00:01
978000 -- [-878.019] (-882.128) (-882.777) (-876.872) * (-878.579) (-877.324) (-880.270) [-876.653] -- 0:00:01
978500 -- [-878.580] (-880.383) (-880.277) (-877.232) * (-876.655) [-879.121] (-877.264) (-877.808) -- 0:00:01
979000 -- (-876.968) [-877.145] (-879.559) (-879.534) * (-878.863) (-881.995) (-876.675) [-878.615] -- 0:00:01
979500 -- (-878.909) (-878.641) (-877.286) [-877.439] * [-875.549] (-882.069) (-875.523) (-876.460) -- 0:00:01
980000 -- (-879.178) (-879.291) (-876.032) [-877.347] * (-875.847) (-880.536) [-879.941] (-876.911) -- 0:00:01
Average standard deviation of split frequencies: 0.009999
980500 -- (-883.524) (-880.287) (-877.184) [-878.668] * (-878.593) [-880.100] (-877.357) (-876.403) -- 0:00:01
981000 -- (-881.117) (-878.245) [-876.973] (-875.935) * [-877.835] (-879.306) (-877.304) (-877.390) -- 0:00:01
981500 -- (-876.432) (-882.219) (-876.397) [-875.396] * (-876.115) [-878.062] (-876.771) (-881.677) -- 0:00:01
982000 -- (-876.179) [-876.186] (-877.277) (-875.470) * [-875.926] (-877.451) (-875.831) (-884.164) -- 0:00:01
982500 -- (-877.003) (-876.144) [-878.751] (-878.658) * (-876.095) (-876.342) (-875.777) [-878.279] -- 0:00:01
983000 -- (-877.701) (-880.706) [-875.699] (-876.926) * (-876.568) (-876.167) [-876.178] (-878.826) -- 0:00:01
983500 -- (-879.058) [-876.134] (-876.970) (-876.545) * (-880.141) (-875.760) [-877.939] (-876.713) -- 0:00:01
984000 -- [-876.077] (-875.833) (-877.140) (-885.201) * (-877.243) (-878.564) (-876.072) [-880.423] -- 0:00:01
984500 -- (-876.434) [-875.666] (-876.910) (-879.168) * (-877.628) (-882.009) [-876.519] (-876.520) -- 0:00:01
985000 -- (-878.805) (-879.067) [-876.824] (-879.451) * (-876.929) (-878.965) [-879.060] (-876.524) -- 0:00:01
Average standard deviation of split frequencies: 0.010136
985500 -- (-878.341) (-877.635) (-876.661) [-876.701] * [-877.281] (-878.019) (-877.535) (-879.996) -- 0:00:01
986000 -- (-880.284) [-877.843] (-876.077) (-876.021) * [-878.845] (-879.775) (-877.204) (-878.779) -- 0:00:01
986500 -- (-883.781) (-877.634) [-876.337] (-877.245) * (-876.344) (-878.424) (-882.672) [-878.450] -- 0:00:01
987000 -- (-876.850) (-878.415) [-877.415] (-876.191) * (-879.261) (-876.982) [-875.739] (-876.652) -- 0:00:01
987500 -- (-876.737) (-878.406) (-879.509) [-876.932] * (-882.435) [-875.827] (-882.365) (-876.993) -- 0:00:00
988000 -- (-876.065) [-876.579] (-880.467) (-878.261) * [-877.518] (-880.028) (-876.602) (-876.715) -- 0:00:00
988500 -- [-878.345] (-880.413) (-878.596) (-877.299) * [-876.613] (-880.027) (-876.089) (-878.268) -- 0:00:00
989000 -- [-876.980] (-876.908) (-878.772) (-878.814) * (-876.589) [-878.829] (-878.254) (-878.937) -- 0:00:00
989500 -- (-876.871) [-880.006] (-876.009) (-878.639) * (-876.674) (-880.537) [-877.433] (-877.089) -- 0:00:00
990000 -- [-878.222] (-876.513) (-878.669) (-879.239) * [-875.466] (-879.773) (-877.609) (-876.744) -- 0:00:00
Average standard deviation of split frequencies: 0.010056
990500 -- [-877.863] (-878.974) (-878.228) (-879.553) * [-877.808] (-880.023) (-877.335) (-876.859) -- 0:00:00
991000 -- (-881.976) [-876.170] (-877.445) (-878.894) * (-876.301) [-880.055] (-877.800) (-876.859) -- 0:00:00
991500 -- (-880.184) [-877.007] (-877.564) (-881.249) * (-876.324) (-879.785) [-877.963] (-882.866) -- 0:00:00
992000 -- (-881.010) (-877.343) (-883.602) [-876.283] * (-876.448) [-875.971] (-876.617) (-877.629) -- 0:00:00
992500 -- (-879.984) [-877.793] (-880.863) (-876.476) * (-876.846) [-878.016] (-877.345) (-878.047) -- 0:00:00
993000 -- [-876.354] (-877.190) (-878.598) (-877.550) * (-878.862) (-876.883) (-876.402) [-878.859] -- 0:00:00
993500 -- (-876.399) (-879.609) [-878.752] (-876.629) * (-877.461) (-878.044) (-877.422) [-876.525] -- 0:00:00
994000 -- (-881.788) (-881.976) [-875.790] (-877.211) * (-876.282) [-880.380] (-882.011) (-876.443) -- 0:00:00
994500 -- (-879.609) (-876.100) [-876.686] (-877.117) * (-878.349) (-879.893) [-879.531] (-878.389) -- 0:00:00
995000 -- [-877.627] (-877.236) (-879.191) (-876.002) * (-878.382) (-877.904) (-877.555) [-878.389] -- 0:00:00
Average standard deviation of split frequencies: 0.010065
995500 -- (-878.423) [-877.052] (-884.006) (-879.211) * (-879.186) (-879.198) (-880.750) [-875.461] -- 0:00:00
996000 -- [-878.807] (-877.996) (-879.861) (-877.096) * (-875.994) (-877.454) (-879.904) [-876.320] -- 0:00:00
996500 -- (-877.646) (-883.075) (-878.959) [-877.002] * (-877.756) (-876.226) (-876.731) [-876.901] -- 0:00:00
997000 -- (-877.381) (-877.732) [-876.660] (-878.286) * (-877.353) (-875.908) (-878.021) [-877.441] -- 0:00:00
997500 -- (-878.316) (-878.424) [-876.909] (-880.353) * (-876.315) [-876.234] (-877.365) (-877.507) -- 0:00:00
998000 -- (-877.874) (-878.657) (-882.645) [-876.879] * [-877.260] (-879.799) (-877.547) (-878.726) -- 0:00:00
998500 -- (-886.000) (-880.813) [-876.608] (-877.916) * [-876.790] (-878.237) (-878.707) (-878.753) -- 0:00:00
999000 -- (-882.733) (-877.204) [-876.771] (-880.435) * (-877.608) (-879.077) [-877.922] (-878.984) -- 0:00:00
999500 -- [-883.978] (-877.255) (-875.988) (-877.817) * (-877.823) (-877.655) [-881.492] (-876.082) -- 0:00:00
1000000 -- (-878.775) (-879.767) [-877.761] (-878.018) * (-879.235) [-875.956] (-878.498) (-878.986) -- 0:00:00
Average standard deviation of split frequencies: 0.009453
Analysis completed in 1 mins 18 seconds
Analysis used 76.32 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -875.35
Likelihood of best state for "cold" chain of run 2 was -875.35
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.7 % ( 24 %) Dirichlet(Pi{all})
31.0 % ( 17 %) Slider(Pi{all})
78.2 % ( 53 %) Multiplier(Alpha{1,2})
77.3 % ( 54 %) Multiplier(Alpha{3})
21.4 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.1 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.9 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.0 % ( 25 %) Dirichlet(Pi{all})
29.7 % ( 28 %) Slider(Pi{all})
79.3 % ( 53 %) Multiplier(Alpha{1,2})
77.5 % ( 46 %) Multiplier(Alpha{3})
21.5 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 83 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.5 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167201 0.82 0.67
3 | 166531 166138 0.84
4 | 166756 166956 166418
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167112 0.82 0.67
3 | 167220 166056 0.84
4 | 166446 166669 166497
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -877.14
|2 1 2 2 1 |
| 2 2 |
| 1 1 1 2 2 212 |
| 2 1 2 1 1 1 1 1 1|
|1 1 2 2 22 1 2 1 2 2 12 2|
| 1 22 1 1 21 2 21 1 |
| 1 12 1 2 1 121 2 1 2 1 1 2 2 |
| 1 22 1 1 2 2 1 |
| 11 22 1 1 11 1 2 2 12 22 1 1 |
| 2 2 1 2 2 1 1 21 |
| 2 1 2 1 1 1 |
| 2 2 1 2 2 2 12 |
| |
| 2 2 |
| 1 2 1 * |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -878.67
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -877.07 -879.84
2 -877.08 -880.67
--------------------------------------
TOTAL -877.07 -880.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904324 0.089749 0.379435 1.524989 0.869977 1461.00 1481.00 1.000
r(A<->C){all} 0.172915 0.019747 0.000056 0.450694 0.141411 90.51 173.60 1.000
r(A<->G){all} 0.170395 0.021960 0.000043 0.465670 0.125513 261.87 276.14 1.000
r(A<->T){all} 0.172483 0.020797 0.000070 0.451718 0.134321 181.51 211.13 1.002
r(C<->G){all} 0.161814 0.018800 0.000083 0.441205 0.123614 229.91 250.56 1.002
r(C<->T){all} 0.159538 0.017372 0.000078 0.434650 0.123585 176.09 206.25 1.000
r(G<->T){all} 0.162855 0.019619 0.000148 0.452377 0.123010 238.50 308.33 1.000
pi(A){all} 0.186475 0.000224 0.156354 0.214219 0.186371 1052.07 1184.61 1.001
pi(C){all} 0.295200 0.000328 0.260363 0.329982 0.294894 1142.47 1266.16 1.000
pi(G){all} 0.308321 0.000321 0.272021 0.342139 0.308155 1113.36 1205.20 1.000
pi(T){all} 0.210004 0.000255 0.179284 0.241352 0.209552 1273.67 1339.28 1.000
alpha{1,2} 0.425301 0.222395 0.000164 1.389629 0.264454 1083.79 1203.67 1.000
alpha{3} 0.473721 0.269307 0.000113 1.506697 0.299009 1155.52 1241.14 1.001
pinvar{all} 0.997583 0.000008 0.992053 0.999999 0.998525 898.24 1122.96 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- .****.
9 -- .**.**
10 -- ....**
11 -- .**...
12 -- .***.*
13 -- ..*..*
14 -- ..****
15 -- ...**.
16 -- .*..*.
17 -- .*...*
18 -- .*.*..
19 -- ...*.*
20 -- ..*.*.
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.007066 0.150566 0.160560 2
8 451 0.150233 0.011777 0.141905 0.158561 2
9 445 0.148235 0.007066 0.143238 0.153231 2
10 445 0.148235 0.008951 0.141905 0.154564 2
11 432 0.143904 0.028265 0.123917 0.163891 2
12 431 0.143571 0.023083 0.127249 0.159893 2
13 428 0.142572 0.009422 0.135909 0.149234 2
14 426 0.141905 0.003769 0.139241 0.144570 2
15 423 0.140906 0.001413 0.139907 0.141905 2
16 422 0.140573 0.006595 0.135909 0.145237 2
17 419 0.139574 0.002355 0.137908 0.141239 2
18 415 0.138241 0.018373 0.125250 0.151233 2
19 414 0.137908 0.009422 0.131246 0.144570 2
20 404 0.134577 0.002827 0.132578 0.136576 2
21 399 0.132911 0.001413 0.131912 0.133911 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100038 0.009659 0.000003 0.296118 0.069410 1.000 2
length{all}[2] 0.100229 0.009622 0.000056 0.298072 0.071529 1.000 2
length{all}[3] 0.104872 0.011675 0.000010 0.313377 0.071386 1.000 2
length{all}[4] 0.097452 0.009598 0.000034 0.297359 0.064969 1.001 2
length{all}[5] 0.099134 0.010572 0.000004 0.302606 0.066000 1.000 2
length{all}[6] 0.101731 0.010728 0.000046 0.305943 0.071511 1.000 2
length{all}[7] 0.096514 0.008727 0.000594 0.280135 0.070016 0.998 2
length{all}[8] 0.098889 0.008273 0.000041 0.290261 0.075669 0.998 2
length{all}[9] 0.101192 0.009901 0.000028 0.312278 0.069805 0.998 2
length{all}[10] 0.102890 0.008936 0.000034 0.288463 0.076974 0.998 2
length{all}[11] 0.111125 0.012393 0.000224 0.327506 0.076644 0.998 2
length{all}[12] 0.096796 0.009664 0.000011 0.297958 0.062115 1.002 2
length{all}[13] 0.102458 0.010287 0.000075 0.268645 0.074486 1.004 2
length{all}[14] 0.097921 0.010901 0.000180 0.303894 0.068383 0.999 2
length{all}[15] 0.102828 0.009175 0.000025 0.287377 0.077858 1.008 2
length{all}[16] 0.104545 0.009806 0.000019 0.301576 0.082414 0.998 2
length{all}[17] 0.093925 0.008291 0.000083 0.270100 0.065197 0.999 2
length{all}[18] 0.100941 0.009179 0.000690 0.295156 0.068363 0.998 2
length{all}[19] 0.097208 0.008773 0.000014 0.270904 0.068082 0.999 2
length{all}[20] 0.098833 0.008865 0.000734 0.299006 0.070514 0.998 2
length{all}[21] 0.093791 0.007594 0.000435 0.258938 0.066230 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009453
Maximum standard deviation of split frequencies = 0.028265
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 654
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
24 ambiguity characters in seq. 1
24 ambiguity characters in seq. 2
24 ambiguity characters in seq. 3
24 ambiguity characters in seq. 4
12 ambiguity characters in seq. 5
12 ambiguity characters in seq. 6
8 sites are removed. 1 2 3 4 215 216 217 218
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 210 / 210 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 210 / 210 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108110 0.097038 0.105099 0.093779 0.046997 0.047604 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -937.461788
Iterating by ming2
Initial: fx= 937.461788
x= 0.10811 0.09704 0.10510 0.09378 0.04700 0.04760 0.30000 1.30000
1 h-m-p 0.0000 0.0002 500.5975 +++ 879.964745 m 0.0002 14 | 1/8
2 h-m-p 0.0018 0.0091 48.4440 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 460.0893 ++ 879.340134 m 0.0000 46 | 2/8
4 h-m-p 0.0000 0.0160 36.5234 ---------.. | 2/8
5 h-m-p 0.0000 0.0002 410.8013 +++ 840.987910 m 0.0002 76 | 3/8
6 h-m-p 0.0029 0.0318 28.0378 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 358.4410 ++ 838.933763 m 0.0000 108 | 4/8
8 h-m-p 0.0002 0.0648 21.2529 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 292.6691 ++ 835.539609 m 0.0000 138 | 5/8
10 h-m-p 0.0006 0.0965 14.4167 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 207.1810 ++ 834.904131 m 0.0000 169 | 6/8
12 h-m-p 0.0889 8.0000 0.0000 --Y 834.904131 0 0.0014 182 | 6/8
13 h-m-p 0.9768 8.0000 0.0000 ----Y 834.904131 0 0.0010 199
Out..
lnL = -834.904131
200 lfun, 200 eigenQcodon, 1200 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049981 0.091539 0.049109 0.039186 0.074597 0.074923 0.299906 0.829423 0.250063
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 15.176457
np = 9
lnL0 = -909.132015
Iterating by ming2
Initial: fx= 909.132015
x= 0.04998 0.09154 0.04911 0.03919 0.07460 0.07492 0.29991 0.82942 0.25006
1 h-m-p 0.0000 0.0002 460.8166 +++ 864.090291 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0001 401.9197 ++ 854.083132 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0000 5020.4802 ++ 853.346784 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 28465.7708 ++ 838.289161 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 1123.4162 ++ 838.156657 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 6421.8544 ++ 834.904044 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 834.904044 m 8.0000 87 | 6/9
8 h-m-p 0.0016 0.0952 0.9282 ----------Y 834.904044 0 0.0000 112 | 6/9
9 h-m-p 0.0160 8.0000 0.0083 +++++ 834.904027 m 8.0000 130 | 6/9
10 h-m-p 0.1333 0.6666 0.3550 -----------Y 834.904027 0 0.0000 156 | 6/9
11 h-m-p 0.0160 8.0000 0.0002 --------N 834.904027 0 0.0000 179 | 6/9
12 h-m-p 0.0160 8.0000 0.0006 +++++ 834.904026 m 8.0000 197 | 6/9
13 h-m-p 0.0124 0.8531 0.3764 ------------Y 834.904026 0 0.0000 224 | 6/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 834.904026 m 8.0000 242 | 6/9
15 h-m-p 0.0069 3.4381 0.2390 ------------Y 834.904026 0 0.0000 269 | 6/9
16 h-m-p 0.0160 8.0000 0.0003 +++++ 834.904025 m 8.0000 287 | 6/9
17 h-m-p 0.0109 3.3182 0.2481 -------------.. | 6/9
18 h-m-p 0.0160 8.0000 0.0004 +++++ 834.904024 m 8.0000 331 | 6/9
19 h-m-p 0.0208 6.9415 0.1661 ------------Y 834.904024 0 0.0000 358 | 6/9
20 h-m-p 0.0001 0.0588 0.9646 +++++ 834.903993 m 0.0588 376 | 7/9
21 h-m-p 0.3061 6.5483 0.1446 ---------------.. | 7/9
22 h-m-p 0.0160 8.0000 0.0005 +++++ 834.903991 m 8.0000 421 | 7/9
23 h-m-p 0.0200 4.6879 0.2004 ----------Y 834.903991 0 0.0000 445 | 7/9
24 h-m-p 0.0160 8.0000 0.0126 +++++ 834.903923 m 8.0000 462 | 7/9
25 h-m-p 0.4479 4.3941 0.2242 ----------------.. | 7/9
26 h-m-p 0.0160 8.0000 0.0009 +++++ 834.903917 m 8.0000 507 | 7/9
27 h-m-p 0.0487 6.8229 0.1510 -----------C 834.903917 0 0.0000 532 | 7/9
28 h-m-p 0.0160 8.0000 0.0001 +++++ 834.903916 m 8.0000 549 | 7/9
29 h-m-p 0.0132 6.6101 0.1508 ----------C 834.903916 0 0.0000 573 | 7/9
30 h-m-p 0.0029 1.4387 0.0164 +++++ 834.903892 m 1.4387 590 | 8/9
31 h-m-p 0.1105 8.0000 0.0004 ++++ 834.903891 m 8.0000 606 | 8/9
32 h-m-p 0.0160 8.0000 0.8751 -------------.. | 8/9
33 h-m-p 0.0160 8.0000 0.0003 +++++ 834.903890 m 8.0000 646 | 8/9
34 h-m-p 0.0160 8.0000 0.8702 -----------Y 834.903890 0 0.0000 670 | 8/9
35 h-m-p 0.0160 8.0000 0.0002 -------------.. | 8/9
36 h-m-p 0.0160 8.0000 0.0003 +++++ 834.903889 m 8.0000 710 | 8/9
37 h-m-p 0.0160 8.0000 0.8638 -----------Y 834.903889 0 0.0000 734 | 8/9
38 h-m-p 0.0160 8.0000 0.0000 ----C 834.903889 0 0.0000 751 | 8/9
39 h-m-p 0.0160 8.0000 0.0001 +++++ 834.903889 m 8.0000 767 | 8/9
40 h-m-p 0.0160 8.0000 0.8819 ------------Y 834.903889 0 0.0000 792 | 8/9
41 h-m-p 0.0160 8.0000 0.0000 +++++ 834.903889 m 8.0000 808 | 8/9
42 h-m-p 0.0160 8.0000 1.5016 -------------.. | 8/9
43 h-m-p 0.0160 8.0000 0.0004 +++++ 834.903888 m 8.0000 847 | 8/9
44 h-m-p 0.0026 0.1860 1.0867 ++++ 834.903808 m 0.1860 862 | 9/9
45 h-m-p 0.0160 8.0000 0.0000 Y 834.903808 0 0.0160 874 | 9/9
46 h-m-p 0.0160 8.0000 0.0000 Y 834.903808 0 0.0160 886
Out..
lnL = -834.903808
887 lfun, 2661 eigenQcodon, 10644 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048308 0.104384 0.018831 0.061440 0.094160 0.083123 0.000100 1.465814 0.142477 0.377725 1.416525
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.224968
np = 11
lnL0 = -914.716571
Iterating by ming2
Initial: fx= 914.716571
x= 0.04831 0.10438 0.01883 0.06144 0.09416 0.08312 0.00011 1.46581 0.14248 0.37772 1.41653
1 h-m-p 0.0000 0.0000 454.1535 ++ 914.256161 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 388.8099 +++ 892.511361 m 0.0002 31 | 2/11
3 h-m-p 0.0001 0.0005 141.5715 ++ 867.307329 m 0.0005 45 | 3/11
4 h-m-p 0.0006 0.0030 45.1842 ++ 853.394650 m 0.0030 59 | 4/11
5 h-m-p 0.0000 0.0000 8690.7965 ++ 840.162099 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0001 1409.7688 ++ 836.355431 m 0.0001 87 | 6/11
7 h-m-p 0.0000 0.0000 118469.4663 ++ 835.466067 m 0.0000 101 | 7/11
8 h-m-p 0.0160 8.0000 7.1496 -------------.. | 7/11
9 h-m-p 0.0000 0.0000 202.0639 ++ 834.904025 m 0.0000 140 | 8/11
10 h-m-p 0.0274 8.0000 0.0000 +++++ 834.904025 m 8.0000 157 | 8/11
11 h-m-p 0.0236 8.0000 0.0017 +++++ 834.904025 m 8.0000 177 | 8/11
12 h-m-p 0.0288 8.0000 0.4806 --------C 834.904025 0 0.0000 202 | 8/11
13 h-m-p 0.0160 8.0000 0.0002 -------N 834.904025 0 0.0000 226 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 N 834.904025 0 0.0160 243
Out..
lnL = -834.904025
244 lfun, 976 eigenQcodon, 4392 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -834.923158 S = -834.901643 -0.008254
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:05
did 20 / 54 patterns 0:05
did 30 / 54 patterns 0:05
did 40 / 54 patterns 0:05
did 50 / 54 patterns 0:05
did 54 / 54 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.035102 0.080166 0.079122 0.031359 0.041752 0.082864 0.000100 0.770929 1.500579
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.673574
np = 9
lnL0 = -902.654890
Iterating by ming2
Initial: fx= 902.654890
x= 0.03510 0.08017 0.07912 0.03136 0.04175 0.08286 0.00011 0.77093 1.50058
1 h-m-p 0.0000 0.0000 452.3730 ++ 902.334080 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0121 63.8031 +++++ 862.667717 m 0.0121 29 | 2/9
3 h-m-p 0.0000 0.0002 348.9610 ++ 844.684643 m 0.0002 41 | 3/9
4 h-m-p 0.0001 0.0005 10.4048 ++ 842.590420 m 0.0005 53 | 4/9
5 h-m-p 0.0000 0.0000 63.4883 ++ 842.556126 m 0.0000 65 | 5/9
6 h-m-p 0.0000 0.0001 142.7900 ++ 840.087654 m 0.0001 77 | 6/9
7 h-m-p 0.0003 0.0134 14.7274 +++ 836.561087 m 0.0134 90 | 7/9
8 h-m-p 0.0021 1.0365 94.1784 ------------.. | 7/9
9 h-m-p 0.0000 0.0000 192.1933 ++ 834.903808 m 0.0000 124 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 Y 834.903808 0 1.6000 136 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 --Y 834.903808 0 0.0250 151
Out..
lnL = -834.903808
152 lfun, 1672 eigenQcodon, 9120 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.061274 0.055525 0.064514 0.018735 0.015608 0.079751 0.000100 0.900000 0.603363 1.871434 1.299830
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.385359
np = 11
lnL0 = -890.568279
Iterating by ming2
Initial: fx= 890.568279
x= 0.06127 0.05552 0.06451 0.01873 0.01561 0.07975 0.00011 0.90000 0.60336 1.87143 1.29983
1 h-m-p 0.0000 0.0000 431.5783 ++ 890.253126 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0009 146.2927 ++++ 872.709866 m 0.0009 32 | 2/11
3 h-m-p 0.0000 0.0000 361.2611 ++ 869.782289 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0056 99.5131 +++ 841.749525 m 0.0056 61 | 4/11
5 h-m-p 0.0000 0.0000 9939.5347 ++ 838.634210 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0000 1813.1337 ++ 838.610343 m 0.0000 89 | 6/11
7 h-m-p 0.0001 0.0009 12.0795 ++ 838.575410 m 0.0009 103 | 7/11
8 h-m-p 0.0003 0.0116 36.8574 ----------.. | 7/11
9 h-m-p 0.0000 0.0001 198.5180 ++ 834.904069 m 0.0001 139 | 8/11
10 h-m-p 0.9257 8.0000 0.0000 ++ 834.904069 m 8.0000 153 | 8/11
11 h-m-p 0.0160 8.0000 0.0493 +++++ 834.904052 m 8.0000 173 | 8/11
12 h-m-p 0.3641 5.1916 1.0832 ---------------.. | 8/11
13 h-m-p 0.0160 8.0000 0.0003 +++++ 834.904052 m 8.0000 220 | 8/11
14 h-m-p 0.0089 2.7335 0.2534 -------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0003 +++++ 834.904051 m 8.0000 268 | 8/11
16 h-m-p 0.0081 2.4915 0.2788 ----------C 834.904051 0 0.0000 295 | 8/11
17 h-m-p 0.0160 8.0000 0.0090 +++++ 834.904028 m 8.0000 315 | 8/11
18 h-m-p 0.2301 2.5504 0.3124 ---------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0004 +++++ 834.904027 m 8.0000 365 | 8/11
20 h-m-p 0.0124 3.1488 0.2408 ----------Y 834.904027 0 0.0000 392 | 8/11
21 h-m-p 0.0160 8.0000 0.0047 +++++ 834.904012 m 8.0000 412 | 8/11
22 h-m-p 0.1342 3.1023 0.2803 ------------C 834.904012 0 0.0000 441 | 8/11
23 h-m-p 0.0070 3.5086 0.0710 +++++ 834.903808 m 3.5086 461 | 9/11
24 h-m-p 1.6000 8.0000 0.0000 ++ 834.903808 m 8.0000 478 | 9/11
25 h-m-p 0.1778 8.0000 0.0013 +++ 834.903808 m 8.0000 495 | 9/11
26 h-m-p 0.0726 1.2902 0.1454 +
QuantileBeta(0.15, 0.00500, 2.17825) = 1.209158e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
+ 834.903808 m 1.2902 512
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18863) = 1.201932e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18839) = 1.202101e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18851) = 1.202016e-160 2000 rounds
| 10/11
27 h-m-p 0.5334 8.0000 0.1934
QuantileBeta(0.15, 0.00500, 2.29165) = 1.134587e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60107) = 9.708456e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
+ 834.903808 m 8.0000 528
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.561346e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73554) = 6.339710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73523) = 6.340326e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
| 10/11
28 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
Y 834.903808 0 1.6000 543
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.561346e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73554) = 6.339710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73523) = 6.340326e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
| 10/11
29 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
Y 834.903808 0 0.0160 558
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
Out..
lnL = -834.903808
559 lfun, 6708 eigenQcodon, 36894 P(t)
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -834.968012 S = -834.904811 -0.028111
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:16
did 20 / 54 patterns 0:17
did 30 / 54 patterns 0:17
did 40 / 54 patterns 0:17
did 50 / 54 patterns 0:17
did 54 / 54 patterns 0:17
QuantileBeta(0.15, 0.00500, 3.73539) = 6.340018e-161 2000 rounds
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=218
NC_011896_1_WP_010907717_1_427_MLBR_RS02050 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
NC_002677_1_NP_301393_1_265_ML0418 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220 VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305 VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG
**********************************************
NC_011896_1_WP_010907717_1_427_MLBR_RS02050 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
NC_002677_1_NP_301393_1_265_ML0418 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305 WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS
**************************************************
NC_011896_1_WP_010907717_1_427_MLBR_RS02050 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
NC_002677_1_NP_301393_1_265_ML0418 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305 ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS
**************************************************
NC_011896_1_WP_010907717_1_427_MLBR_RS02050 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NC_002677_1_NP_301393_1_265_ML0418 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305 RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA
**************************************************
NC_011896_1_WP_010907717_1_427_MLBR_RS02050 NRLPAENVTHWDIWoooo
NC_002677_1_NP_301393_1_265_ML0418 NRLPAENVTHWDIWoooo
NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875 NRLPAENVTHWDIWoooo
NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575 NRLPAENVTHWDIWoooo
NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220 NRLPAENVTHWDIW----
NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305 NRLPAENVTHWDIW----
**************
>NC_011896_1_WP_010907717_1_427_MLBR_RS02050 ------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG-------- ---- >NC_002677_1_NP_301393_1_265_ML0418 ------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG-------- ---- >NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875 ------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG-------- ---- >NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575 ------------TTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG-------- ---- >NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220 GTGAATCTAAACTTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG-------- ---- >NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305 GTGAATCTAAACTTGTCTGTTGACGAAGTTCTTACCACTACCCGTTCAGT GCGCAAACGGCTCGACTTCGACAAACCTGTGCCTCGCGACGTGTTGATGG AATGCCTACAGCTAGCGTTGCAGGCACCGACCGGTTCCAATTCGCAGGGC TGGCATTGGGTGTTCGTCGAGGACGCCGAAAAGCGCAAGGCTATCGGTGA CATCTACCTGGTCAATGCCCGGTGCTACCTAAGCCAGCCCGCACCTGAAT ACCCTGAAGGCGACACGCGTGGTGAACGGATGAGGCTGGTGCGCGATTCC GCGACTTATCTCGCCGAGCATATGCACGAGGTGCCGGTTCTGTTGATCCC GTGCCTATTGGGTCGGGCGGAAGAGTCGCCGTTGGGCGCTGTGTCGTACT GGGCATCGTTGTTTCCAGCGGTCTGGAGCTTCTGCCTAGCGCTTCGCTCC CGAGGACTGGGCACGTGCTGGACCAGCTTGCACTTGCTTGGCGACGGTGA GCAGCGGGCGGCCGAGGTACTAGGCATTCCTTCCGACAAGTACAGCCAGG GCGGGCTGTTTCCCATCGCCTACACCAAAGGAACCGACTTCCGGCCGGCC AACCGGCTGCCCGCCGAGAACGTCACGCACTGGGACATCTGG-------- ----
>NC_011896_1_WP_010907717_1_427_MLBR_RS02050 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA NRLPAENVTHWDIW >NC_002677_1_NP_301393_1_265_ML0418 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA NRLPAENVTHWDIW >NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA NRLPAENVTHWDIW >NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575 ----LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA NRLPAENVTHWDIW >NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220 VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA NRLPAENVTHWDIW >NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305 VNLNLSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQG WHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDS ATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRS RGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPA NRLPAENVTHWDIW
#NEXUS
[ID: 1985819497]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907717_1_427_MLBR_RS02050
NC_002677_1_NP_301393_1_265_ML0418
NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875
NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575
NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220
NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907717_1_427_MLBR_RS02050,
2 NC_002677_1_NP_301393_1_265_ML0418,
3 NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875,
4 NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575,
5 NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220,
6 NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06940958,2:0.07152856,3:0.07138619,4:0.06496877,5:0.06600008,6:0.07151132);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06940958,2:0.07152856,3:0.07138619,4:0.06496877,5:0.06600008,6:0.07151132);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -877.07 -879.84
2 -877.08 -880.67
--------------------------------------
TOTAL -877.07 -880.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0418/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904324 0.089749 0.379435 1.524989 0.869977 1461.00 1481.00 1.000
r(A<->C){all} 0.172915 0.019747 0.000056 0.450694 0.141411 90.51 173.60 1.000
r(A<->G){all} 0.170395 0.021960 0.000043 0.465670 0.125513 261.87 276.14 1.000
r(A<->T){all} 0.172483 0.020797 0.000070 0.451718 0.134321 181.51 211.13 1.002
r(C<->G){all} 0.161814 0.018800 0.000083 0.441205 0.123614 229.91 250.56 1.002
r(C<->T){all} 0.159538 0.017372 0.000078 0.434650 0.123585 176.09 206.25 1.000
r(G<->T){all} 0.162855 0.019619 0.000148 0.452377 0.123010 238.50 308.33 1.000
pi(A){all} 0.186475 0.000224 0.156354 0.214219 0.186371 1052.07 1184.61 1.001
pi(C){all} 0.295200 0.000328 0.260363 0.329982 0.294894 1142.47 1266.16 1.000
pi(G){all} 0.308321 0.000321 0.272021 0.342139 0.308155 1113.36 1205.20 1.000
pi(T){all} 0.210004 0.000255 0.179284 0.241352 0.209552 1273.67 1339.28 1.000
alpha{1,2} 0.425301 0.222395 0.000164 1.389629 0.264454 1083.79 1203.67 1.000
alpha{3} 0.473721 0.269307 0.000113 1.506697 0.299009 1155.52 1241.14 1.001
pinvar{all} 0.997583 0.000008 0.992053 0.999999 0.998525 898.24 1122.96 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0418/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 210
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 4 4 4 4 4 4 | TAC 6 6 6 6 6 6 | TGC 5 5 5 5 5 5
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 9 9 9 9 9 9 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 5 5 5 5 5 5 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 3 3 3 3 3 3 | CGC 5 5 5 5 5 5
CTA 6 6 6 6 6 6 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 6 6 6 6 6 6 | CCG 5 5 5 5 5 5 | CAG 6 6 6 6 6 6 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 5 5 5 5 5 5 | ACC 6 6 6 6 6 6 | AAC 2 2 2 2 2 2 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 5 5 5 5 5 5
GTC 4 4 4 4 4 4 | GCC 7 7 7 7 7 7 | GAC 11 11 11 11 11 11 | GGC 7 7 7 7 7 7
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 7 7 7 7 7 7 | GGA 2 2 2 2 2 2
GTG 7 7 7 7 7 7 | GCG 6 6 6 6 6 6 | GAG 7 7 7 7 7 7 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907717_1_427_MLBR_RS02050
position 1: T:0.20952 C:0.27143 A:0.16667 G:0.35238
position 2: T:0.26667 C:0.25238 A:0.25714 G:0.22381
position 3: T:0.15238 C:0.37143 A:0.11905 G:0.35714
Average T:0.20952 C:0.29841 A:0.18095 G:0.31111
#2: NC_002677_1_NP_301393_1_265_ML0418
position 1: T:0.20952 C:0.27143 A:0.16667 G:0.35238
position 2: T:0.26667 C:0.25238 A:0.25714 G:0.22381
position 3: T:0.15238 C:0.37143 A:0.11905 G:0.35714
Average T:0.20952 C:0.29841 A:0.18095 G:0.31111
#3: NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875
position 1: T:0.20952 C:0.27143 A:0.16667 G:0.35238
position 2: T:0.26667 C:0.25238 A:0.25714 G:0.22381
position 3: T:0.15238 C:0.37143 A:0.11905 G:0.35714
Average T:0.20952 C:0.29841 A:0.18095 G:0.31111
#4: NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575
position 1: T:0.20952 C:0.27143 A:0.16667 G:0.35238
position 2: T:0.26667 C:0.25238 A:0.25714 G:0.22381
position 3: T:0.15238 C:0.37143 A:0.11905 G:0.35714
Average T:0.20952 C:0.29841 A:0.18095 G:0.31111
#5: NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220
position 1: T:0.20952 C:0.27143 A:0.16667 G:0.35238
position 2: T:0.26667 C:0.25238 A:0.25714 G:0.22381
position 3: T:0.15238 C:0.37143 A:0.11905 G:0.35714
Average T:0.20952 C:0.29841 A:0.18095 G:0.31111
#6: NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305
position 1: T:0.20952 C:0.27143 A:0.16667 G:0.35238
position 2: T:0.26667 C:0.25238 A:0.25714 G:0.22381
position 3: T:0.15238 C:0.37143 A:0.11905 G:0.35714
Average T:0.20952 C:0.29841 A:0.18095 G:0.31111
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 24 | TCC 24 | TAC 36 | TGC 30
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 54 | TCG 24 | TAG 0 | Trp W TGG 42
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 30 | His H CAT 12 | Arg R CGT 12
CTC 12 | CCC 18 | CAC 18 | CGC 30
CTA 36 | CCA 6 | Gln Q CAA 0 | CGA 6
CTG 36 | CCG 30 | CAG 36 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 0
ATC 30 | ACC 36 | AAC 12 | AGC 24
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 18 | ACG 18 | AAG 18 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 30
GTC 24 | GCC 42 | GAC 66 | GGC 42
GTA 6 | GCA 18 | Glu E GAA 42 | GGA 12
GTG 42 | GCG 36 | GAG 42 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20952 C:0.27143 A:0.16667 G:0.35238
position 2: T:0.26667 C:0.25238 A:0.25714 G:0.22381
position 3: T:0.15238 C:0.37143 A:0.11905 G:0.35714
Average T:0.20952 C:0.29841 A:0.18095 G:0.31111
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -834.904131 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299906 1.299830
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907717_1_427_MLBR_RS02050: 0.000004, NC_002677_1_NP_301393_1_265_ML0418: 0.000004, NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875: 0.000004, NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575: 0.000004, NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220: 0.000004, NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29991
omega (dN/dS) = 1.29983
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 497.2 132.8 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 497.2 132.8 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 497.2 132.8 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 497.2 132.8 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 497.2 132.8 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 497.2 132.8 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -834.903808 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907717_1_427_MLBR_RS02050: 0.000004, NC_002677_1_NP_301393_1_265_ML0418: 0.000004, NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875: 0.000004, NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575: 0.000004, NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220: 0.000004, NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -834.904025 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.712772 0.148655 0.000001 1.235406
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907717_1_427_MLBR_RS02050: 0.000004, NC_002677_1_NP_301393_1_265_ML0418: 0.000004, NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875: 0.000004, NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575: 0.000004, NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220: 0.000004, NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.71277 0.14866 0.13857
w: 0.00000 1.00000 1.23541
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 503.6 126.4 0.3198 0.0000 0.0000 0.0 0.0
7..2 0.000 503.6 126.4 0.3198 0.0000 0.0000 0.0 0.0
7..3 0.000 503.6 126.4 0.3198 0.0000 0.0000 0.0 0.0
7..4 0.000 503.6 126.4 0.3198 0.0000 0.0000 0.0 0.0
7..5 0.000 503.6 126.4 0.3198 0.0000 0.0000 0.0 0.0
7..6 0.000 503.6 126.4 0.3198 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907717_1_427_MLBR_RS02050)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907717_1_427_MLBR_RS02050)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -834.903808 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.385320
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907717_1_427_MLBR_RS02050: 0.000004, NC_002677_1_NP_301393_1_265_ML0418: 0.000004, NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875: 0.000004, NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575: 0.000004, NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220: 0.000004, NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.38532
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -834.903808 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 3.735386 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907717_1_427_MLBR_RS02050: 0.000004, NC_002677_1_NP_301393_1_265_ML0418: 0.000004, NZ_LVXE01000036_1_WP_010907717_1_1611_A3216_RS09875: 0.000004, NZ_LYPH01000040_1_WP_010907717_1_1584_A8144_RS07575: 0.000004, NZ_CP029543_1_WP_041322404_1_434_DIJ64_RS02220: 0.000004, NZ_AP014567_1_WP_041322404_1_451_JK2ML_RS02305: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 3.73539
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 503.6 126.4 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907717_1_427_MLBR_RS02050)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.105 0.103 0.102 0.101 0.100 0.099 0.098 0.098 0.097 0.096
Time used: 0:17
Model 1: NearlyNeutral -834.903808 Model 2: PositiveSelection -834.904025 Model 0: one-ratio -834.904131 Model 7: beta -834.903808 Model 8: beta&w>1 -834.903808 Model 0 vs 1 6.459999999606225E-4 Model 2 vs 1 4.340000000411237E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
