--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:36:21 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0425/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -308.04 -311.22
2 -307.98 -311.10
--------------------------------------
TOTAL -308.01 -311.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890954 0.085765 0.363507 1.469787 0.862850 1297.91 1399.46 1.000
r(A<->C){all} 0.170013 0.020479 0.000139 0.456787 0.130758 177.76 183.28 1.000
r(A<->G){all} 0.160539 0.019009 0.000023 0.440450 0.122401 144.69 239.08 1.001
r(A<->T){all} 0.179374 0.021419 0.000028 0.462845 0.138539 202.80 205.04 1.000
r(C<->G){all} 0.161319 0.017438 0.000054 0.433210 0.131655 208.57 291.16 1.008
r(C<->T){all} 0.164928 0.019065 0.000031 0.445068 0.130793 151.75 152.59 1.001
r(G<->T){all} 0.163828 0.019146 0.000020 0.447042 0.126309 230.96 239.01 1.006
pi(A){all} 0.192718 0.000648 0.145691 0.244122 0.191700 1120.36 1166.59 1.000
pi(C){all} 0.261933 0.000845 0.203375 0.315796 0.261801 1419.55 1422.26 1.000
pi(G){all} 0.335798 0.001017 0.273066 0.397036 0.335207 1187.17 1248.61 1.000
pi(T){all} 0.209551 0.000737 0.158689 0.263132 0.208871 1117.75 1186.32 1.000
alpha{1,2} 0.414520 0.225391 0.000124 1.419198 0.249505 1169.35 1246.33 1.000
alpha{3} 0.459834 0.244457 0.000191 1.456592 0.288472 1018.64 1239.28 1.000
pinvar{all} 0.992436 0.000083 0.975275 0.999993 0.995295 1362.88 1431.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -291.891609
Model 2: PositiveSelection -291.891589
Model 0: one-ratio -291.891606
Model 7: beta -291.891592
Model 8: beta&w>1 -291.891604
Model 0 vs 1 5.999999984851456E-6
Model 2 vs 1 4.0000000012696546E-5
Model 8 vs 7 2.3999999939405825E-5
>C1
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C2
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C3
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C4
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C5
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C6
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=75
C1 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C2 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C3 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C4 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C5 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C6 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
**************************************************
C1 PAVIAALVSCAVLTVIVVVRKVKNR
C2 PAVIAALVSCAVLTVIVVVRKVKNR
C3 PAVIAALVSCAVLTVIVVVRKVKNR
C4 PAVIAALVSCAVLTVIVVVRKVKNR
C5 PAVIAALVSCAVLTVIVVVRKVKNR
C6 PAVIAALVSCAVLTVIVVVRKVKNR
*************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 75 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 75 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2250]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2250]--->[2250]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.447 Mb, Max= 30.595 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C2 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C3 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C4 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C5 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C6 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
**************************************************
C1 PAVIAALVSCAVLTVIVVVRKVKNR
C2 PAVIAALVSCAVLTVIVVVRKVKNR
C3 PAVIAALVSCAVLTVIVVVRKVKNR
C4 PAVIAALVSCAVLTVIVVVRKVKNR
C5 PAVIAALVSCAVLTVIVVVRKVKNR
C6 PAVIAALVSCAVLTVIVVVRKVKNR
*************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C2 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C3 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C4 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C5 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C6 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
**************************************************
C1 TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C2 TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C3 TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C4 TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C5 TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C6 TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
**************************************************
C1 GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C2 GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C3 GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C4 GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C5 GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C6 GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
**************************************************
C1 CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C2 CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C3 CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C4 CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C5 CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C6 CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
**************************************************
C1 TGTGGTACGCAAGGTCAAGAATCGC
C2 TGTGGTACGCAAGGTCAAGAATCGC
C3 TGTGGTACGCAAGGTCAAGAATCGC
C4 TGTGGTACGCAAGGTCAAGAATCGC
C5 TGTGGTACGCAAGGTCAAGAATCGC
C6 TGTGGTACGCAAGGTCAAGAATCGC
*************************
>C1
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C2
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C3
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C4
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C5
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C6
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C1
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C2
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C3
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C4
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C5
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C6
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 225 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579800890
Setting output file names to "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 986755636
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1746845858
Seed = 1257424353
Swapseed = 1579800890
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -503.560786 -- -24.965149
Chain 2 -- -503.560756 -- -24.965149
Chain 3 -- -503.560786 -- -24.965149
Chain 4 -- -503.560756 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -503.560786 -- -24.965149
Chain 2 -- -503.560786 -- -24.965149
Chain 3 -- -503.560786 -- -24.965149
Chain 4 -- -503.560786 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-503.561] (-503.561) (-503.561) (-503.561) * [-503.561] (-503.561) (-503.561) (-503.561)
500 -- (-312.034) (-317.872) (-316.973) [-318.639] * (-318.159) (-320.155) (-318.870) [-316.875] -- 0:00:00
1000 -- (-319.304) (-315.912) [-319.210] (-322.303) * [-316.759] (-316.274) (-319.028) (-312.667) -- 0:00:00
1500 -- (-312.975) [-313.399] (-314.071) (-318.034) * [-320.170] (-320.743) (-319.856) (-318.873) -- 0:00:00
2000 -- [-315.441] (-318.534) (-319.148) (-317.781) * (-319.453) [-318.849] (-314.401) (-321.442) -- 0:00:00
2500 -- (-316.094) (-320.941) [-317.014] (-314.657) * (-319.164) (-316.920) (-316.142) [-318.644] -- 0:06:39
3000 -- (-317.343) (-322.931) (-315.087) [-311.618] * (-329.887) (-321.662) [-315.477] (-319.045) -- 0:05:32
3500 -- (-316.931) (-325.668) [-318.374] (-325.351) * (-315.408) (-317.377) [-317.421] (-319.893) -- 0:04:44
4000 -- (-314.269) (-323.140) [-316.348] (-324.267) * (-317.601) (-324.359) (-315.237) [-312.411] -- 0:04:09
4500 -- (-322.282) (-315.424) (-330.947) [-315.047] * (-315.222) (-328.120) [-315.107] (-315.398) -- 0:03:41
5000 -- (-322.278) [-318.026] (-311.320) (-326.446) * (-317.679) (-320.056) (-318.898) [-319.199] -- 0:03:19
Average standard deviation of split frequencies: 0.114280
5500 -- (-319.074) (-313.646) [-318.322] (-321.409) * (-320.046) (-324.619) (-318.622) [-324.540] -- 0:03:00
6000 -- (-322.607) (-317.847) [-319.143] (-318.420) * [-318.433] (-315.602) (-318.028) (-325.744) -- 0:02:45
6500 -- (-318.666) [-322.124] (-317.257) (-321.069) * (-319.838) (-319.154) [-316.717] (-317.979) -- 0:02:32
7000 -- [-312.792] (-312.596) (-323.319) (-317.639) * (-314.783) (-313.816) (-317.445) [-315.810] -- 0:02:21
7500 -- (-323.028) [-322.448] (-317.901) (-322.344) * [-318.216] (-315.723) (-317.007) (-315.871) -- 0:02:12
8000 -- (-314.434) [-317.263] (-326.154) (-320.267) * (-317.022) [-312.257] (-317.233) (-329.056) -- 0:02:04
8500 -- [-315.559] (-326.158) (-326.604) (-313.117) * (-321.857) (-310.561) (-319.469) [-310.555] -- 0:01:56
9000 -- [-322.925] (-315.418) (-316.101) (-312.507) * [-311.762] (-316.420) (-330.012) (-312.812) -- 0:01:50
9500 -- (-327.528) (-314.371) (-315.166) [-312.399] * (-317.867) (-313.664) [-314.344] (-316.774) -- 0:01:44
10000 -- (-317.749) [-317.351] (-312.842) (-318.600) * (-326.224) (-314.813) (-334.716) [-319.899] -- 0:01:39
Average standard deviation of split frequencies: 0.058150
10500 -- (-319.495) (-320.563) (-310.501) [-315.585] * (-320.367) (-315.029) (-330.307) [-324.363] -- 0:01:34
11000 -- (-318.789) (-317.335) (-315.542) [-313.790] * [-318.328] (-320.295) (-322.025) (-318.882) -- 0:01:29
11500 -- (-327.515) (-318.197) [-312.254] (-313.030) * [-321.840] (-321.071) (-320.631) (-315.688) -- 0:01:25
12000 -- (-311.809) (-312.846) [-307.802] (-319.671) * (-316.469) (-326.298) [-311.891] (-316.153) -- 0:01:22
12500 -- (-315.563) (-319.073) [-310.497] (-321.832) * (-316.829) (-314.946) [-307.811] (-321.630) -- 0:01:19
13000 -- [-321.686] (-315.433) (-309.203) (-316.071) * (-314.459) [-320.662] (-307.551) (-333.966) -- 0:01:15
13500 -- (-319.188) (-319.205) [-308.100] (-315.547) * [-315.751] (-318.128) (-307.012) (-326.303) -- 0:01:13
14000 -- (-319.846) (-316.543) (-307.494) [-316.948] * (-325.187) (-318.709) [-306.382] (-328.389) -- 0:01:10
14500 -- (-312.152) (-322.957) (-307.763) [-314.105] * [-314.389] (-323.169) (-309.559) (-327.641) -- 0:01:07
15000 -- (-312.206) (-316.680) (-307.568) [-316.053] * (-315.446) [-315.725] (-307.693) (-324.995) -- 0:01:05
Average standard deviation of split frequencies: 0.052723
15500 -- [-323.367] (-314.046) (-312.313) (-314.853) * (-324.184) [-315.041] (-310.925) (-326.137) -- 0:01:03
16000 -- (-318.317) [-325.192] (-308.908) (-315.855) * [-312.982] (-320.207) (-312.604) (-314.498) -- 0:01:01
16500 -- (-332.527) (-327.700) (-306.609) [-314.760] * (-314.815) [-314.744] (-309.476) (-307.812) -- 0:00:59
17000 -- [-313.903] (-322.707) (-308.530) (-314.749) * (-317.885) (-320.305) [-308.798] (-307.662) -- 0:00:57
17500 -- (-324.338) [-322.389] (-313.945) (-317.906) * (-323.362) [-316.724] (-309.601) (-307.214) -- 0:00:56
18000 -- (-319.378) (-320.523) [-306.914] (-321.232) * (-319.068) (-323.117) [-310.564] (-309.543) -- 0:00:54
18500 -- [-320.066] (-316.900) (-307.246) (-316.646) * [-316.951] (-321.211) (-311.956) (-307.861) -- 0:00:53
19000 -- [-320.523] (-320.586) (-307.094) (-325.576) * (-326.036) (-318.575) [-312.142] (-309.471) -- 0:00:51
19500 -- (-322.554) (-321.639) (-311.265) [-316.608] * [-316.156] (-330.274) (-311.004) (-309.288) -- 0:01:40
20000 -- [-315.786] (-329.505) (-311.527) (-319.490) * [-321.867] (-322.776) (-307.706) (-310.143) -- 0:01:38
Average standard deviation of split frequencies: 0.067004
20500 -- (-330.187) [-308.828] (-307.920) (-315.985) * (-318.182) (-310.236) [-307.608] (-309.288) -- 0:01:35
21000 -- (-314.574) (-307.675) [-308.640] (-319.929) * (-315.430) [-307.994] (-312.048) (-308.588) -- 0:01:33
21500 -- (-324.848) (-308.685) [-307.559] (-313.107) * (-323.523) (-311.558) (-310.177) [-308.583] -- 0:01:31
22000 -- (-316.460) [-309.124] (-309.872) (-321.334) * (-311.160) [-307.079] (-309.562) (-308.055) -- 0:01:28
22500 -- (-314.122) (-310.040) (-311.563) [-316.938] * (-330.909) [-307.942] (-309.566) (-309.167) -- 0:01:26
23000 -- [-314.269] (-307.988) (-308.124) (-326.556) * (-324.164) [-311.660] (-308.067) (-307.354) -- 0:01:24
23500 -- (-322.397) [-308.735] (-308.447) (-318.055) * [-323.226] (-314.659) (-312.212) (-306.471) -- 0:01:23
24000 -- (-314.276) (-308.768) (-308.339) [-313.995] * (-320.533) [-307.023] (-307.626) (-307.855) -- 0:01:21
24500 -- [-322.606] (-308.889) (-311.552) (-315.644) * (-316.792) (-307.174) (-307.592) [-307.161] -- 0:01:19
25000 -- [-316.215] (-306.332) (-310.415) (-329.291) * [-307.137] (-307.418) (-307.717) (-310.176) -- 0:01:18
Average standard deviation of split frequencies: 0.053569
25500 -- [-315.429] (-309.464) (-309.730) (-321.431) * (-308.621) (-312.168) [-307.429] (-313.252) -- 0:01:16
26000 -- (-319.377) (-310.989) [-308.793] (-336.585) * (-306.721) [-308.680] (-308.326) (-309.055) -- 0:01:14
26500 -- [-316.076] (-309.669) (-309.764) (-327.872) * (-307.173) (-308.638) [-309.631] (-308.615) -- 0:01:13
27000 -- (-320.029) [-309.348] (-307.998) (-317.447) * (-306.911) [-309.012] (-307.983) (-307.603) -- 0:01:12
27500 -- (-323.875) (-309.163) [-307.583] (-317.663) * (-307.778) [-309.095] (-310.410) (-308.103) -- 0:01:10
28000 -- [-322.654] (-307.861) (-307.440) (-319.636) * [-308.388] (-307.528) (-306.717) (-309.785) -- 0:01:09
28500 -- (-319.448) (-312.101) [-307.416] (-315.856) * (-307.569) (-310.643) [-307.923] (-307.359) -- 0:01:08
29000 -- [-316.576] (-309.254) (-306.626) (-314.629) * (-307.155) (-311.236) (-307.269) [-308.311] -- 0:01:06
29500 -- (-321.671) (-307.314) [-308.010] (-315.147) * (-307.782) (-307.273) [-308.972] (-309.218) -- 0:01:05
30000 -- (-318.419) [-311.529] (-310.595) (-317.427) * (-308.247) (-307.907) [-307.598] (-309.066) -- 0:01:04
Average standard deviation of split frequencies: 0.046848
30500 -- (-323.742) [-311.157] (-311.800) (-317.144) * (-312.561) [-307.767] (-308.775) (-308.770) -- 0:01:03
31000 -- (-322.159) (-308.340) (-310.328) [-311.798] * (-308.219) (-309.907) [-308.479] (-308.230) -- 0:01:02
31500 -- (-316.976) (-307.057) (-309.354) [-314.072] * (-312.010) (-306.732) (-308.420) [-308.538] -- 0:01:01
32000 -- [-322.924] (-312.047) (-306.582) (-315.732) * [-309.665] (-311.670) (-309.465) (-308.946) -- 0:01:00
32500 -- [-331.221] (-309.855) (-307.941) (-322.707) * (-308.047) (-306.822) (-310.972) [-307.978] -- 0:00:59
33000 -- (-318.638) (-309.605) (-312.540) [-315.685] * [-308.433] (-308.496) (-308.448) (-310.828) -- 0:00:58
33500 -- (-316.681) [-308.297] (-309.998) (-320.753) * (-309.358) (-312.427) [-307.991] (-307.639) -- 0:00:57
34000 -- (-328.295) (-309.217) [-310.097] (-328.454) * (-312.090) (-308.823) [-307.959] (-311.462) -- 0:00:56
34500 -- [-323.128] (-309.273) (-307.553) (-323.128) * (-307.053) (-310.834) (-308.768) [-307.838] -- 0:00:55
35000 -- (-324.818) (-309.627) [-306.707] (-322.174) * (-309.338) [-308.103] (-314.255) (-312.081) -- 0:00:55
Average standard deviation of split frequencies: 0.047140
35500 -- (-312.711) (-308.903) (-309.225) [-316.102] * (-307.524) (-309.240) (-309.094) [-308.860] -- 0:00:54
36000 -- (-330.520) (-309.051) (-307.012) [-314.952] * (-309.422) [-309.382] (-315.459) (-310.693) -- 0:00:53
36500 -- (-320.802) (-307.691) [-307.015] (-310.564) * (-307.732) [-309.914] (-309.592) (-307.203) -- 0:01:19
37000 -- [-314.723] (-310.192) (-307.355) (-308.349) * [-316.969] (-307.885) (-307.357) (-307.041) -- 0:01:18
37500 -- (-325.815) (-307.409) (-308.803) [-306.857] * (-308.559) (-312.570) (-308.095) [-309.638] -- 0:01:17
38000 -- (-323.556) [-308.011] (-312.718) (-307.852) * (-309.674) (-310.083) (-308.265) [-307.734] -- 0:01:15
38500 -- (-321.049) (-310.097) [-308.167] (-308.858) * (-307.983) (-311.720) [-306.716] (-310.131) -- 0:01:14
39000 -- (-330.647) (-311.373) (-309.682) [-307.137] * (-310.585) [-309.448] (-306.970) (-307.906) -- 0:01:13
39500 -- (-312.480) [-307.180] (-308.566) (-308.747) * (-308.781) [-310.642] (-306.946) (-310.438) -- 0:01:12
40000 -- (-315.033) (-308.174) (-308.444) [-306.754] * (-309.216) (-307.126) [-309.628] (-307.100) -- 0:01:12
Average standard deviation of split frequencies: 0.038253
40500 -- (-318.188) [-308.941] (-311.376) (-308.402) * (-308.474) (-306.646) [-306.881] (-309.090) -- 0:01:11
41000 -- (-318.797) (-308.791) [-309.342] (-309.755) * [-307.755] (-307.193) (-308.161) (-306.966) -- 0:01:10
41500 -- (-320.862) (-312.010) (-308.624) [-306.581] * (-308.477) (-308.168) (-309.507) [-310.855] -- 0:01:09
42000 -- [-322.413] (-309.484) (-308.657) (-307.137) * (-308.099) [-307.892] (-309.088) (-307.848) -- 0:01:08
42500 -- (-319.263) (-307.922) [-307.676] (-308.792) * (-314.060) (-312.210) [-308.628] (-311.699) -- 0:01:07
43000 -- (-315.463) (-308.461) (-307.709) [-311.566] * [-308.426] (-309.119) (-308.272) (-307.234) -- 0:01:06
43500 -- (-320.206) [-309.224] (-309.487) (-306.387) * (-308.877) (-313.667) [-310.195] (-310.243) -- 0:01:05
44000 -- (-325.312) (-307.678) [-310.523] (-308.079) * (-310.493) (-319.765) (-311.740) [-308.752] -- 0:01:05
44500 -- (-321.084) [-313.588] (-309.657) (-310.751) * (-310.261) (-309.026) (-308.926) [-306.835] -- 0:01:04
45000 -- (-308.176) [-312.417] (-306.838) (-310.192) * (-307.756) [-311.495] (-308.822) (-307.328) -- 0:01:03
Average standard deviation of split frequencies: 0.031232
45500 -- (-310.680) [-307.243] (-307.968) (-308.482) * [-308.350] (-311.858) (-308.691) (-308.410) -- 0:01:02
46000 -- [-308.879] (-308.825) (-308.937) (-306.374) * [-306.982] (-307.941) (-307.130) (-311.012) -- 0:01:02
46500 -- [-309.621] (-308.597) (-308.021) (-308.235) * (-309.891) [-309.985] (-307.154) (-308.068) -- 0:01:01
47000 -- [-308.573] (-312.308) (-308.249) (-306.471) * (-308.389) [-308.016] (-308.614) (-308.809) -- 0:01:00
47500 -- (-308.356) [-307.931] (-307.354) (-308.144) * (-307.751) (-307.629) [-310.799] (-311.024) -- 0:01:00
48000 -- (-308.204) [-309.557] (-309.568) (-308.722) * (-309.992) (-306.870) [-306.916] (-309.097) -- 0:00:59
48500 -- (-308.109) (-312.815) [-309.517] (-308.383) * (-309.135) [-307.002] (-308.787) (-310.945) -- 0:00:58
49000 -- [-309.512] (-307.461) (-309.988) (-308.254) * (-310.884) (-312.546) [-307.078] (-307.831) -- 0:00:58
49500 -- (-311.290) [-308.398] (-309.450) (-309.358) * (-312.994) (-307.059) [-311.633] (-307.704) -- 0:00:57
50000 -- [-306.536] (-308.738) (-309.885) (-308.629) * (-310.744) [-311.476] (-308.558) (-310.009) -- 0:00:57
Average standard deviation of split frequencies: 0.031634
50500 -- (-309.891) [-308.171] (-309.772) (-310.911) * (-311.139) [-307.733] (-308.393) (-309.243) -- 0:00:56
51000 -- (-308.520) (-309.923) (-310.285) [-308.838] * [-307.559] (-310.721) (-310.673) (-309.617) -- 0:00:55
51500 -- [-309.788] (-310.581) (-310.813) (-308.279) * [-308.108] (-308.517) (-307.969) (-312.389) -- 0:00:55
52000 -- (-306.383) [-307.912] (-310.481) (-308.789) * [-307.825] (-306.971) (-306.373) (-315.195) -- 0:00:54
52500 -- (-309.271) (-307.997) [-310.657] (-307.530) * (-313.877) [-307.317] (-309.840) (-312.402) -- 0:00:54
53000 -- (-313.019) (-307.760) (-308.671) [-308.102] * (-316.535) [-307.464] (-307.567) (-309.133) -- 0:00:53
53500 -- (-309.248) [-307.186] (-310.843) (-308.054) * (-314.436) [-307.298] (-307.699) (-308.835) -- 0:01:10
54000 -- (-307.130) [-307.548] (-309.210) (-307.167) * (-310.287) (-308.158) (-309.150) [-308.623] -- 0:01:10
54500 -- (-311.459) (-308.375) [-310.897] (-312.784) * (-309.973) (-308.437) (-311.596) [-308.189] -- 0:01:09
55000 -- (-311.746) [-308.471] (-309.430) (-307.414) * (-310.839) (-311.264) (-311.345) [-307.732] -- 0:01:08
Average standard deviation of split frequencies: 0.031267
55500 -- (-311.317) [-310.355] (-310.350) (-308.873) * (-308.958) (-306.641) [-313.531] (-309.780) -- 0:01:08
56000 -- (-313.562) (-310.851) (-309.092) [-307.713] * [-307.717] (-308.615) (-308.552) (-308.854) -- 0:01:07
56500 -- (-309.894) (-310.710) [-309.588] (-306.917) * (-307.265) [-308.109] (-308.221) (-309.521) -- 0:01:06
57000 -- (-309.845) [-309.135] (-310.684) (-309.411) * [-308.333] (-309.101) (-312.625) (-308.574) -- 0:01:06
57500 -- (-308.645) (-308.734) (-312.016) [-308.417] * (-310.263) (-310.340) (-310.385) [-309.909] -- 0:01:05
58000 -- (-309.952) (-308.469) [-307.433] (-307.965) * (-306.994) [-309.319] (-307.531) (-307.785) -- 0:01:04
58500 -- (-315.573) (-311.989) (-306.845) [-308.549] * (-308.654) (-309.157) [-309.866] (-307.572) -- 0:01:04
59000 -- [-311.953] (-307.000) (-306.573) (-309.298) * (-308.202) [-310.064] (-306.810) (-308.023) -- 0:01:03
59500 -- (-307.151) (-307.663) [-308.688] (-308.135) * (-307.112) [-307.652] (-306.466) (-309.664) -- 0:01:03
60000 -- [-311.263] (-310.217) (-308.612) (-310.913) * (-309.886) [-310.399] (-307.124) (-310.053) -- 0:01:02
Average standard deviation of split frequencies: 0.034042
60500 -- [-311.369] (-311.081) (-308.520) (-311.497) * (-308.565) [-307.861] (-308.424) (-308.863) -- 0:01:02
61000 -- (-307.120) (-310.112) [-309.146] (-307.974) * (-309.113) (-308.211) (-307.076) [-308.604] -- 0:01:01
61500 -- [-308.074] (-307.698) (-308.037) (-310.355) * [-307.951] (-309.566) (-308.799) (-307.718) -- 0:01:01
62000 -- (-309.044) [-310.719] (-308.136) (-307.104) * (-309.745) [-308.133] (-308.880) (-308.128) -- 0:01:00
62500 -- (-314.804) [-306.872] (-308.728) (-307.650) * (-307.538) [-308.362] (-307.546) (-311.722) -- 0:01:00
63000 -- (-309.164) (-308.852) [-307.392] (-309.258) * (-308.596) (-308.344) (-307.191) [-307.497] -- 0:00:59
63500 -- [-308.560] (-312.586) (-308.212) (-307.821) * [-310.401] (-306.818) (-309.007) (-308.663) -- 0:00:58
64000 -- [-309.346] (-308.066) (-307.770) (-314.584) * (-309.304) (-308.113) [-307.834] (-307.965) -- 0:00:58
64500 -- [-310.248] (-309.914) (-307.151) (-311.175) * (-308.649) (-308.084) (-308.129) [-309.117] -- 0:00:58
65000 -- (-307.592) (-311.872) (-307.603) [-312.165] * (-309.048) (-308.083) [-311.555] (-310.477) -- 0:00:57
Average standard deviation of split frequencies: 0.032651
65500 -- [-308.492] (-307.444) (-310.619) (-308.759) * (-308.596) (-307.540) (-311.150) [-310.058] -- 0:00:57
66000 -- (-311.861) (-306.763) (-306.661) [-306.631] * (-309.781) (-309.324) (-309.559) [-313.654] -- 0:00:56
66500 -- (-310.766) (-309.165) (-311.767) [-306.921] * (-310.233) (-307.353) [-307.528] (-309.162) -- 0:00:56
67000 -- (-309.672) (-309.178) (-311.110) [-306.824] * (-312.208) (-307.313) [-311.064] (-311.622) -- 0:00:55
67500 -- (-309.984) [-307.365] (-309.346) (-307.243) * (-309.169) (-309.092) [-310.189] (-308.343) -- 0:00:55
68000 -- (-312.931) (-308.496) (-308.559) [-308.984] * [-307.102] (-310.988) (-309.924) (-309.438) -- 0:00:54
68500 -- (-309.550) (-306.869) [-309.773] (-308.434) * (-310.013) (-307.390) [-309.273] (-311.448) -- 0:00:54
69000 -- [-311.500] (-312.188) (-309.269) (-310.261) * [-307.506] (-310.558) (-308.118) (-308.880) -- 0:00:53
69500 -- (-308.446) (-308.492) (-308.398) [-309.140] * [-308.900] (-307.766) (-310.293) (-311.958) -- 0:00:53
70000 -- (-309.032) (-309.329) (-309.208) [-309.027] * (-307.990) [-307.466] (-307.859) (-307.222) -- 0:00:53
Average standard deviation of split frequencies: 0.027954
70500 -- (-308.814) [-307.311] (-311.708) (-309.737) * [-308.000] (-307.838) (-307.152) (-308.080) -- 0:00:52
71000 -- [-306.975] (-309.642) (-308.267) (-307.576) * [-307.097] (-306.830) (-311.785) (-308.408) -- 0:01:05
71500 -- [-306.575] (-310.759) (-306.667) (-309.736) * (-307.692) [-307.523] (-307.463) (-312.864) -- 0:01:04
72000 -- (-307.244) (-310.469) [-307.489] (-309.038) * (-310.021) (-307.911) [-309.865] (-307.550) -- 0:01:04
72500 -- (-307.491) (-307.785) [-308.052] (-310.418) * (-308.370) (-307.353) [-310.309] (-308.426) -- 0:01:03
73000 -- (-308.406) [-307.116] (-310.446) (-307.627) * (-311.588) (-308.608) [-306.774] (-310.670) -- 0:01:03
73500 -- (-307.720) (-308.967) [-306.957] (-312.226) * [-311.622] (-307.547) (-312.684) (-311.638) -- 0:01:03
74000 -- (-311.773) (-308.862) (-308.747) [-307.783] * (-309.166) [-307.925] (-310.314) (-308.998) -- 0:01:02
74500 -- [-306.907] (-308.364) (-307.888) (-309.649) * (-309.396) (-308.801) (-310.609) [-308.855] -- 0:01:02
75000 -- (-307.448) [-311.247] (-309.509) (-310.111) * [-311.204] (-307.777) (-308.721) (-308.823) -- 0:01:01
Average standard deviation of split frequencies: 0.029832
75500 -- (-307.189) (-307.891) [-309.092] (-306.707) * (-309.123) (-307.683) [-309.425] (-306.472) -- 0:01:01
76000 -- (-309.501) (-307.272) (-308.862) [-306.637] * [-308.317] (-310.644) (-308.240) (-307.762) -- 0:01:00
76500 -- (-308.820) [-307.752] (-310.974) (-306.842) * (-308.478) (-307.425) [-308.876] (-308.153) -- 0:01:00
77000 -- (-308.002) [-307.712] (-307.125) (-313.716) * (-309.072) (-307.762) (-309.572) [-308.358] -- 0:00:59
77500 -- [-307.559] (-310.457) (-307.046) (-309.872) * (-310.372) (-307.772) [-308.281] (-308.498) -- 0:00:59
78000 -- (-307.427) (-308.622) [-308.493] (-311.614) * (-307.608) (-307.955) (-308.284) [-309.877] -- 0:00:59
78500 -- [-307.120] (-308.392) (-307.772) (-308.337) * [-308.784] (-308.337) (-308.042) (-309.699) -- 0:00:58
79000 -- (-310.355) (-310.091) [-307.809] (-311.248) * (-311.316) (-308.027) (-311.449) [-306.684] -- 0:00:58
79500 -- [-307.797] (-308.254) (-310.127) (-310.638) * (-315.210) [-306.856] (-307.891) (-307.093) -- 0:00:57
80000 -- (-311.357) (-308.482) [-307.539] (-308.718) * (-312.320) (-308.269) [-307.062] (-307.492) -- 0:00:57
Average standard deviation of split frequencies: 0.028343
80500 -- [-313.601] (-307.572) (-307.605) (-308.208) * (-307.537) (-307.033) [-313.363] (-310.481) -- 0:00:57
81000 -- (-309.043) (-308.119) [-308.113] (-308.745) * (-307.077) (-307.521) [-310.228] (-306.726) -- 0:00:56
81500 -- [-309.583] (-309.401) (-308.080) (-307.283) * (-308.895) [-308.490] (-309.144) (-308.054) -- 0:00:56
82000 -- (-310.353) [-309.476] (-308.843) (-306.929) * (-307.867) (-309.008) (-308.851) [-307.608] -- 0:00:55
82500 -- (-309.436) (-310.570) (-307.282) [-309.259] * (-310.582) (-310.694) [-307.654] (-312.750) -- 0:00:55
83000 -- [-308.483] (-314.190) (-308.214) (-307.813) * (-309.009) (-306.752) [-308.083] (-307.432) -- 0:00:55
83500 -- (-313.892) (-310.416) (-307.800) [-309.951] * [-307.395] (-307.601) (-309.303) (-309.406) -- 0:00:54
84000 -- (-308.968) [-308.630] (-308.303) (-308.340) * (-306.796) (-308.990) [-309.538] (-309.509) -- 0:00:54
84500 -- [-313.443] (-310.959) (-312.562) (-308.414) * (-307.085) [-307.704] (-306.638) (-309.598) -- 0:00:54
85000 -- [-308.561] (-312.398) (-308.080) (-309.853) * (-307.451) (-310.319) (-306.991) [-310.119] -- 0:00:53
Average standard deviation of split frequencies: 0.025841
85500 -- (-309.732) (-311.670) (-314.176) [-309.036] * [-307.479] (-308.177) (-310.662) (-312.076) -- 0:00:53
86000 -- [-307.992] (-309.893) (-308.830) (-307.061) * (-309.917) (-310.106) [-310.335] (-307.792) -- 0:00:53
86500 -- (-307.306) (-307.783) [-309.226] (-308.154) * [-309.270] (-309.916) (-307.967) (-310.171) -- 0:00:52
87000 -- (-308.255) (-307.990) [-307.430] (-311.319) * (-306.485) (-311.114) (-309.998) [-312.008] -- 0:00:52
87500 -- (-308.125) [-307.788] (-307.284) (-311.614) * (-308.499) [-307.299] (-312.422) (-309.098) -- 0:00:52
88000 -- (-312.629) [-311.018] (-307.552) (-311.414) * (-311.407) [-310.144] (-310.916) (-307.691) -- 0:01:02
88500 -- (-309.772) (-314.066) (-314.187) [-309.139] * (-307.205) [-306.870] (-314.975) (-311.922) -- 0:01:01
89000 -- (-307.848) (-308.780) [-309.570] (-309.837) * [-312.746] (-309.607) (-310.027) (-307.627) -- 0:01:01
89500 -- (-309.589) (-308.530) (-307.454) [-308.756] * (-307.311) (-310.089) (-309.661) [-309.911] -- 0:01:01
90000 -- (-311.424) (-307.689) (-308.670) [-309.955] * (-311.106) [-307.976] (-312.248) (-307.991) -- 0:01:00
Average standard deviation of split frequencies: 0.027816
90500 -- (-307.295) (-308.414) [-308.109] (-313.199) * [-308.991] (-314.704) (-308.245) (-307.707) -- 0:01:00
91000 -- (-308.189) (-306.930) (-308.342) [-307.626] * [-310.087] (-311.903) (-311.295) (-312.000) -- 0:00:59
91500 -- (-306.785) (-308.793) (-308.429) [-313.447] * [-307.691] (-314.813) (-309.151) (-308.922) -- 0:00:59
92000 -- (-307.772) (-308.691) [-307.240] (-312.711) * (-308.715) (-309.676) (-310.113) [-307.866] -- 0:00:59
92500 -- (-307.451) (-309.016) [-310.065] (-309.486) * (-315.848) (-309.411) [-307.600] (-309.247) -- 0:00:58
93000 -- (-307.298) [-308.632] (-309.266) (-307.502) * [-315.656] (-308.803) (-307.634) (-310.249) -- 0:00:58
93500 -- (-309.633) (-307.523) [-308.581] (-308.234) * (-307.076) (-306.953) (-308.607) [-315.075] -- 0:00:58
94000 -- (-309.153) (-308.357) (-309.689) [-308.127] * [-307.738] (-306.891) (-307.628) (-309.606) -- 0:00:57
94500 -- (-308.460) (-311.856) [-310.881] (-308.762) * [-308.460] (-308.365) (-308.279) (-312.503) -- 0:00:57
95000 -- [-308.235] (-309.263) (-307.192) (-307.967) * (-309.831) [-309.428] (-308.332) (-312.933) -- 0:00:57
Average standard deviation of split frequencies: 0.029980
95500 -- (-308.606) (-313.841) (-309.590) [-310.142] * (-309.309) (-309.181) (-313.798) [-307.027] -- 0:00:56
96000 -- (-307.633) [-311.583] (-310.110) (-306.943) * [-309.866] (-308.360) (-308.721) (-308.989) -- 0:00:56
96500 -- (-309.027) (-307.730) (-314.029) [-310.477] * [-306.818] (-308.365) (-307.159) (-307.362) -- 0:00:56
97000 -- (-309.824) [-308.333] (-311.166) (-310.113) * (-308.001) (-307.375) (-308.497) [-309.246] -- 0:00:55
97500 -- (-313.160) (-309.471) (-309.133) [-309.855] * (-306.847) (-316.333) (-308.803) [-310.415] -- 0:00:55
98000 -- (-309.481) [-309.082] (-309.031) (-308.008) * (-308.469) (-306.800) [-310.623] (-308.545) -- 0:00:55
98500 -- (-307.918) (-308.757) [-309.496] (-310.128) * [-307.463] (-311.564) (-307.994) (-307.550) -- 0:00:54
99000 -- (-307.503) [-311.091] (-310.764) (-308.201) * (-309.786) (-309.154) (-309.949) [-309.013] -- 0:00:54
99500 -- [-312.545] (-308.413) (-309.203) (-308.170) * (-309.995) (-307.933) [-308.252] (-311.113) -- 0:00:54
100000 -- (-310.180) (-308.214) (-311.682) [-310.515] * [-308.432] (-307.647) (-309.470) (-308.076) -- 0:00:54
Average standard deviation of split frequencies: 0.028590
100500 -- (-307.096) [-308.101] (-311.140) (-307.944) * [-308.802] (-310.919) (-310.702) (-308.190) -- 0:00:53
101000 -- (-310.813) [-309.640] (-307.415) (-311.897) * (-309.690) (-314.226) (-312.202) [-308.057] -- 0:00:53
101500 -- (-308.219) (-309.864) (-307.341) [-308.940] * [-307.269] (-312.192) (-310.500) (-308.198) -- 0:00:53
102000 -- (-308.846) (-308.768) [-306.603] (-308.031) * [-309.298] (-309.543) (-317.416) (-306.611) -- 0:00:52
102500 -- (-307.317) (-309.264) (-310.327) [-307.811] * (-306.728) [-309.671] (-306.862) (-307.155) -- 0:00:52
103000 -- (-311.928) [-306.456] (-319.557) (-311.750) * (-309.616) (-308.605) [-308.357] (-307.413) -- 0:00:52
103500 -- [-306.682] (-307.904) (-309.799) (-316.939) * (-310.375) [-309.632] (-307.877) (-308.666) -- 0:00:51
104000 -- (-310.271) [-308.186] (-310.365) (-309.057) * (-311.539) [-309.047] (-306.693) (-308.024) -- 0:00:51
104500 -- [-308.273] (-307.315) (-309.901) (-307.945) * (-309.403) (-308.803) [-307.347] (-307.635) -- 0:00:51
105000 -- (-308.398) (-311.532) (-307.322) [-308.519] * (-306.523) (-313.921) (-308.019) [-306.999] -- 0:00:59
Average standard deviation of split frequencies: 0.026239
105500 -- (-309.255) (-307.989) [-308.211] (-306.800) * (-307.924) [-307.535] (-308.486) (-308.009) -- 0:00:59
106000 -- (-307.992) (-308.994) [-309.171] (-310.346) * (-307.930) (-314.981) [-308.603] (-313.122) -- 0:00:59
106500 -- (-312.125) (-311.305) [-310.588] (-313.881) * (-308.776) (-311.847) (-308.898) [-309.672] -- 0:00:58
107000 -- (-307.536) (-307.306) [-312.282] (-309.786) * [-309.344] (-307.313) (-310.811) (-306.675) -- 0:00:58
107500 -- [-308.284] (-308.577) (-310.054) (-308.351) * (-307.018) (-309.532) (-312.983) [-308.023] -- 0:00:58
108000 -- (-311.126) (-311.729) (-307.773) [-311.313] * (-307.322) (-309.652) [-310.984] (-310.216) -- 0:00:57
108500 -- (-308.528) (-306.552) [-308.944] (-310.166) * [-307.258] (-309.852) (-308.169) (-308.292) -- 0:00:57
109000 -- (-310.096) [-308.742] (-307.154) (-314.582) * (-307.334) (-308.001) (-309.074) [-309.953] -- 0:00:57
109500 -- (-307.724) (-306.450) (-310.715) [-306.995] * (-310.003) [-306.833] (-308.932) (-309.343) -- 0:00:56
110000 -- (-312.955) [-307.054] (-309.394) (-307.879) * [-312.430] (-308.991) (-307.353) (-307.671) -- 0:00:56
Average standard deviation of split frequencies: 0.024493
110500 -- [-309.390] (-310.866) (-308.666) (-308.595) * (-308.824) (-307.620) (-312.825) [-308.736] -- 0:00:56
111000 -- (-307.696) [-311.662] (-306.786) (-309.489) * (-309.181) [-309.864] (-308.457) (-312.171) -- 0:00:56
111500 -- (-308.523) (-307.399) (-309.148) [-308.956] * (-313.161) [-307.726] (-307.980) (-306.492) -- 0:00:55
112000 -- (-306.647) (-313.128) [-308.580] (-309.843) * (-314.022) [-309.038] (-308.754) (-308.927) -- 0:00:55
112500 -- (-310.256) (-307.368) [-307.742] (-311.541) * (-309.518) (-308.996) (-308.686) [-307.926] -- 0:00:55
113000 -- (-307.918) (-311.607) [-309.563] (-306.666) * (-307.685) (-308.904) (-313.157) [-308.960] -- 0:00:54
113500 -- [-308.203] (-307.547) (-313.492) (-309.629) * (-309.949) (-308.297) [-308.580] (-308.851) -- 0:00:54
114000 -- [-307.335] (-307.470) (-311.927) (-307.368) * (-308.554) (-309.560) (-309.425) [-308.327] -- 0:00:54
114500 -- (-310.177) (-310.701) [-307.332] (-307.316) * (-308.252) [-308.096] (-309.230) (-307.605) -- 0:00:54
115000 -- (-307.491) (-310.431) (-309.885) [-308.059] * [-309.033] (-307.340) (-311.868) (-310.469) -- 0:00:53
Average standard deviation of split frequencies: 0.028875
115500 -- (-306.330) (-310.036) [-309.153] (-308.204) * [-309.246] (-309.587) (-310.309) (-311.655) -- 0:00:53
116000 -- [-310.772] (-310.475) (-308.730) (-308.666) * [-310.141] (-310.895) (-307.864) (-312.186) -- 0:00:53
116500 -- (-310.140) [-307.885] (-307.173) (-308.479) * [-308.726] (-307.880) (-308.750) (-309.246) -- 0:00:53
117000 -- (-306.877) [-307.639] (-308.982) (-307.168) * (-307.375) (-307.661) (-310.497) [-309.038] -- 0:00:52
117500 -- (-311.280) (-309.690) [-309.279] (-308.079) * (-310.319) [-308.035] (-312.914) (-311.916) -- 0:00:52
118000 -- [-307.577] (-311.638) (-308.124) (-308.467) * (-307.449) (-310.596) [-309.227] (-307.658) -- 0:00:52
118500 -- [-310.224] (-314.437) (-308.338) (-309.878) * (-307.392) (-310.802) [-310.156] (-310.158) -- 0:00:52
119000 -- (-312.033) (-311.438) (-308.626) [-307.829] * (-309.542) (-309.067) [-307.272] (-309.211) -- 0:00:51
119500 -- (-309.932) (-309.450) [-310.822] (-308.615) * [-308.177] (-307.696) (-307.812) (-307.570) -- 0:00:51
120000 -- (-310.567) [-309.197] (-307.819) (-308.452) * [-307.807] (-307.381) (-308.524) (-308.057) -- 0:00:51
Average standard deviation of split frequencies: 0.025291
120500 -- (-314.308) (-309.673) [-307.336] (-307.780) * (-309.708) (-308.278) (-310.191) [-310.078] -- 0:00:51
121000 -- (-309.968) (-309.071) [-308.582] (-307.128) * (-307.216) (-307.707) [-307.689] (-309.708) -- 0:00:50
121500 -- (-307.264) (-312.323) (-308.502) [-308.586] * (-308.874) [-306.987] (-312.810) (-311.590) -- 0:00:57
122000 -- [-312.933] (-308.552) (-310.657) (-309.472) * [-308.720] (-310.375) (-309.622) (-309.744) -- 0:00:57
122500 -- [-308.872] (-307.371) (-309.883) (-309.174) * (-306.545) (-307.905) [-306.512] (-306.709) -- 0:00:57
123000 -- (-307.104) (-307.288) [-307.395] (-310.696) * (-310.814) (-307.867) [-307.800] (-311.623) -- 0:00:57
123500 -- (-307.693) (-306.846) (-307.685) [-310.389] * (-310.696) [-307.493] (-306.527) (-311.343) -- 0:00:56
124000 -- (-307.572) (-307.095) (-309.969) [-307.653] * (-308.521) [-310.135] (-308.597) (-309.186) -- 0:00:56
124500 -- [-308.049] (-308.750) (-308.911) (-315.124) * (-308.459) (-308.661) (-308.493) [-307.676] -- 0:00:56
125000 -- [-306.912] (-309.233) (-310.738) (-310.735) * [-307.652] (-312.336) (-307.098) (-312.209) -- 0:00:56
Average standard deviation of split frequencies: 0.025815
125500 -- (-311.091) (-313.177) (-306.992) [-308.850] * (-310.260) (-309.999) (-310.368) [-312.322] -- 0:00:55
126000 -- (-309.360) (-313.459) (-307.093) [-307.913] * (-309.002) [-307.397] (-307.481) (-312.970) -- 0:00:55
126500 -- (-309.766) (-318.726) (-309.948) [-307.933] * (-310.273) [-307.251] (-307.347) (-308.793) -- 0:00:55
127000 -- [-307.387] (-310.643) (-308.629) (-307.801) * (-309.421) [-307.634] (-309.489) (-307.832) -- 0:00:54
127500 -- (-308.509) [-313.371] (-307.791) (-307.347) * (-311.014) [-307.691] (-307.348) (-308.414) -- 0:00:54
128000 -- (-307.571) (-308.303) (-311.210) [-308.197] * (-310.142) (-310.439) [-311.096] (-308.090) -- 0:00:54
128500 -- [-307.672] (-308.492) (-311.068) (-313.279) * [-308.811] (-308.714) (-309.340) (-307.833) -- 0:00:54
129000 -- (-307.679) (-308.630) [-307.584] (-310.602) * (-307.420) [-306.984] (-309.820) (-309.050) -- 0:00:54
129500 -- (-311.576) (-311.845) (-308.145) [-311.066] * [-308.810] (-309.382) (-308.496) (-307.421) -- 0:00:53
130000 -- (-308.772) (-312.988) (-310.378) [-306.750] * (-307.086) (-309.376) (-308.220) [-307.721] -- 0:00:53
Average standard deviation of split frequencies: 0.023545
130500 -- [-309.566] (-309.765) (-307.111) (-306.621) * [-307.442] (-307.206) (-308.881) (-310.323) -- 0:00:53
131000 -- (-308.398) (-308.936) (-312.099) [-309.000] * (-307.350) (-310.980) (-308.493) [-308.759] -- 0:00:53
131500 -- [-310.556] (-310.489) (-312.685) (-311.145) * (-311.319) (-308.178) [-311.822] (-307.893) -- 0:00:52
132000 -- (-312.945) (-308.097) [-308.725] (-307.438) * [-309.393] (-306.580) (-308.891) (-308.500) -- 0:00:52
132500 -- (-306.456) (-308.041) [-307.835] (-308.516) * (-306.843) [-307.180] (-310.943) (-311.978) -- 0:00:52
133000 -- [-308.246] (-307.298) (-307.881) (-307.651) * (-310.913) (-307.133) [-307.886] (-311.457) -- 0:00:52
133500 -- [-307.562] (-307.805) (-310.182) (-308.576) * (-308.437) [-309.740] (-307.028) (-307.848) -- 0:00:51
134000 -- (-310.642) (-309.019) (-310.092) [-308.548] * (-309.866) [-311.131] (-306.736) (-308.406) -- 0:00:51
134500 -- (-317.530) (-310.788) [-308.655] (-310.855) * (-306.440) [-307.721] (-307.864) (-307.442) -- 0:00:51
135000 -- (-309.833) (-310.245) [-307.022] (-313.708) * [-308.471] (-308.458) (-308.499) (-308.297) -- 0:00:51
Average standard deviation of split frequencies: 0.022804
135500 -- (-309.827) [-310.276] (-310.241) (-313.387) * (-307.675) [-308.262] (-308.313) (-310.823) -- 0:00:51
136000 -- [-309.270] (-307.507) (-308.596) (-313.696) * [-310.444] (-310.161) (-306.629) (-308.065) -- 0:00:50
136500 -- (-308.042) (-308.834) [-308.034] (-308.228) * (-310.946) (-306.968) (-308.550) [-308.321] -- 0:00:50
137000 -- (-306.418) [-310.370] (-309.654) (-312.774) * (-306.552) [-311.125] (-310.077) (-306.861) -- 0:00:50
137500 -- (-307.811) [-309.866] (-307.753) (-308.637) * (-307.128) (-309.326) (-309.187) [-309.028] -- 0:00:50
138000 -- (-308.235) (-308.406) (-309.090) [-307.196] * (-309.997) (-311.081) [-308.261] (-308.936) -- 0:00:49
138500 -- [-307.107] (-307.928) (-307.352) (-310.796) * [-308.757] (-309.176) (-308.379) (-311.281) -- 0:00:49
139000 -- (-308.680) [-307.964] (-310.536) (-307.018) * (-308.436) (-308.979) [-311.908] (-309.304) -- 0:00:55
139500 -- (-309.840) (-307.983) (-309.036) [-308.723] * (-309.333) [-308.773] (-307.288) (-309.190) -- 0:00:55
140000 -- (-307.222) [-309.569] (-308.917) (-309.425) * (-308.075) (-314.739) (-310.648) [-309.364] -- 0:00:55
Average standard deviation of split frequencies: 0.022714
140500 -- (-306.873) (-308.177) [-307.740] (-308.803) * (-308.165) (-311.987) [-308.135] (-312.976) -- 0:00:55
141000 -- [-307.651] (-309.554) (-307.168) (-308.123) * (-309.383) [-306.979] (-307.620) (-308.869) -- 0:00:54
141500 -- (-309.423) (-309.052) [-309.569] (-309.132) * (-307.621) (-308.150) [-306.903] (-308.671) -- 0:00:54
142000 -- (-308.230) (-309.390) [-308.065] (-308.611) * (-309.017) [-308.510] (-313.225) (-307.571) -- 0:00:54
142500 -- (-309.049) [-310.826] (-311.667) (-310.343) * (-310.542) [-309.436] (-308.710) (-308.378) -- 0:00:54
143000 -- [-307.474] (-308.631) (-310.769) (-318.183) * (-309.973) (-308.271) [-310.065] (-308.250) -- 0:00:53
143500 -- [-308.320] (-308.280) (-308.769) (-312.006) * (-308.056) (-307.737) [-307.501] (-308.000) -- 0:00:53
144000 -- [-310.725] (-310.681) (-309.583) (-313.144) * (-308.361) (-308.011) [-308.250] (-307.229) -- 0:00:53
144500 -- (-311.484) (-312.763) [-306.604] (-310.299) * (-308.223) (-309.144) [-307.782] (-306.538) -- 0:00:53
145000 -- [-307.499] (-307.581) (-308.056) (-307.281) * (-307.613) (-311.867) [-312.166] (-306.974) -- 0:00:53
Average standard deviation of split frequencies: 0.019373
145500 -- [-308.652] (-307.074) (-310.536) (-310.221) * [-307.185] (-311.226) (-307.372) (-307.080) -- 0:00:52
146000 -- (-308.720) (-309.074) [-307.023] (-311.750) * (-307.956) (-314.615) (-309.442) [-310.252] -- 0:00:52
146500 -- [-306.713] (-310.839) (-307.470) (-311.658) * (-306.980) (-308.430) (-307.863) [-308.233] -- 0:00:52
147000 -- [-307.799] (-309.433) (-307.102) (-311.494) * (-311.892) [-307.764] (-309.806) (-308.548) -- 0:00:52
147500 -- [-308.211] (-309.049) (-310.156) (-307.099) * (-310.040) [-308.804] (-309.859) (-308.780) -- 0:00:52
148000 -- [-308.864] (-306.881) (-312.557) (-307.942) * [-308.555] (-306.509) (-307.380) (-308.233) -- 0:00:51
148500 -- (-308.758) (-306.677) (-308.188) [-309.354] * (-308.696) (-310.177) (-309.033) [-309.791] -- 0:00:51
149000 -- (-308.127) (-309.882) [-310.746] (-307.575) * [-307.902] (-310.202) (-307.781) (-308.287) -- 0:00:51
149500 -- (-309.373) (-308.796) (-309.362) [-309.971] * [-308.351] (-307.457) (-309.258) (-309.331) -- 0:00:51
150000 -- (-307.943) (-310.454) [-307.530] (-307.390) * (-309.016) (-307.810) [-309.141] (-309.450) -- 0:00:51
Average standard deviation of split frequencies: 0.017785
150500 -- (-308.384) [-308.130] (-310.054) (-308.611) * (-307.975) (-308.765) [-309.368] (-307.379) -- 0:00:50
151000 -- (-308.167) (-306.325) (-307.670) [-307.500] * (-307.214) (-308.185) [-307.353] (-307.331) -- 0:00:50
151500 -- (-307.905) (-307.130) (-309.319) [-307.557] * (-308.307) (-309.068) [-307.129] (-313.156) -- 0:00:50
152000 -- (-307.726) (-306.836) [-307.953] (-311.552) * [-308.161] (-307.371) (-306.585) (-309.933) -- 0:00:50
152500 -- [-310.989] (-308.828) (-309.088) (-314.461) * (-307.604) [-309.623] (-308.566) (-310.674) -- 0:00:50
153000 -- [-308.393] (-310.223) (-309.658) (-312.891) * [-309.521] (-307.234) (-309.122) (-306.536) -- 0:00:49
153500 -- (-307.802) [-308.859] (-310.137) (-311.414) * (-309.324) [-307.354] (-309.534) (-309.240) -- 0:00:49
154000 -- (-310.706) (-308.191) [-307.730] (-310.803) * (-310.745) (-309.244) [-307.338] (-307.991) -- 0:00:49
154500 -- (-309.613) (-309.696) (-309.198) [-307.118] * (-311.707) (-308.120) (-309.536) [-307.975] -- 0:00:49
155000 -- (-307.688) [-306.578] (-308.490) (-307.266) * (-315.813) (-308.167) [-307.266] (-307.906) -- 0:00:49
Average standard deviation of split frequencies: 0.016859
155500 -- (-308.240) (-307.106) [-308.833] (-306.870) * (-308.569) [-311.540] (-307.360) (-307.480) -- 0:00:48
156000 -- (-310.328) (-309.601) (-311.733) [-308.236] * (-308.338) (-308.502) (-308.748) [-312.980] -- 0:00:54
156500 -- (-311.024) (-309.636) (-310.404) [-306.503] * (-311.198) (-308.093) (-309.426) [-309.829] -- 0:00:53
157000 -- (-307.500) [-306.868] (-308.291) (-306.874) * (-308.956) (-309.114) [-308.900] (-308.799) -- 0:00:53
157500 -- (-307.938) (-308.043) (-308.096) [-307.208] * (-306.708) (-308.585) [-309.332] (-307.489) -- 0:00:53
158000 -- (-308.241) (-308.366) (-306.791) [-307.602] * (-307.270) (-308.054) (-314.893) [-307.681] -- 0:00:53
158500 -- (-307.315) (-308.880) [-308.265] (-308.320) * [-309.279] (-312.393) (-308.142) (-307.864) -- 0:00:53
159000 -- (-308.566) (-309.683) [-307.051] (-308.903) * (-308.304) (-306.676) [-308.518] (-310.485) -- 0:00:52
159500 -- [-309.567] (-308.625) (-310.034) (-308.669) * (-310.156) [-309.109] (-309.571) (-311.354) -- 0:00:52
160000 -- (-307.188) (-307.763) (-307.562) [-310.538] * (-306.681) (-308.285) [-308.994] (-312.843) -- 0:00:52
Average standard deviation of split frequencies: 0.016369
160500 -- (-308.900) [-309.966] (-310.024) (-309.102) * (-306.469) (-308.966) [-306.641] (-310.329) -- 0:00:52
161000 -- [-309.753] (-309.741) (-309.006) (-311.938) * [-307.641] (-311.217) (-307.686) (-306.915) -- 0:00:52
161500 -- (-308.286) (-318.287) (-308.660) [-310.178] * (-307.743) (-308.271) [-311.643] (-308.544) -- 0:00:51
162000 -- [-307.903] (-312.396) (-309.198) (-308.959) * (-311.041) [-309.932] (-309.688) (-309.112) -- 0:00:51
162500 -- (-308.049) (-312.593) [-308.887] (-311.203) * (-309.377) [-308.793] (-309.414) (-309.298) -- 0:00:51
163000 -- (-309.565) [-307.975] (-307.828) (-315.291) * (-306.979) (-314.786) [-311.448] (-308.610) -- 0:00:51
163500 -- (-309.443) (-310.223) (-309.198) [-311.801] * (-311.500) (-309.140) (-307.585) [-308.955] -- 0:00:51
164000 -- (-310.359) (-307.536) [-311.046] (-308.248) * (-307.703) (-310.728) [-307.169] (-309.797) -- 0:00:50
164500 -- [-310.182] (-306.825) (-312.043) (-310.139) * (-309.082) (-311.576) [-307.011] (-310.767) -- 0:00:50
165000 -- (-313.287) [-308.722] (-310.927) (-310.311) * [-309.259] (-307.209) (-306.801) (-308.608) -- 0:00:50
Average standard deviation of split frequencies: 0.017749
165500 -- (-309.680) (-310.193) [-309.473] (-308.574) * [-307.938] (-306.908) (-307.196) (-308.031) -- 0:00:50
166000 -- (-308.255) [-310.918] (-307.538) (-309.939) * (-307.938) (-307.577) (-308.424) [-308.083] -- 0:00:50
166500 -- [-310.838] (-313.552) (-309.591) (-311.374) * (-312.764) (-308.878) (-307.298) [-306.707] -- 0:00:50
167000 -- (-313.047) [-309.762] (-307.829) (-314.024) * (-311.281) (-316.384) (-314.311) [-307.124] -- 0:00:49
167500 -- (-310.541) (-310.604) (-309.476) [-309.413] * (-307.006) (-310.286) (-307.122) [-307.683] -- 0:00:49
168000 -- (-309.265) [-309.869] (-310.879) (-309.400) * (-308.092) (-308.702) (-309.787) [-306.838] -- 0:00:49
168500 -- (-307.828) [-308.285] (-312.777) (-307.728) * (-309.474) [-308.021] (-312.044) (-309.679) -- 0:00:49
169000 -- [-311.918] (-312.223) (-310.298) (-308.636) * (-307.931) (-313.949) [-312.863] (-308.305) -- 0:00:49
169500 -- (-308.537) (-310.480) [-306.770] (-308.942) * (-307.644) (-309.354) [-306.869] (-310.808) -- 0:00:48
170000 -- (-307.755) (-308.811) (-308.197) [-306.845] * (-309.211) [-308.202] (-310.750) (-306.931) -- 0:00:48
Average standard deviation of split frequencies: 0.018753
170500 -- [-310.351] (-307.619) (-311.302) (-308.425) * (-309.357) [-306.563] (-316.437) (-309.268) -- 0:00:48
171000 -- (-306.409) [-308.529] (-307.902) (-309.544) * (-308.705) (-306.789) (-307.491) [-307.837] -- 0:00:48
171500 -- (-306.434) [-307.036] (-308.602) (-306.808) * [-306.380] (-307.801) (-311.510) (-308.429) -- 0:00:48
172000 -- (-307.637) (-309.051) (-307.479) [-308.528] * (-307.412) (-307.479) (-308.967) [-308.434] -- 0:00:48
172500 -- [-310.648] (-309.142) (-312.330) (-315.737) * [-307.955] (-310.227) (-310.151) (-310.547) -- 0:00:47
173000 -- [-307.045] (-308.988) (-308.264) (-316.129) * [-308.305] (-314.868) (-309.006) (-308.712) -- 0:00:52
173500 -- [-307.996] (-310.065) (-309.012) (-314.658) * (-309.387) (-307.343) (-307.632) [-307.714] -- 0:00:52
174000 -- (-309.273) (-308.133) [-307.751] (-320.796) * (-306.366) (-308.889) [-307.786] (-311.207) -- 0:00:52
174500 -- (-307.164) [-307.474] (-307.268) (-310.977) * [-309.151] (-310.225) (-311.168) (-307.751) -- 0:00:52
175000 -- [-307.040] (-309.176) (-307.645) (-309.413) * [-310.005] (-308.921) (-309.164) (-306.564) -- 0:00:51
Average standard deviation of split frequencies: 0.017008
175500 -- [-309.321] (-308.863) (-309.154) (-310.214) * (-312.986) (-308.806) [-310.277] (-307.567) -- 0:00:51
176000 -- (-309.717) (-310.961) [-308.896] (-311.220) * (-316.515) (-313.173) (-307.437) [-307.721] -- 0:00:51
176500 -- (-307.192) [-308.756] (-308.335) (-308.565) * (-317.214) [-308.867] (-307.885) (-310.800) -- 0:00:51
177000 -- (-309.371) (-309.866) (-308.472) [-309.809] * [-312.674] (-307.617) (-307.931) (-309.172) -- 0:00:51
177500 -- (-313.341) [-309.162] (-307.771) (-311.148) * (-309.776) (-310.090) (-309.387) [-307.375] -- 0:00:50
178000 -- (-309.302) [-308.824] (-310.136) (-308.954) * (-310.940) (-307.754) [-309.262] (-308.511) -- 0:00:50
178500 -- (-307.676) (-308.890) (-307.141) [-308.380] * (-308.123) (-309.558) [-307.916] (-307.870) -- 0:00:50
179000 -- (-310.753) (-307.487) (-308.111) [-309.247] * (-311.179) (-306.498) (-309.521) [-308.337] -- 0:00:50
179500 -- (-309.544) (-311.025) (-307.101) [-309.799] * (-309.182) [-310.131] (-307.832) (-312.408) -- 0:00:50
180000 -- (-309.939) [-307.193] (-307.750) (-313.044) * [-306.715] (-308.861) (-310.927) (-308.976) -- 0:00:50
Average standard deviation of split frequencies: 0.018787
180500 -- (-310.887) (-307.761) (-308.119) [-310.413] * (-309.810) (-308.525) (-308.158) [-307.628] -- 0:00:49
181000 -- [-307.289] (-307.077) (-307.924) (-308.520) * [-308.268] (-307.736) (-310.481) (-308.877) -- 0:00:49
181500 -- [-312.598] (-307.086) (-306.926) (-310.063) * (-308.690) [-307.103] (-308.132) (-308.562) -- 0:00:49
182000 -- [-307.481] (-314.031) (-308.888) (-307.598) * [-307.845] (-307.821) (-309.131) (-315.812) -- 0:00:49
182500 -- (-307.538) (-311.505) (-307.201) [-311.439] * (-311.706) (-311.292) (-313.911) [-308.255] -- 0:00:49
183000 -- [-307.551] (-308.234) (-308.334) (-309.620) * (-308.757) (-314.867) [-307.708] (-307.718) -- 0:00:49
183500 -- (-311.715) (-308.796) (-309.103) [-308.538] * (-308.163) [-309.042] (-314.759) (-308.928) -- 0:00:48
184000 -- [-310.332] (-308.616) (-308.341) (-308.116) * (-306.866) [-308.067] (-308.077) (-308.362) -- 0:00:48
184500 -- [-307.339] (-311.963) (-309.341) (-310.193) * (-307.955) [-310.640] (-308.791) (-307.401) -- 0:00:48
185000 -- (-307.510) [-311.368] (-310.961) (-310.042) * (-309.920) (-309.302) (-310.176) [-309.424] -- 0:00:48
Average standard deviation of split frequencies: 0.017874
185500 -- (-312.697) [-309.812] (-311.495) (-310.806) * (-307.104) (-311.686) (-309.950) [-307.524] -- 0:00:48
186000 -- (-310.019) (-309.857) (-306.945) [-308.049] * (-309.930) (-308.229) (-307.902) [-307.300] -- 0:00:48
186500 -- [-306.474] (-308.923) (-308.549) (-308.392) * (-308.220) (-307.646) [-311.795] (-314.142) -- 0:00:47
187000 -- [-307.448] (-308.326) (-307.414) (-307.661) * (-307.655) (-308.998) (-309.749) [-308.554] -- 0:00:47
187500 -- (-306.703) (-307.915) [-308.607] (-307.803) * [-308.826] (-309.515) (-308.814) (-309.587) -- 0:00:47
188000 -- (-316.664) (-308.938) (-307.581) [-307.901] * (-311.690) [-307.312] (-307.130) (-310.575) -- 0:00:47
188500 -- (-309.094) [-306.599] (-310.870) (-309.776) * [-312.385] (-310.648) (-309.288) (-310.874) -- 0:00:47
189000 -- (-309.437) [-307.494] (-313.022) (-309.840) * (-313.711) [-307.949] (-307.726) (-308.603) -- 0:00:47
189500 -- (-308.966) (-308.460) (-314.236) [-308.755] * (-310.181) [-308.683] (-312.084) (-311.330) -- 0:00:47
190000 -- (-308.129) [-307.371] (-309.485) (-309.029) * (-310.303) (-312.194) [-309.863] (-309.057) -- 0:00:51
Average standard deviation of split frequencies: 0.017060
190500 -- [-307.558] (-306.922) (-309.651) (-306.432) * [-307.017] (-310.729) (-308.844) (-308.580) -- 0:00:50
191000 -- (-310.861) (-308.969) [-309.301] (-312.262) * [-307.572] (-307.581) (-312.517) (-307.839) -- 0:00:50
191500 -- (-308.263) (-306.727) [-307.590] (-310.436) * [-308.829] (-307.028) (-310.754) (-308.404) -- 0:00:50
192000 -- (-309.543) (-307.138) (-311.613) [-309.505] * (-308.642) (-306.844) [-309.204] (-307.204) -- 0:00:50
192500 -- (-308.849) (-308.152) (-309.942) [-307.608] * [-310.279] (-308.712) (-311.244) (-308.697) -- 0:00:50
193000 -- (-310.077) (-307.481) (-307.405) [-308.245] * (-309.276) (-309.609) (-309.901) [-307.613] -- 0:00:50
193500 -- (-310.766) (-310.914) [-311.316] (-309.108) * [-306.923] (-307.772) (-307.377) (-307.816) -- 0:00:50
194000 -- (-312.119) [-308.879] (-313.009) (-308.888) * (-307.229) (-308.238) (-316.575) [-308.579] -- 0:00:49
194500 -- (-308.461) (-307.157) [-322.079] (-308.791) * (-310.442) (-309.294) (-309.460) [-306.840] -- 0:00:49
195000 -- (-308.056) (-310.491) [-313.652] (-307.378) * (-308.150) [-310.675] (-309.765) (-307.104) -- 0:00:49
Average standard deviation of split frequencies: 0.015754
195500 -- (-309.322) (-307.505) [-308.010] (-310.072) * [-306.734] (-308.231) (-309.330) (-309.762) -- 0:00:49
196000 -- (-310.372) (-311.124) [-306.466] (-310.767) * (-306.531) (-312.807) (-308.248) [-307.286] -- 0:00:49
196500 -- (-312.652) (-312.688) [-310.198] (-309.216) * (-307.530) [-309.505] (-307.337) (-308.676) -- 0:00:49
197000 -- [-308.866] (-314.155) (-310.267) (-310.418) * (-307.106) [-308.154] (-309.357) (-308.198) -- 0:00:48
197500 -- (-310.502) (-307.528) [-308.704] (-307.277) * (-309.630) (-310.129) (-307.486) [-313.405] -- 0:00:48
198000 -- (-308.614) (-307.655) [-311.943] (-308.557) * (-307.664) (-308.145) (-309.229) [-314.166] -- 0:00:48
198500 -- (-310.626) [-312.302] (-308.516) (-309.091) * (-307.860) [-309.998] (-309.316) (-309.900) -- 0:00:48
199000 -- [-306.615] (-308.372) (-312.369) (-308.005) * (-310.159) (-307.685) [-307.304] (-309.418) -- 0:00:48
199500 -- (-311.318) [-308.780] (-309.926) (-309.381) * (-309.761) (-308.764) (-312.179) [-312.677] -- 0:00:48
200000 -- [-308.308] (-308.115) (-308.374) (-309.750) * [-309.985] (-308.217) (-310.095) (-311.402) -- 0:00:48
Average standard deviation of split frequencies: 0.015975
200500 -- (-310.785) (-308.811) (-313.384) [-307.636] * (-306.911) (-309.835) [-309.138] (-309.100) -- 0:00:47
201000 -- (-307.196) (-308.301) [-307.253] (-309.198) * [-307.435] (-309.424) (-313.570) (-307.721) -- 0:00:47
201500 -- (-312.027) (-308.668) (-309.410) [-307.425] * (-310.998) (-309.110) (-310.813) [-308.498] -- 0:00:47
202000 -- (-310.448) [-309.970] (-309.182) (-308.580) * (-307.884) (-311.956) [-307.797] (-310.728) -- 0:00:47
202500 -- (-309.917) (-308.322) (-307.041) [-310.579] * [-308.116] (-307.914) (-307.664) (-310.418) -- 0:00:47
203000 -- [-308.182] (-307.265) (-308.162) (-307.134) * (-308.461) (-308.145) [-307.551] (-309.601) -- 0:00:47
203500 -- (-308.686) [-309.179] (-307.062) (-308.392) * [-306.894] (-309.867) (-309.872) (-311.871) -- 0:00:46
204000 -- (-306.970) (-310.237) (-307.253) [-309.109] * (-308.418) [-307.003] (-315.305) (-316.967) -- 0:00:46
204500 -- (-307.416) (-310.442) (-307.249) [-306.548] * (-314.739) (-309.374) [-308.251] (-310.675) -- 0:00:46
205000 -- (-309.558) (-307.361) (-308.285) [-308.859] * (-307.684) (-310.570) [-309.193] (-311.711) -- 0:00:46
Average standard deviation of split frequencies: 0.015790
205500 -- (-309.659) (-307.490) [-308.344] (-309.870) * (-307.305) (-307.408) (-315.674) [-310.796] -- 0:00:46
206000 -- [-308.803] (-310.319) (-307.822) (-310.557) * (-307.091) (-308.939) (-310.109) [-310.040] -- 0:00:46
206500 -- (-308.857) (-312.572) (-308.207) [-315.257] * [-307.193] (-310.029) (-307.590) (-307.273) -- 0:00:46
207000 -- (-307.637) (-307.439) (-307.121) [-307.594] * [-306.848] (-308.539) (-307.413) (-309.360) -- 0:00:49
207500 -- (-310.302) (-310.827) (-307.161) [-308.580] * (-307.649) (-309.086) (-309.382) [-307.573] -- 0:00:49
208000 -- (-307.564) [-308.852] (-309.789) (-308.321) * [-307.327] (-308.639) (-308.484) (-308.872) -- 0:00:49
208500 -- (-306.672) (-312.297) [-307.755] (-311.423) * (-307.580) (-311.501) (-308.167) [-307.682] -- 0:00:49
209000 -- (-307.025) (-308.524) [-307.322] (-310.330) * (-309.377) (-310.387) [-309.664] (-310.279) -- 0:00:49
209500 -- (-307.602) (-308.380) [-307.360] (-308.014) * (-308.223) [-307.041] (-307.493) (-309.349) -- 0:00:49
210000 -- (-308.193) (-306.693) (-307.639) [-307.424] * (-310.568) [-307.965] (-307.998) (-306.797) -- 0:00:48
Average standard deviation of split frequencies: 0.015440
210500 -- (-310.566) (-309.732) [-309.212] (-307.791) * (-308.246) (-308.010) (-308.159) [-309.164] -- 0:00:48
211000 -- (-307.922) (-313.995) [-310.574] (-307.966) * (-314.256) [-309.004] (-310.605) (-309.187) -- 0:00:48
211500 -- [-306.659] (-307.628) (-307.589) (-307.366) * (-313.092) (-309.528) [-310.715] (-313.249) -- 0:00:48
212000 -- (-307.395) [-309.555] (-307.362) (-312.771) * (-313.835) (-308.118) [-310.511] (-311.063) -- 0:00:48
212500 -- (-308.812) (-308.325) [-308.318] (-306.978) * [-307.577] (-307.937) (-309.807) (-306.966) -- 0:00:48
213000 -- (-307.817) (-307.158) (-307.836) [-306.805] * [-309.177] (-308.614) (-308.827) (-309.041) -- 0:00:48
213500 -- (-310.147) (-310.331) [-307.026] (-308.159) * [-309.040] (-307.567) (-310.134) (-307.886) -- 0:00:47
214000 -- (-307.162) (-311.550) [-306.581] (-306.668) * (-306.757) [-309.222] (-308.312) (-309.344) -- 0:00:47
214500 -- [-309.701] (-309.816) (-306.847) (-311.119) * (-307.118) (-308.115) [-306.928] (-307.223) -- 0:00:47
215000 -- (-311.838) (-308.414) (-306.777) [-309.298] * [-307.382] (-307.069) (-307.615) (-309.943) -- 0:00:47
Average standard deviation of split frequencies: 0.015277
215500 -- [-308.400] (-311.626) (-308.699) (-311.537) * (-309.742) (-308.872) (-307.350) [-308.037] -- 0:00:47
216000 -- (-306.832) (-308.444) (-314.081) [-311.075] * (-309.540) (-309.594) [-311.579] (-307.681) -- 0:00:47
216500 -- [-307.753] (-309.476) (-307.369) (-312.180) * (-312.498) (-308.932) (-310.777) [-308.332] -- 0:00:47
217000 -- (-307.681) (-312.581) [-310.284] (-317.481) * [-307.484] (-308.765) (-308.563) (-310.068) -- 0:00:46
217500 -- (-307.189) (-308.941) (-307.821) [-307.752] * [-307.837] (-308.263) (-308.516) (-308.479) -- 0:00:46
218000 -- (-309.496) (-307.061) [-310.796] (-308.287) * (-307.270) (-307.122) (-308.327) [-311.556] -- 0:00:46
218500 -- (-308.218) (-308.008) (-307.911) [-307.587] * (-308.986) (-307.424) (-313.140) [-309.425] -- 0:00:46
219000 -- (-307.892) (-309.730) (-311.881) [-306.624] * [-310.123] (-310.508) (-310.113) (-309.787) -- 0:00:46
219500 -- (-308.761) [-309.556] (-306.720) (-311.594) * [-310.246] (-309.778) (-308.525) (-312.393) -- 0:00:46
220000 -- (-307.493) [-308.200] (-310.884) (-307.152) * (-310.726) (-309.081) [-307.671] (-310.084) -- 0:00:46
Average standard deviation of split frequencies: 0.014954
220500 -- (-313.072) [-306.637] (-314.845) (-308.153) * (-307.785) (-308.101) [-308.326] (-310.541) -- 0:00:45
221000 -- (-311.862) (-311.261) (-311.761) [-306.514] * [-308.063] (-307.885) (-310.274) (-311.308) -- 0:00:45
221500 -- (-308.863) (-307.418) [-306.763] (-308.018) * (-306.845) (-314.239) [-309.063] (-308.259) -- 0:00:45
222000 -- [-309.761] (-308.450) (-307.995) (-308.408) * (-307.365) [-307.823] (-309.412) (-306.605) -- 0:00:45
222500 -- [-309.138] (-310.842) (-307.957) (-307.973) * (-308.066) (-309.101) [-309.397] (-307.715) -- 0:00:45
223000 -- (-312.040) [-307.142] (-307.637) (-307.606) * (-308.706) (-307.525) (-307.802) [-307.387] -- 0:00:45
223500 -- (-308.154) [-307.177] (-309.190) (-307.582) * (-308.844) (-308.062) (-309.536) [-306.576] -- 0:00:45
224000 -- (-308.120) (-307.126) (-306.853) [-308.662] * (-313.291) (-311.819) [-309.035] (-308.972) -- 0:00:48
224500 -- (-310.676) [-308.231] (-310.192) (-306.897) * (-307.754) (-312.089) [-309.476] (-309.530) -- 0:00:48
225000 -- [-307.017] (-309.716) (-307.971) (-308.001) * (-308.844) [-313.520] (-307.569) (-309.518) -- 0:00:48
Average standard deviation of split frequencies: 0.014381
225500 -- (-308.029) [-306.841] (-310.929) (-308.578) * [-307.316] (-317.094) (-310.086) (-308.136) -- 0:00:48
226000 -- [-310.229] (-306.850) (-307.947) (-308.103) * (-306.814) [-308.841] (-310.647) (-308.229) -- 0:00:47
226500 -- [-309.179] (-306.597) (-308.681) (-309.070) * (-307.443) [-308.273] (-309.996) (-308.050) -- 0:00:47
227000 -- (-308.409) (-307.316) (-307.285) [-308.874] * [-308.136] (-313.217) (-309.697) (-312.320) -- 0:00:47
227500 -- (-306.891) [-308.830] (-307.627) (-307.011) * [-308.481] (-310.426) (-309.083) (-312.131) -- 0:00:47
228000 -- (-308.936) (-307.476) (-308.171) [-307.567] * [-307.605] (-307.537) (-308.673) (-309.413) -- 0:00:47
228500 -- (-308.832) [-308.277] (-311.378) (-311.897) * [-309.005] (-307.970) (-308.154) (-309.618) -- 0:00:47
229000 -- (-313.805) (-309.419) [-310.341] (-311.748) * (-308.935) [-306.865] (-309.654) (-311.178) -- 0:00:47
229500 -- (-310.525) (-307.277) [-307.085] (-307.134) * [-309.672] (-307.975) (-308.366) (-309.708) -- 0:00:47
230000 -- (-309.617) (-309.936) [-310.191] (-308.477) * (-308.765) [-308.690] (-307.930) (-310.365) -- 0:00:46
Average standard deviation of split frequencies: 0.014306
230500 -- [-309.288] (-313.241) (-307.948) (-313.058) * [-306.921] (-311.634) (-314.644) (-308.328) -- 0:00:46
231000 -- (-308.207) (-306.764) (-311.191) [-311.098] * (-311.738) (-309.857) (-310.147) [-310.599] -- 0:00:46
231500 -- (-306.812) [-309.744] (-309.910) (-308.280) * (-312.480) (-310.041) (-310.235) [-310.206] -- 0:00:46
232000 -- (-307.498) (-310.856) (-307.920) [-306.967] * (-306.836) (-307.450) [-307.278] (-308.850) -- 0:00:46
232500 -- (-311.952) (-308.468) (-309.991) [-309.365] * (-306.967) [-308.149] (-310.348) (-307.007) -- 0:00:46
233000 -- (-308.100) [-307.431] (-308.720) (-308.353) * (-308.068) (-314.000) (-312.292) [-310.595] -- 0:00:46
233500 -- (-308.539) [-307.805] (-308.314) (-308.107) * (-308.203) (-314.528) (-307.127) [-306.628] -- 0:00:45
234000 -- [-313.816] (-310.113) (-308.760) (-308.083) * [-307.656] (-309.671) (-306.967) (-306.851) -- 0:00:45
234500 -- [-312.455] (-310.793) (-308.142) (-309.822) * (-310.122) [-309.517] (-310.287) (-310.975) -- 0:00:45
235000 -- (-310.124) [-307.893] (-310.170) (-309.491) * [-310.333] (-307.719) (-307.099) (-306.740) -- 0:00:45
Average standard deviation of split frequencies: 0.014613
235500 -- (-310.580) (-309.222) (-311.977) [-309.581] * (-307.291) (-309.195) (-309.564) [-308.326] -- 0:00:45
236000 -- (-307.349) (-307.474) [-308.728] (-310.313) * [-308.689] (-309.023) (-311.645) (-311.881) -- 0:00:45
236500 -- (-308.114) [-306.644] (-307.715) (-308.215) * (-307.499) (-309.956) [-308.426] (-310.815) -- 0:00:45
237000 -- (-308.867) (-309.389) (-309.544) [-307.170] * (-307.635) [-308.151] (-307.369) (-306.961) -- 0:00:45
237500 -- (-307.525) [-310.150] (-306.813) (-314.535) * [-308.232] (-310.782) (-307.926) (-308.308) -- 0:00:44
238000 -- (-308.786) (-307.998) (-308.869) [-309.263] * (-307.319) [-308.923] (-306.803) (-306.946) -- 0:00:44
238500 -- (-309.958) (-310.077) (-310.940) [-309.906] * [-312.207] (-308.361) (-306.599) (-307.946) -- 0:00:44
239000 -- (-306.352) [-307.926] (-309.185) (-307.168) * (-309.997) (-310.173) [-309.514] (-309.196) -- 0:00:44
239500 -- (-309.100) [-307.532] (-309.295) (-313.869) * (-309.939) [-308.330] (-306.567) (-312.416) -- 0:00:44
240000 -- (-312.355) (-306.981) (-309.644) [-311.063] * (-310.595) (-306.397) [-307.586] (-311.304) -- 0:00:44
Average standard deviation of split frequencies: 0.015464
240500 -- (-309.826) [-306.813] (-309.340) (-308.795) * [-306.829] (-308.792) (-308.018) (-310.877) -- 0:00:44
241000 -- [-311.245] (-306.497) (-307.311) (-310.545) * (-307.547) (-307.573) (-310.399) [-307.740] -- 0:00:47
241500 -- [-306.665] (-311.918) (-310.501) (-307.682) * (-311.471) [-306.584] (-312.435) (-308.454) -- 0:00:47
242000 -- [-307.881] (-307.988) (-314.173) (-307.258) * (-312.565) (-307.944) (-306.941) [-310.286] -- 0:00:46
242500 -- (-307.991) [-309.581] (-314.580) (-309.288) * (-313.724) (-309.608) [-307.352] (-308.807) -- 0:00:46
243000 -- [-306.802] (-309.390) (-306.657) (-307.450) * (-315.323) (-310.829) (-310.691) [-307.063] -- 0:00:46
243500 -- (-308.831) (-307.766) (-307.188) [-308.328] * (-309.946) (-311.095) (-308.338) [-307.738] -- 0:00:46
244000 -- (-310.578) (-308.025) (-307.068) [-307.423] * (-308.759) [-308.781] (-309.790) (-310.905) -- 0:00:46
244500 -- [-311.213] (-310.788) (-311.676) (-307.612) * [-309.701] (-309.676) (-307.219) (-310.475) -- 0:00:46
245000 -- [-308.831] (-307.981) (-314.087) (-308.811) * [-310.024] (-309.481) (-307.243) (-311.933) -- 0:00:46
Average standard deviation of split frequencies: 0.015835
245500 -- (-308.245) (-312.891) (-316.581) [-308.000] * [-307.150] (-307.584) (-312.594) (-310.990) -- 0:00:46
246000 -- (-307.975) (-313.430) [-306.695] (-309.183) * [-307.378] (-309.581) (-307.002) (-308.699) -- 0:00:45
246500 -- (-312.818) (-308.594) [-308.875] (-308.739) * [-307.126] (-314.208) (-309.752) (-312.440) -- 0:00:45
247000 -- [-307.128] (-309.099) (-309.233) (-309.593) * (-310.021) (-311.887) (-308.705) [-306.736] -- 0:00:45
247500 -- [-309.443] (-307.900) (-307.462) (-311.773) * [-308.483] (-309.364) (-310.735) (-308.703) -- 0:00:45
248000 -- (-309.735) (-307.428) [-310.778] (-311.011) * [-307.572] (-308.929) (-310.091) (-309.178) -- 0:00:45
248500 -- [-308.315] (-307.884) (-308.432) (-307.581) * (-307.188) [-309.517] (-311.629) (-308.430) -- 0:00:45
249000 -- [-308.585] (-307.369) (-308.161) (-308.544) * (-307.862) [-307.183] (-308.752) (-307.296) -- 0:00:45
249500 -- (-309.662) (-307.161) [-309.258] (-309.133) * [-310.530] (-306.781) (-310.049) (-308.444) -- 0:00:45
250000 -- (-309.091) (-311.336) [-312.184] (-309.320) * [-310.133] (-308.893) (-307.558) (-309.579) -- 0:00:45
Average standard deviation of split frequencies: 0.014649
250500 -- (-309.771) (-310.249) (-307.751) [-309.399] * (-310.784) [-308.920] (-308.568) (-310.771) -- 0:00:44
251000 -- (-310.716) [-309.427] (-307.718) (-309.521) * [-307.408] (-311.432) (-308.111) (-310.299) -- 0:00:44
251500 -- (-308.106) (-313.664) [-306.785] (-308.607) * (-308.503) (-311.763) [-306.979] (-307.385) -- 0:00:44
252000 -- (-309.240) (-312.176) [-310.301] (-314.205) * (-308.904) [-309.079] (-309.078) (-307.426) -- 0:00:44
252500 -- [-309.374] (-308.248) (-313.768) (-309.779) * (-306.742) [-312.207] (-307.080) (-308.068) -- 0:00:44
253000 -- [-307.776] (-307.538) (-307.692) (-307.813) * [-308.510] (-310.048) (-310.222) (-307.357) -- 0:00:44
253500 -- (-309.343) (-308.164) (-307.033) [-307.844] * [-306.793] (-310.659) (-308.517) (-311.871) -- 0:00:44
254000 -- [-308.440] (-308.130) (-309.013) (-308.091) * (-306.822) (-311.812) (-310.166) [-307.648] -- 0:00:44
254500 -- (-308.586) (-311.933) [-307.729] (-310.558) * (-307.858) (-310.064) [-309.396] (-309.732) -- 0:00:43
255000 -- (-307.373) (-310.263) [-307.165] (-307.677) * (-308.911) (-310.654) [-308.470] (-314.144) -- 0:00:43
Average standard deviation of split frequencies: 0.013504
255500 -- (-308.284) (-306.965) (-307.919) [-308.822] * [-308.744] (-307.878) (-308.271) (-315.062) -- 0:00:43
256000 -- (-308.238) (-307.384) (-309.982) [-309.098] * (-306.742) (-306.829) (-308.389) [-308.803] -- 0:00:43
256500 -- (-310.135) (-307.922) [-307.755] (-307.422) * (-307.895) (-309.848) (-308.832) [-308.283] -- 0:00:43
257000 -- (-309.455) [-310.163] (-311.525) (-306.976) * (-311.842) (-311.700) (-311.819) [-308.438] -- 0:00:43
257500 -- [-307.781] (-307.186) (-314.203) (-307.665) * (-309.128) (-308.653) [-307.442] (-309.706) -- 0:00:43
258000 -- (-307.456) [-310.431] (-314.205) (-309.762) * (-308.254) (-313.176) (-306.790) [-308.024] -- 0:00:46
258500 -- (-307.378) (-313.546) [-311.322] (-310.850) * (-309.130) (-309.907) [-306.548] (-308.544) -- 0:00:45
259000 -- (-310.290) (-309.205) [-308.390] (-309.309) * (-309.529) [-309.453] (-308.424) (-308.797) -- 0:00:45
259500 -- (-310.658) (-311.496) (-312.991) [-310.682] * (-310.407) (-307.232) [-308.567] (-308.066) -- 0:00:45
260000 -- (-308.313) (-311.026) [-311.053] (-310.742) * (-309.805) (-309.879) [-307.637] (-309.289) -- 0:00:45
Average standard deviation of split frequencies: 0.013463
260500 -- (-308.743) [-309.427] (-314.644) (-309.797) * (-308.591) (-308.816) (-311.103) [-308.997] -- 0:00:45
261000 -- (-310.138) (-306.566) [-310.448] (-309.332) * [-308.602] (-307.531) (-307.469) (-308.512) -- 0:00:45
261500 -- [-309.502] (-307.947) (-308.876) (-309.746) * (-307.587) (-311.483) (-308.245) [-311.605] -- 0:00:45
262000 -- (-307.333) [-306.974] (-308.441) (-307.410) * [-307.565] (-312.617) (-308.652) (-310.834) -- 0:00:45
262500 -- (-313.135) (-307.454) (-312.434) [-309.621] * [-308.273] (-308.745) (-310.897) (-310.480) -- 0:00:44
263000 -- [-311.988] (-308.856) (-310.906) (-307.795) * (-307.703) (-310.127) (-313.962) [-309.617] -- 0:00:44
263500 -- (-306.744) [-308.045] (-306.844) (-308.262) * (-309.963) (-308.348) (-317.048) [-307.417] -- 0:00:44
264000 -- (-309.555) (-307.085) (-307.226) [-310.106] * (-310.539) (-309.563) (-317.415) [-312.329] -- 0:00:44
264500 -- (-311.364) (-307.155) (-307.322) [-308.663] * [-308.559] (-310.087) (-309.467) (-317.113) -- 0:00:44
265000 -- (-306.841) [-308.260] (-309.730) (-310.496) * (-308.928) (-306.961) [-307.942] (-308.289) -- 0:00:44
Average standard deviation of split frequencies: 0.014798
265500 -- (-306.642) (-307.687) (-307.088) [-315.780] * (-310.240) [-309.465] (-312.977) (-311.496) -- 0:00:44
266000 -- (-307.970) (-308.598) (-309.988) [-307.548] * (-313.119) [-307.284] (-307.904) (-307.920) -- 0:00:44
266500 -- (-309.001) (-309.941) (-309.112) [-307.450] * (-307.506) (-308.169) (-307.514) [-308.364] -- 0:00:44
267000 -- [-308.108] (-310.612) (-307.008) (-308.219) * (-313.074) [-308.692] (-310.725) (-306.708) -- 0:00:43
267500 -- (-308.998) [-309.526] (-308.286) (-307.826) * (-310.244) (-307.560) [-307.542] (-307.826) -- 0:00:43
268000 -- [-308.972] (-308.203) (-308.293) (-308.610) * (-311.609) (-309.769) [-311.710] (-315.008) -- 0:00:43
268500 -- (-311.653) (-307.944) (-308.491) [-309.095] * [-310.348] (-307.014) (-309.008) (-317.299) -- 0:00:43
269000 -- (-307.794) (-308.167) [-307.971] (-307.482) * (-308.652) (-312.496) [-308.326] (-309.606) -- 0:00:43
269500 -- (-308.693) [-308.866] (-310.877) (-313.213) * (-308.642) (-312.612) [-307.829] (-309.898) -- 0:00:43
270000 -- (-307.496) (-308.693) (-307.474) [-309.533] * [-308.163] (-308.132) (-308.885) (-307.186) -- 0:00:43
Average standard deviation of split frequencies: 0.014025
270500 -- (-306.839) [-308.122] (-312.626) (-313.971) * (-308.042) (-307.617) [-307.841] (-307.831) -- 0:00:43
271000 -- (-306.554) (-309.344) [-311.673] (-313.963) * (-308.606) [-309.083] (-308.285) (-307.974) -- 0:00:43
271500 -- (-307.758) (-308.753) [-310.318] (-307.978) * (-307.881) (-306.739) (-309.542) [-309.379] -- 0:00:42
272000 -- (-309.701) (-309.404) (-309.985) [-307.481] * (-308.944) (-307.844) [-307.767] (-307.288) -- 0:00:42
272500 -- (-309.150) [-308.884] (-310.959) (-308.198) * (-309.188) (-307.922) (-310.335) [-307.681] -- 0:00:42
273000 -- [-307.831] (-309.093) (-309.425) (-308.096) * (-311.892) (-311.120) [-308.947] (-310.047) -- 0:00:42
273500 -- [-308.961] (-307.653) (-310.279) (-309.501) * (-308.534) (-306.844) [-311.323] (-307.970) -- 0:00:42
274000 -- (-307.935) (-310.468) (-308.569) [-309.464] * (-310.062) [-308.235] (-307.731) (-307.538) -- 0:00:42
274500 -- (-310.327) (-308.271) (-307.862) [-309.538] * (-308.945) [-308.511] (-307.509) (-309.487) -- 0:00:42
275000 -- (-315.115) (-307.339) [-308.210] (-307.783) * (-310.425) (-306.822) (-307.172) [-308.175] -- 0:00:44
Average standard deviation of split frequencies: 0.012765
275500 -- (-311.543) (-308.099) [-307.476] (-308.137) * (-308.307) (-309.831) [-308.815] (-307.012) -- 0:00:44
276000 -- (-307.804) (-311.414) (-307.856) [-307.288] * (-308.563) (-308.298) [-306.472] (-307.776) -- 0:00:44
276500 -- (-307.634) [-308.305] (-306.719) (-307.147) * (-311.172) (-309.614) (-306.355) [-307.871] -- 0:00:44
277000 -- (-310.366) [-307.999] (-306.984) (-310.405) * (-311.957) (-311.232) (-307.940) [-314.849] -- 0:00:44
277500 -- (-308.509) [-311.687] (-308.017) (-310.364) * (-307.678) [-309.420] (-306.609) (-313.423) -- 0:00:44
278000 -- (-308.659) [-311.538] (-307.820) (-308.963) * (-310.361) [-308.997] (-308.808) (-311.565) -- 0:00:44
278500 -- (-309.326) (-306.922) [-306.496] (-310.638) * [-311.246] (-307.324) (-310.297) (-312.162) -- 0:00:44
279000 -- [-310.724] (-306.830) (-309.366) (-308.295) * [-308.075] (-309.265) (-310.298) (-307.571) -- 0:00:43
279500 -- (-307.932) (-310.811) [-308.306] (-307.083) * [-308.970] (-309.605) (-309.657) (-308.302) -- 0:00:43
280000 -- [-312.045] (-309.496) (-312.985) (-307.176) * (-307.466) (-306.808) [-306.547] (-306.908) -- 0:00:43
Average standard deviation of split frequencies: 0.014056
280500 -- (-310.837) (-310.170) (-307.381) [-308.580] * (-308.708) (-307.462) (-306.715) [-307.268] -- 0:00:43
281000 -- (-311.387) [-307.682] (-309.495) (-308.966) * [-309.915] (-309.320) (-306.622) (-308.926) -- 0:00:43
281500 -- (-308.949) (-309.840) (-312.411) [-309.531] * (-307.505) (-309.529) [-309.212] (-308.009) -- 0:00:43
282000 -- (-307.112) (-308.342) (-311.111) [-308.607] * (-308.717) (-309.402) (-308.709) [-307.903] -- 0:00:43
282500 -- (-306.865) (-309.885) (-310.821) [-308.052] * (-307.584) (-309.669) [-307.151] (-309.463) -- 0:00:43
283000 -- (-308.350) (-308.254) [-308.128] (-309.050) * (-307.073) (-307.037) (-308.007) [-307.573] -- 0:00:43
283500 -- [-307.338] (-313.871) (-307.483) (-307.323) * [-307.739] (-306.772) (-311.469) (-308.578) -- 0:00:42
284000 -- [-309.956] (-308.632) (-307.958) (-307.911) * [-307.943] (-311.191) (-310.569) (-309.094) -- 0:00:42
284500 -- [-312.281] (-313.652) (-309.361) (-310.719) * [-307.140] (-311.497) (-308.074) (-309.516) -- 0:00:42
285000 -- (-308.955) [-310.099] (-308.702) (-307.214) * (-309.167) (-308.171) [-311.161] (-311.160) -- 0:00:42
Average standard deviation of split frequencies: 0.013269
285500 -- (-307.912) [-313.640] (-307.057) (-307.104) * (-307.742) (-308.051) [-308.785] (-310.925) -- 0:00:42
286000 -- [-307.810] (-307.448) (-309.174) (-308.138) * (-306.990) [-308.295] (-311.672) (-307.070) -- 0:00:42
286500 -- (-307.871) (-307.749) [-307.493] (-309.749) * (-308.573) (-306.886) [-310.209] (-310.245) -- 0:00:42
287000 -- [-312.514] (-307.842) (-308.592) (-308.631) * (-309.969) (-309.032) [-307.092] (-311.764) -- 0:00:42
287500 -- (-309.704) (-307.381) [-309.885] (-307.885) * (-307.801) (-307.467) (-307.161) [-307.320] -- 0:00:42
288000 -- (-307.212) [-308.124] (-308.537) (-310.413) * [-306.822] (-311.899) (-309.636) (-307.285) -- 0:00:42
288500 -- (-309.144) (-306.902) [-311.242] (-307.678) * (-306.783) (-311.762) [-310.380] (-310.007) -- 0:00:41
289000 -- (-306.915) (-306.701) [-308.248] (-309.572) * [-306.526] (-308.020) (-307.224) (-311.225) -- 0:00:41
289500 -- (-308.656) [-307.755] (-308.164) (-310.071) * (-308.009) (-309.044) [-306.879] (-311.744) -- 0:00:41
290000 -- (-308.216) [-308.712] (-308.919) (-308.546) * (-308.277) (-307.693) [-307.510] (-313.311) -- 0:00:41
Average standard deviation of split frequencies: 0.012377
290500 -- [-311.469] (-312.216) (-308.928) (-306.677) * (-309.051) [-307.314] (-311.499) (-307.936) -- 0:00:41
291000 -- (-308.846) (-309.761) (-310.288) [-307.799] * [-306.727] (-310.312) (-311.777) (-307.924) -- 0:00:41
291500 -- (-307.200) (-308.223) (-311.681) [-309.144] * (-307.952) [-309.310] (-308.063) (-310.425) -- 0:00:43
292000 -- (-307.433) (-307.827) (-307.534) [-308.571] * (-308.246) (-309.913) (-308.181) [-309.740] -- 0:00:43
292500 -- (-308.235) [-309.467] (-308.078) (-309.407) * (-309.053) [-310.909] (-311.799) (-308.465) -- 0:00:43
293000 -- (-310.596) [-307.811] (-307.171) (-309.760) * (-308.784) (-306.669) (-313.787) [-307.022] -- 0:00:43
293500 -- [-311.865] (-310.168) (-307.141) (-307.071) * (-308.529) (-307.825) (-309.491) [-308.027] -- 0:00:43
294000 -- [-310.336] (-308.678) (-309.101) (-307.789) * [-307.511] (-310.905) (-309.031) (-309.814) -- 0:00:43
294500 -- (-308.494) (-308.498) (-307.964) [-309.713] * (-310.473) [-311.979] (-309.450) (-308.028) -- 0:00:43
295000 -- (-311.115) (-307.457) [-307.944] (-309.153) * (-308.018) (-309.774) [-308.139] (-308.584) -- 0:00:43
Average standard deviation of split frequencies: 0.011735
295500 -- (-308.700) (-308.016) (-309.150) [-309.254] * (-308.153) (-308.024) [-307.812] (-308.386) -- 0:00:42
296000 -- (-311.116) [-307.523] (-309.854) (-309.549) * (-312.022) (-310.128) (-309.874) [-307.916] -- 0:00:42
296500 -- [-307.849] (-307.191) (-311.384) (-308.423) * [-308.138] (-307.502) (-309.098) (-307.141) -- 0:00:42
297000 -- [-306.879] (-308.620) (-312.938) (-308.840) * (-308.781) (-308.358) (-308.668) [-307.179] -- 0:00:42
297500 -- [-307.582] (-307.154) (-317.257) (-308.841) * [-307.490] (-312.368) (-308.226) (-308.463) -- 0:00:42
298000 -- (-306.974) [-307.755] (-309.059) (-309.080) * (-306.981) (-312.023) [-310.490] (-308.947) -- 0:00:42
298500 -- (-308.326) (-310.856) [-308.555] (-310.565) * [-309.411] (-307.347) (-309.923) (-307.020) -- 0:00:42
299000 -- (-307.711) (-306.748) (-309.080) [-307.417] * [-312.206] (-311.520) (-308.289) (-308.861) -- 0:00:42
299500 -- (-309.366) (-310.362) [-309.884] (-309.827) * (-307.534) (-314.602) (-311.083) [-306.898] -- 0:00:42
300000 -- (-310.165) (-307.671) (-309.658) [-310.148] * (-311.220) (-310.053) (-307.929) [-308.089] -- 0:00:42
Average standard deviation of split frequencies: 0.012630
300500 -- (-307.443) (-314.709) [-309.410] (-308.148) * (-310.206) (-307.118) [-309.099] (-308.399) -- 0:00:41
301000 -- (-308.330) (-307.270) [-308.789] (-315.351) * (-308.132) [-308.613] (-308.938) (-310.468) -- 0:00:41
301500 -- [-309.319] (-312.602) (-311.513) (-310.085) * (-309.058) (-311.878) [-306.416] (-315.284) -- 0:00:41
302000 -- (-308.379) [-307.014] (-314.106) (-308.093) * (-306.401) (-311.287) (-310.219) [-309.470] -- 0:00:41
302500 -- (-310.452) [-307.736] (-310.704) (-307.864) * [-307.752] (-307.051) (-308.652) (-309.695) -- 0:00:41
303000 -- (-309.788) (-308.347) [-308.605] (-307.113) * (-307.608) (-310.286) (-307.779) [-306.586] -- 0:00:41
303500 -- (-310.051) (-308.194) [-310.621] (-306.386) * (-307.786) (-307.803) (-308.280) [-307.369] -- 0:00:41
304000 -- (-311.029) (-308.232) [-310.099] (-306.348) * [-308.746] (-309.890) (-307.001) (-309.537) -- 0:00:41
304500 -- (-310.222) (-310.827) (-309.496) [-307.904] * [-307.352] (-307.231) (-306.774) (-311.849) -- 0:00:41
305000 -- (-310.319) (-312.502) [-307.043] (-307.646) * [-308.874] (-309.515) (-310.821) (-309.039) -- 0:00:41
Average standard deviation of split frequencies: 0.011432
305500 -- (-309.174) (-309.340) (-307.737) [-308.392] * (-309.813) [-307.993] (-309.326) (-309.335) -- 0:00:40
306000 -- (-312.917) (-308.984) (-311.162) [-306.724] * (-308.882) [-308.234] (-309.182) (-309.369) -- 0:00:40
306500 -- (-310.900) (-307.979) [-310.050] (-306.957) * (-311.624) (-308.405) (-309.342) [-306.941] -- 0:00:40
307000 -- (-309.045) (-308.871) [-307.719] (-311.594) * [-307.957] (-307.851) (-308.686) (-308.256) -- 0:00:40
307500 -- (-307.805) [-311.813] (-310.577) (-308.014) * (-313.135) [-308.265] (-307.456) (-308.693) -- 0:00:40
308000 -- (-309.530) (-307.467) [-308.466] (-310.681) * [-307.504] (-310.190) (-308.832) (-306.789) -- 0:00:40
308500 -- (-314.086) [-308.735] (-310.281) (-310.409) * (-308.810) (-316.074) (-308.108) [-309.370] -- 0:00:42
309000 -- (-307.211) (-307.626) [-309.078] (-309.210) * (-310.116) [-307.955] (-308.491) (-306.577) -- 0:00:42
309500 -- (-309.191) (-307.346) [-310.084] (-310.115) * (-309.968) [-307.109] (-311.794) (-307.200) -- 0:00:42
310000 -- (-311.071) [-310.842] (-308.192) (-308.644) * [-312.766] (-309.979) (-311.814) (-307.331) -- 0:00:42
Average standard deviation of split frequencies: 0.011500
310500 -- [-309.598] (-307.173) (-310.353) (-314.621) * (-314.668) (-318.895) (-307.522) [-307.367] -- 0:00:42
311000 -- (-311.015) (-311.584) [-307.330] (-308.693) * (-313.083) (-314.043) (-307.620) [-307.670] -- 0:00:42
311500 -- (-306.779) (-309.408) (-307.613) [-307.101] * (-309.082) (-310.458) (-307.624) [-307.513] -- 0:00:41
312000 -- (-309.356) (-307.143) [-309.581] (-308.861) * (-309.966) [-311.388] (-307.713) (-315.141) -- 0:00:41
312500 -- (-307.963) (-313.139) (-307.313) [-309.101] * (-306.591) [-312.156] (-310.705) (-310.551) -- 0:00:41
313000 -- [-308.801] (-313.310) (-308.703) (-308.682) * (-311.666) (-306.851) [-307.231] (-309.091) -- 0:00:41
313500 -- [-308.619] (-310.957) (-309.607) (-306.713) * (-309.773) (-306.912) [-307.884] (-309.425) -- 0:00:41
314000 -- (-307.351) [-307.754] (-310.612) (-312.429) * (-307.726) [-308.982] (-310.591) (-308.122) -- 0:00:41
314500 -- (-306.867) (-307.894) (-309.315) [-309.302] * (-310.113) (-309.673) [-309.703] (-306.624) -- 0:00:41
315000 -- [-308.920] (-307.498) (-307.184) (-309.933) * (-308.485) (-308.096) [-312.117] (-306.947) -- 0:00:41
Average standard deviation of split frequencies: 0.010608
315500 -- [-308.870] (-309.148) (-307.459) (-310.779) * (-306.799) (-307.152) (-309.996) [-307.167] -- 0:00:41
316000 -- (-310.684) (-307.313) (-309.683) [-310.119] * [-307.648] (-308.662) (-309.905) (-310.491) -- 0:00:41
316500 -- (-311.324) (-306.923) [-308.041] (-310.886) * [-310.353] (-309.357) (-307.091) (-309.881) -- 0:00:41
317000 -- (-308.215) (-307.650) (-308.289) [-311.299] * (-309.673) (-308.952) (-311.310) [-306.718] -- 0:00:40
317500 -- (-308.524) (-316.166) [-310.608] (-307.760) * (-307.046) [-308.436] (-308.655) (-307.900) -- 0:00:40
318000 -- [-309.241] (-308.874) (-307.954) (-311.668) * (-308.449) (-306.670) (-308.855) [-308.211] -- 0:00:40
318500 -- [-309.429] (-308.186) (-307.901) (-311.365) * (-310.451) [-310.283] (-307.890) (-307.030) -- 0:00:40
319000 -- (-309.234) (-309.214) (-307.954) [-307.141] * [-312.878] (-308.074) (-312.398) (-306.462) -- 0:00:40
319500 -- (-315.233) (-306.643) (-308.865) [-308.786] * [-309.931] (-314.782) (-307.680) (-308.621) -- 0:00:40
320000 -- (-310.952) (-307.785) [-309.966] (-307.106) * [-308.203] (-307.268) (-309.051) (-308.716) -- 0:00:40
Average standard deviation of split frequencies: 0.010204
320500 -- (-308.503) [-309.360] (-308.139) (-307.963) * (-306.713) [-307.824] (-311.777) (-309.769) -- 0:00:40
321000 -- (-312.446) (-307.832) [-311.104] (-310.647) * (-309.789) [-307.572] (-311.681) (-310.812) -- 0:00:40
321500 -- (-306.747) [-308.708] (-309.901) (-308.282) * (-307.200) (-308.865) [-307.935] (-308.863) -- 0:00:40
322000 -- (-311.596) [-310.563] (-310.387) (-307.292) * (-308.121) [-309.207] (-306.961) (-307.990) -- 0:00:40
322500 -- (-311.733) [-308.563] (-309.191) (-309.382) * (-311.592) (-308.158) (-308.455) [-306.652] -- 0:00:39
323000 -- (-309.543) (-310.445) (-316.534) [-308.782] * (-313.113) (-310.219) (-308.480) [-306.841] -- 0:00:39
323500 -- [-311.191] (-311.297) (-307.355) (-311.557) * (-314.060) (-307.570) (-310.180) [-309.288] -- 0:00:39
324000 -- (-310.183) (-308.904) (-310.060) [-308.823] * (-308.072) (-307.072) (-309.027) [-309.141] -- 0:00:39
324500 -- [-308.228] (-310.907) (-309.109) (-309.400) * (-306.797) [-312.118] (-309.561) (-308.432) -- 0:00:39
325000 -- [-307.704] (-311.403) (-309.904) (-308.135) * [-310.097] (-309.790) (-310.060) (-306.699) -- 0:00:39
Average standard deviation of split frequencies: 0.009560
325500 -- (-314.934) (-313.111) [-308.407] (-306.804) * (-312.476) (-309.578) (-307.023) [-308.476] -- 0:00:41
326000 -- [-311.403] (-311.517) (-307.449) (-307.504) * [-311.366] (-308.228) (-310.107) (-311.703) -- 0:00:41
326500 -- (-310.959) (-308.238) [-310.417] (-308.075) * (-309.255) [-307.755] (-307.428) (-310.994) -- 0:00:41
327000 -- (-308.618) (-310.272) (-308.563) [-308.569] * (-307.395) (-308.839) [-308.932] (-306.908) -- 0:00:41
327500 -- (-307.937) (-309.244) (-309.299) [-307.835] * [-306.827] (-309.282) (-310.950) (-308.020) -- 0:00:41
328000 -- (-306.515) (-307.403) (-308.448) [-309.917] * (-308.138) (-307.261) [-307.925] (-307.919) -- 0:00:40
328500 -- [-309.630] (-308.599) (-313.077) (-306.830) * (-313.063) (-309.295) [-309.765] (-309.240) -- 0:00:40
329000 -- (-309.619) (-307.498) [-310.511] (-307.182) * (-308.444) [-306.828] (-310.006) (-308.048) -- 0:00:40
329500 -- (-308.021) (-308.068) (-307.467) [-308.000] * (-307.626) (-309.100) [-312.357] (-309.724) -- 0:00:40
330000 -- (-309.724) (-310.717) (-310.770) [-308.479] * (-311.330) (-307.733) (-309.753) [-308.313] -- 0:00:40
Average standard deviation of split frequencies: 0.010566
330500 -- (-310.631) (-307.133) (-309.211) [-308.731] * (-313.857) (-309.526) (-309.906) [-307.987] -- 0:00:40
331000 -- (-309.099) (-307.798) [-307.446] (-312.488) * (-310.914) (-310.543) (-308.724) [-310.485] -- 0:00:40
331500 -- (-308.298) [-307.173] (-309.508) (-307.952) * (-310.876) (-308.195) [-307.814] (-309.278) -- 0:00:40
332000 -- [-308.605] (-308.017) (-313.188) (-307.980) * (-312.108) (-308.761) [-309.619] (-306.790) -- 0:00:40
332500 -- (-307.722) [-307.826] (-307.408) (-313.997) * [-309.012] (-307.511) (-308.107) (-307.186) -- 0:00:40
333000 -- [-306.807] (-312.789) (-308.466) (-314.793) * (-308.364) (-307.319) (-310.076) [-309.072] -- 0:00:40
333500 -- [-308.376] (-307.316) (-308.928) (-315.286) * [-312.180] (-307.431) (-308.131) (-309.556) -- 0:00:39
334000 -- (-310.500) (-307.006) [-309.326] (-311.060) * (-313.010) [-306.461] (-309.083) (-310.008) -- 0:00:39
334500 -- (-315.477) (-307.575) (-308.954) [-308.578] * (-308.137) [-307.433] (-307.479) (-308.954) -- 0:00:39
335000 -- (-308.317) [-307.945] (-308.115) (-311.750) * (-308.127) (-307.257) (-306.927) [-307.924] -- 0:00:39
Average standard deviation of split frequencies: 0.009656
335500 -- (-311.039) (-306.473) (-309.522) [-308.441] * (-309.797) (-308.872) (-306.848) [-308.999] -- 0:00:39
336000 -- [-309.781] (-307.617) (-314.137) (-309.670) * [-310.796] (-309.334) (-306.695) (-308.408) -- 0:00:39
336500 -- [-311.070] (-309.234) (-311.689) (-313.375) * (-311.568) (-307.161) (-308.426) [-306.791] -- 0:00:39
337000 -- (-309.958) (-308.265) [-307.494] (-310.285) * (-309.701) (-308.840) [-306.512] (-308.615) -- 0:00:39
337500 -- (-308.013) (-312.199) [-308.815] (-309.550) * [-308.514] (-309.987) (-312.165) (-309.914) -- 0:00:39
338000 -- (-307.432) (-310.852) (-307.890) [-310.270] * (-307.598) [-315.013] (-310.373) (-309.350) -- 0:00:39
338500 -- (-309.335) [-307.556] (-307.335) (-312.925) * (-308.559) (-310.577) (-306.900) [-308.348] -- 0:00:39
339000 -- [-310.474] (-307.484) (-312.994) (-315.463) * (-308.487) (-308.893) [-308.187] (-307.928) -- 0:00:38
339500 -- [-307.288] (-308.996) (-308.248) (-314.822) * (-311.846) (-307.609) [-308.430] (-307.786) -- 0:00:38
340000 -- (-309.118) (-307.699) (-307.858) [-309.741] * (-310.615) (-308.319) [-309.413] (-306.710) -- 0:00:38
Average standard deviation of split frequencies: 0.009456
340500 -- [-313.884] (-307.087) (-308.473) (-308.774) * (-309.812) [-306.609] (-306.583) (-309.873) -- 0:00:38
341000 -- (-310.854) [-307.756] (-308.706) (-309.922) * (-309.877) (-310.096) [-307.181] (-310.222) -- 0:00:38
341500 -- (-308.113) (-310.732) [-310.361] (-307.997) * (-309.514) (-312.831) [-307.015] (-308.144) -- 0:00:38
342000 -- [-307.398] (-308.779) (-308.625) (-307.112) * (-308.073) (-312.381) [-307.399] (-310.597) -- 0:00:38
342500 -- (-307.673) (-307.842) [-307.262] (-307.144) * (-307.129) (-313.527) (-307.405) [-312.241] -- 0:00:40
343000 -- [-311.896] (-312.021) (-307.389) (-308.837) * [-311.512] (-309.716) (-307.292) (-310.071) -- 0:00:40
343500 -- (-308.571) (-306.704) (-308.314) [-308.682] * (-309.764) (-312.792) [-307.190] (-307.890) -- 0:00:40
344000 -- (-308.772) (-306.642) (-308.440) [-312.794] * (-307.806) [-308.797] (-309.627) (-307.611) -- 0:00:40
344500 -- (-312.632) [-307.366] (-307.494) (-306.886) * (-308.353) (-311.785) [-315.686] (-306.793) -- 0:00:39
345000 -- (-310.247) (-307.838) [-306.978] (-308.058) * (-308.362) (-311.271) (-321.659) [-307.561] -- 0:00:39
Average standard deviation of split frequencies: 0.008856
345500 -- [-307.953] (-313.599) (-311.335) (-308.014) * [-308.241] (-309.761) (-308.839) (-308.011) -- 0:00:39
346000 -- [-310.808] (-308.336) (-311.913) (-308.235) * [-308.986] (-308.295) (-310.144) (-310.152) -- 0:00:39
346500 -- (-310.763) (-311.119) [-309.075] (-312.639) * (-307.273) [-307.070] (-306.934) (-307.872) -- 0:00:39
347000 -- (-312.807) (-307.745) [-307.813] (-308.287) * [-307.562] (-306.627) (-309.060) (-310.270) -- 0:00:39
347500 -- (-310.277) [-307.785] (-308.653) (-310.829) * (-308.354) (-311.839) [-306.708] (-307.476) -- 0:00:39
348000 -- [-310.462] (-310.480) (-308.272) (-309.293) * (-307.398) (-308.050) (-307.062) [-307.500] -- 0:00:39
348500 -- (-307.330) [-308.422] (-311.135) (-307.349) * (-306.548) (-313.999) (-310.322) [-308.105] -- 0:00:39
349000 -- [-307.944] (-306.852) (-310.048) (-307.345) * (-308.739) [-308.493] (-309.560) (-308.302) -- 0:00:39
349500 -- (-308.836) (-307.910) [-310.412] (-307.483) * (-309.502) [-307.154] (-308.088) (-310.705) -- 0:00:39
350000 -- [-309.409] (-307.626) (-310.287) (-308.638) * (-315.716) [-307.423] (-308.376) (-308.164) -- 0:00:39
Average standard deviation of split frequencies: 0.008290
350500 -- [-308.028] (-308.502) (-310.184) (-311.040) * [-312.955] (-308.510) (-306.860) (-307.982) -- 0:00:38
351000 -- [-307.316] (-307.313) (-310.517) (-308.667) * [-308.565] (-309.112) (-307.921) (-308.250) -- 0:00:38
351500 -- [-309.154] (-311.319) (-308.839) (-307.843) * (-310.602) (-307.364) (-311.261) [-308.415] -- 0:00:38
352000 -- (-310.391) (-307.604) (-309.542) [-308.234] * [-310.828] (-308.803) (-308.137) (-308.886) -- 0:00:38
352500 -- (-311.875) (-308.174) (-308.644) [-306.610] * (-308.827) [-307.319] (-308.647) (-307.424) -- 0:00:38
353000 -- (-311.022) (-307.902) (-309.360) [-307.325] * (-307.920) [-308.833] (-306.592) (-314.435) -- 0:00:38
353500 -- (-312.894) (-310.087) (-307.677) [-307.259] * (-308.394) (-309.022) [-308.749] (-309.553) -- 0:00:38
354000 -- (-312.776) (-309.244) (-306.714) [-307.636] * (-307.165) [-308.372] (-308.532) (-309.851) -- 0:00:38
354500 -- (-310.014) (-308.148) [-308.192] (-308.234) * (-311.173) (-309.399) [-309.031] (-311.347) -- 0:00:38
355000 -- (-311.232) [-308.281] (-306.894) (-307.167) * (-311.651) [-307.885] (-311.970) (-307.580) -- 0:00:38
Average standard deviation of split frequencies: 0.008334
355500 -- (-310.213) [-307.972] (-307.165) (-307.953) * (-314.007) (-312.046) (-311.137) [-307.635] -- 0:00:38
356000 -- (-307.956) (-311.408) (-307.148) [-309.060] * [-307.339] (-306.739) (-308.614) (-308.455) -- 0:00:39
356500 -- (-309.730) (-310.531) (-307.466) [-307.576] * (-310.677) (-307.356) [-307.848] (-308.452) -- 0:00:39
357000 -- (-307.465) (-308.880) (-311.146) [-309.550] * (-310.224) (-308.414) [-307.420] (-308.734) -- 0:00:39
357500 -- [-309.892] (-306.896) (-311.309) (-309.514) * (-307.766) (-310.578) [-310.143] (-307.570) -- 0:00:39
358000 -- (-308.110) (-307.066) [-309.279] (-306.597) * (-307.207) (-307.141) (-308.548) [-307.010] -- 0:00:39
358500 -- (-307.802) (-309.345) (-310.059) [-308.363] * [-306.930] (-308.444) (-308.295) (-308.166) -- 0:00:39
359000 -- (-308.418) [-307.185] (-307.660) (-308.126) * (-306.971) (-314.349) [-307.844] (-312.400) -- 0:00:39
359500 -- (-307.468) [-307.451] (-308.500) (-307.680) * (-308.912) (-308.910) (-308.165) [-308.517] -- 0:00:39
360000 -- [-308.233] (-307.618) (-306.909) (-308.386) * (-313.171) (-309.919) [-311.484] (-308.581) -- 0:00:39
Average standard deviation of split frequencies: 0.008457
360500 -- (-307.268) (-310.401) (-309.361) [-308.429] * [-308.101] (-309.834) (-308.278) (-308.485) -- 0:00:39
361000 -- (-308.141) (-308.032) (-311.476) [-306.796] * (-312.068) [-307.404] (-311.119) (-307.640) -- 0:00:38
361500 -- (-308.524) (-310.262) [-306.966] (-308.390) * [-309.583] (-307.346) (-310.298) (-307.262) -- 0:00:38
362000 -- (-313.331) [-309.621] (-308.016) (-311.091) * (-308.071) [-309.740] (-309.370) (-308.968) -- 0:00:38
362500 -- [-311.056] (-314.115) (-309.727) (-311.006) * (-309.884) (-310.009) (-313.455) [-310.938] -- 0:00:38
363000 -- [-307.614] (-307.787) (-310.885) (-315.189) * (-310.879) (-308.003) (-307.261) [-308.794] -- 0:00:38
363500 -- (-309.859) (-315.212) (-310.477) [-311.680] * (-307.388) [-306.921] (-306.632) (-314.406) -- 0:00:38
364000 -- [-312.370] (-311.395) (-311.103) (-310.292) * [-306.924] (-308.906) (-310.567) (-307.430) -- 0:00:38
364500 -- (-314.208) [-311.163] (-311.071) (-306.456) * (-310.376) [-306.849] (-307.945) (-307.065) -- 0:00:38
365000 -- (-311.350) [-308.334] (-308.988) (-308.563) * [-309.883] (-308.026) (-309.157) (-311.110) -- 0:00:38
Average standard deviation of split frequencies: 0.009319
365500 -- [-306.835] (-306.879) (-308.643) (-312.643) * [-308.177] (-308.115) (-310.684) (-309.862) -- 0:00:38
366000 -- [-309.065] (-309.192) (-308.000) (-312.725) * (-309.670) [-309.503] (-309.129) (-308.688) -- 0:00:38
366500 -- (-309.308) [-308.432] (-309.324) (-307.992) * (-307.566) (-307.568) (-315.868) [-308.309] -- 0:00:38
367000 -- (-308.103) (-309.164) (-308.369) [-307.557] * (-311.125) (-309.318) [-308.907] (-313.541) -- 0:00:37
367500 -- [-307.438] (-308.681) (-307.431) (-307.039) * (-307.323) [-312.223] (-309.703) (-308.636) -- 0:00:37
368000 -- (-311.946) (-308.905) [-308.333] (-308.363) * (-309.736) [-308.015] (-309.495) (-308.171) -- 0:00:37
368500 -- (-311.940) [-307.093] (-312.116) (-308.077) * (-307.448) [-308.022] (-307.549) (-308.132) -- 0:00:37
369000 -- [-307.815] (-307.003) (-312.966) (-307.470) * (-307.142) (-309.718) [-307.908] (-307.008) -- 0:00:37
369500 -- (-308.731) (-306.869) (-313.653) [-307.017] * (-308.212) (-307.168) [-309.466] (-313.145) -- 0:00:37
370000 -- (-308.544) (-312.347) (-308.158) [-307.684] * (-310.715) (-308.000) (-311.139) [-313.633] -- 0:00:37
Average standard deviation of split frequencies: 0.009276
370500 -- (-309.502) (-308.616) [-309.226] (-310.650) * (-307.394) (-307.736) [-309.425] (-307.166) -- 0:00:37
371000 -- (-308.330) (-309.006) (-310.542) [-310.428] * [-307.921] (-308.334) (-309.913) (-307.732) -- 0:00:37
371500 -- (-309.117) [-308.030] (-308.994) (-309.932) * [-307.333] (-307.243) (-309.438) (-309.176) -- 0:00:37
372000 -- (-310.098) (-311.348) [-312.810] (-309.228) * [-306.331] (-311.279) (-313.054) (-307.168) -- 0:00:37
372500 -- (-307.541) (-307.216) (-312.806) [-307.670] * (-308.509) (-313.384) (-312.134) [-307.378] -- 0:00:37
373000 -- [-308.038] (-308.781) (-307.958) (-307.688) * [-307.753] (-312.159) (-309.214) (-308.863) -- 0:00:38
373500 -- (-309.991) (-307.574) (-307.481) [-310.198] * (-308.805) (-309.980) [-308.934] (-308.478) -- 0:00:38
374000 -- (-309.869) (-308.473) [-306.896] (-311.423) * [-308.447] (-307.496) (-307.598) (-308.758) -- 0:00:38
374500 -- (-307.730) (-311.635) [-311.066] (-308.507) * (-307.049) (-309.143) [-308.919] (-307.961) -- 0:00:38
375000 -- (-309.683) [-310.460] (-306.948) (-309.065) * (-309.927) [-310.934] (-308.465) (-308.429) -- 0:00:38
Average standard deviation of split frequencies: 0.009956
375500 -- (-308.177) [-307.834] (-310.143) (-310.673) * (-308.595) (-307.444) (-309.025) [-308.772] -- 0:00:38
376000 -- (-310.014) (-306.968) [-307.397] (-306.963) * [-308.276] (-309.883) (-309.260) (-307.619) -- 0:00:38
376500 -- (-308.119) [-306.777] (-308.810) (-307.930) * (-309.695) [-308.934] (-309.167) (-308.242) -- 0:00:38
377000 -- (-308.156) [-310.050] (-308.968) (-309.816) * (-308.025) (-309.185) [-312.256] (-308.786) -- 0:00:38
377500 -- (-309.704) (-308.544) [-307.600] (-309.480) * [-309.788] (-306.974) (-310.712) (-309.047) -- 0:00:37
378000 -- (-311.209) (-308.833) [-306.818] (-307.304) * (-307.415) (-309.575) [-309.245] (-310.718) -- 0:00:37
378500 -- [-310.961] (-311.603) (-309.224) (-308.053) * (-306.680) (-307.562) (-309.017) [-311.603] -- 0:00:37
379000 -- (-309.582) (-308.928) (-311.029) [-309.082] * (-309.833) (-306.792) (-307.429) [-306.734] -- 0:00:37
379500 -- (-319.062) (-312.074) (-308.449) [-310.865] * (-309.068) [-310.585] (-307.996) (-311.879) -- 0:00:37
380000 -- (-308.667) (-308.485) (-307.718) [-308.724] * (-310.832) (-306.739) (-307.923) [-308.539] -- 0:00:37
Average standard deviation of split frequencies: 0.010271
380500 -- (-311.545) (-308.967) (-307.215) [-308.089] * (-309.846) (-310.474) (-308.056) [-308.361] -- 0:00:37
381000 -- (-311.183) (-307.579) (-307.946) [-307.940] * (-312.595) (-308.564) (-307.195) [-307.339] -- 0:00:37
381500 -- [-307.958] (-310.282) (-312.143) (-310.175) * (-307.279) (-308.036) (-307.139) [-308.011] -- 0:00:37
382000 -- [-307.596] (-313.412) (-311.067) (-308.354) * (-309.715) (-308.654) (-319.274) [-309.169] -- 0:00:37
382500 -- (-308.195) (-308.063) [-306.991] (-308.209) * [-307.794] (-311.721) (-308.848) (-307.775) -- 0:00:37
383000 -- (-307.968) [-307.761] (-309.078) (-310.046) * (-311.223) (-309.694) [-308.413] (-312.375) -- 0:00:37
383500 -- (-310.155) (-309.630) [-308.927] (-309.916) * (-310.453) [-310.599] (-308.177) (-307.623) -- 0:00:36
384000 -- (-312.656) [-309.685] (-308.087) (-307.989) * [-309.829] (-308.040) (-311.535) (-307.807) -- 0:00:36
384500 -- (-309.409) [-308.131] (-309.121) (-307.490) * (-307.463) [-307.391] (-308.324) (-308.917) -- 0:00:36
385000 -- (-309.831) (-309.968) [-308.595] (-307.924) * (-308.428) [-307.654] (-306.691) (-308.268) -- 0:00:36
Average standard deviation of split frequencies: 0.009842
385500 -- (-308.094) (-308.623) (-308.768) [-309.003] * (-308.900) [-308.504] (-309.202) (-307.840) -- 0:00:36
386000 -- (-308.679) (-310.331) [-309.075] (-313.221) * (-309.173) [-309.429] (-310.731) (-310.233) -- 0:00:36
386500 -- (-311.400) [-306.689] (-311.066) (-307.756) * (-307.937) (-314.890) [-307.778] (-309.270) -- 0:00:36
387000 -- (-309.443) (-307.601) [-307.499] (-307.395) * (-307.383) (-311.724) (-308.387) [-307.505] -- 0:00:36
387500 -- (-307.251) [-307.698] (-307.730) (-308.604) * (-308.925) (-319.127) (-309.758) [-315.399] -- 0:00:36
388000 -- [-313.034] (-306.660) (-309.374) (-308.310) * (-306.595) [-311.080] (-310.234) (-308.725) -- 0:00:36
388500 -- (-310.097) (-310.853) [-307.389] (-308.070) * [-307.909] (-310.786) (-307.926) (-311.686) -- 0:00:36
389000 -- (-310.509) [-309.651] (-310.312) (-307.446) * (-310.607) [-314.516] (-306.844) (-311.993) -- 0:00:36
389500 -- [-308.984] (-309.506) (-307.710) (-307.882) * (-312.193) (-307.758) (-306.663) [-308.443] -- 0:00:36
390000 -- (-309.505) (-309.400) (-308.492) [-308.707] * (-309.290) [-309.211] (-308.098) (-307.699) -- 0:00:37
Average standard deviation of split frequencies: 0.009085
390500 -- [-311.475] (-312.738) (-310.374) (-311.701) * (-307.649) (-309.775) (-309.162) [-308.304] -- 0:00:37
391000 -- (-313.744) (-310.396) [-308.169] (-309.906) * [-315.673] (-310.374) (-311.197) (-308.403) -- 0:00:37
391500 -- (-312.511) (-309.583) (-308.701) [-309.358] * (-312.182) [-307.180] (-311.380) (-310.216) -- 0:00:37
392000 -- [-310.259] (-311.366) (-308.016) (-308.137) * (-311.365) [-309.181] (-308.746) (-311.563) -- 0:00:37
392500 -- (-308.253) (-307.912) [-307.068] (-308.468) * [-307.818] (-308.812) (-308.534) (-312.398) -- 0:00:37
393000 -- (-307.546) [-306.673] (-307.779) (-310.262) * [-308.883] (-308.979) (-308.158) (-311.513) -- 0:00:37
393500 -- [-308.127] (-308.548) (-308.577) (-307.962) * (-310.257) (-310.994) (-308.840) [-306.980] -- 0:00:36
394000 -- (-307.851) (-309.227) (-309.707) [-307.974] * (-307.954) [-311.118] (-307.942) (-307.101) -- 0:00:36
394500 -- [-307.965] (-308.810) (-309.103) (-309.173) * (-310.183) [-309.244] (-308.403) (-306.688) -- 0:00:36
395000 -- (-313.589) [-311.511] (-310.902) (-310.293) * (-309.550) [-308.500] (-307.729) (-307.828) -- 0:00:36
Average standard deviation of split frequencies: 0.009663
395500 -- (-313.013) [-309.179] (-310.442) (-310.316) * (-308.319) (-307.499) (-310.400) [-309.007] -- 0:00:36
396000 -- (-310.711) [-317.197] (-310.619) (-308.166) * (-308.329) [-308.008] (-307.766) (-319.437) -- 0:00:36
396500 -- (-310.361) (-310.963) [-308.501] (-309.219) * (-309.255) (-311.695) (-307.180) [-308.321] -- 0:00:36
397000 -- [-308.833] (-309.167) (-310.739) (-309.006) * (-309.205) [-309.663] (-306.572) (-311.918) -- 0:00:36
397500 -- (-312.249) [-306.944] (-307.073) (-308.618) * (-309.047) (-309.876) [-309.392] (-309.242) -- 0:00:36
398000 -- (-308.702) (-307.220) (-306.816) [-308.319] * (-307.929) [-307.293] (-308.033) (-308.713) -- 0:00:36
398500 -- [-308.325] (-309.104) (-306.515) (-310.194) * (-308.917) (-308.156) [-309.273] (-307.984) -- 0:00:36
399000 -- [-307.285] (-309.085) (-309.313) (-308.074) * (-307.668) [-307.438] (-307.948) (-307.985) -- 0:00:36
399500 -- (-308.794) (-308.800) [-307.320] (-310.632) * (-307.807) [-307.362] (-312.943) (-307.709) -- 0:00:36
400000 -- (-314.846) [-312.712] (-312.573) (-308.242) * (-310.762) (-307.298) [-312.224] (-307.345) -- 0:00:36
Average standard deviation of split frequencies: 0.009689
400500 -- (-309.420) (-310.517) (-309.980) [-308.368] * (-306.929) [-307.281] (-312.412) (-310.321) -- 0:00:35
401000 -- (-306.941) (-308.486) (-308.329) [-309.617] * (-306.658) (-310.959) (-312.977) [-306.893] -- 0:00:35
401500 -- [-308.697] (-309.605) (-309.242) (-308.270) * (-306.879) [-311.095] (-310.720) (-309.030) -- 0:00:35
402000 -- (-307.106) (-308.929) (-307.585) [-309.072] * (-308.134) (-309.082) [-310.819] (-308.691) -- 0:00:35
402500 -- (-309.772) [-309.471] (-307.475) (-308.288) * (-308.005) (-307.637) (-309.232) [-308.098] -- 0:00:35
403000 -- (-310.573) [-307.774] (-307.215) (-317.693) * [-306.393] (-312.397) (-307.276) (-307.466) -- 0:00:35
403500 -- [-308.020] (-306.849) (-308.758) (-316.765) * (-308.277) (-311.446) (-308.149) [-307.851] -- 0:00:35
404000 -- (-308.390) (-306.982) [-308.371] (-312.840) * (-313.401) (-307.847) (-311.065) [-308.098] -- 0:00:35
404500 -- [-308.732] (-310.644) (-306.956) (-307.076) * (-309.454) (-311.516) (-307.798) [-307.420] -- 0:00:35
405000 -- (-310.922) [-313.945] (-309.164) (-306.426) * (-309.064) (-310.643) (-310.586) [-307.277] -- 0:00:35
Average standard deviation of split frequencies: 0.010040
405500 -- (-307.620) (-310.602) [-308.582] (-309.530) * (-310.061) [-310.469] (-309.660) (-310.859) -- 0:00:35
406000 -- (-309.080) (-309.553) [-308.120] (-309.775) * (-311.575) (-308.311) [-307.371] (-308.144) -- 0:00:35
406500 -- (-308.457) (-307.034) (-307.462) [-310.503] * (-309.875) (-310.880) [-308.244] (-308.083) -- 0:00:35
407000 -- (-307.326) (-311.060) (-309.188) [-307.681] * (-311.343) [-309.117] (-308.102) (-308.475) -- 0:00:36
407500 -- (-308.472) [-311.504] (-311.623) (-307.664) * (-307.459) (-308.711) (-307.867) [-307.079] -- 0:00:36
408000 -- (-307.006) (-307.885) [-310.867] (-308.800) * [-307.692] (-308.992) (-308.624) (-310.168) -- 0:00:36
408500 -- (-314.707) (-307.937) (-309.051) [-307.289] * (-308.603) (-308.294) [-309.852] (-308.731) -- 0:00:36
409000 -- (-311.263) (-307.441) (-308.262) [-308.064] * [-306.472] (-309.540) (-308.519) (-311.136) -- 0:00:36
409500 -- (-309.595) (-311.720) (-308.885) [-308.373] * (-308.591) (-307.788) [-310.043] (-307.922) -- 0:00:36
410000 -- [-309.478] (-309.183) (-309.021) (-307.734) * (-307.819) [-308.518] (-306.937) (-306.617) -- 0:00:35
Average standard deviation of split frequencies: 0.009993
410500 -- (-308.896) (-308.778) [-306.839] (-308.510) * (-309.759) [-310.580] (-308.464) (-312.082) -- 0:00:35
411000 -- (-311.706) (-309.947) [-311.495] (-309.976) * (-307.898) (-309.718) (-313.274) [-309.017] -- 0:00:35
411500 -- (-307.737) (-313.608) [-310.458] (-306.485) * (-310.160) (-312.452) (-307.900) [-307.265] -- 0:00:35
412000 -- [-307.832] (-314.318) (-307.812) (-310.565) * (-311.308) (-308.373) (-307.371) [-307.073] -- 0:00:35
412500 -- [-308.291] (-310.134) (-308.676) (-309.137) * (-310.606) (-315.524) (-308.191) [-308.876] -- 0:00:35
413000 -- (-310.588) (-307.049) [-307.267] (-310.326) * [-307.765] (-308.927) (-309.635) (-307.047) -- 0:00:35
413500 -- [-307.414] (-307.320) (-309.615) (-310.331) * (-307.813) (-307.450) (-307.437) [-307.858] -- 0:00:35
414000 -- (-309.562) (-310.514) [-308.258] (-307.814) * (-308.276) (-310.955) (-311.140) [-309.801] -- 0:00:35
414500 -- (-307.045) (-312.331) (-307.424) [-308.721] * (-307.828) (-306.550) [-308.144] (-309.842) -- 0:00:35
415000 -- (-310.595) (-307.839) [-307.069] (-313.424) * (-311.454) (-308.431) [-307.117] (-307.702) -- 0:00:35
Average standard deviation of split frequencies: 0.009999
415500 -- (-312.799) (-306.561) (-309.579) [-309.397] * (-309.111) (-307.600) (-307.618) [-307.166] -- 0:00:35
416000 -- [-308.874] (-309.611) (-309.197) (-311.959) * (-308.641) (-311.221) (-308.171) [-306.601] -- 0:00:35
416500 -- (-309.153) (-310.344) (-308.287) [-310.255] * [-311.351] (-308.454) (-308.787) (-307.851) -- 0:00:35
417000 -- (-308.714) (-309.472) (-307.860) [-308.161] * [-308.155] (-308.365) (-307.930) (-307.394) -- 0:00:34
417500 -- (-311.086) (-306.486) (-311.047) [-308.916] * [-306.536] (-310.625) (-306.843) (-310.963) -- 0:00:34
418000 -- (-310.115) (-309.914) (-310.471) [-307.472] * (-308.298) [-310.333] (-308.230) (-308.102) -- 0:00:34
418500 -- (-308.426) (-311.537) (-317.427) [-306.665] * (-310.286) (-307.595) (-307.178) [-310.350] -- 0:00:34
419000 -- (-306.916) [-311.779] (-311.922) (-308.177) * (-308.789) [-306.806] (-307.426) (-308.476) -- 0:00:34
419500 -- (-310.053) [-307.604] (-308.503) (-307.439) * (-307.267) [-308.315] (-309.097) (-308.462) -- 0:00:34
420000 -- (-310.600) [-306.944] (-309.384) (-308.216) * (-310.458) [-311.519] (-307.987) (-309.099) -- 0:00:34
Average standard deviation of split frequencies: 0.009954
420500 -- (-310.038) (-306.625) (-310.912) [-307.644] * [-310.091] (-308.177) (-306.953) (-308.666) -- 0:00:34
421000 -- (-309.524) (-307.091) (-306.867) [-308.604] * (-308.330) (-310.937) [-307.368] (-307.451) -- 0:00:34
421500 -- (-308.635) (-310.471) [-308.200] (-307.504) * (-308.402) [-310.285] (-310.102) (-307.079) -- 0:00:34
422000 -- (-309.105) (-309.468) [-310.267] (-306.875) * (-308.859) [-309.970] (-309.136) (-306.922) -- 0:00:34
422500 -- (-306.668) (-309.618) (-310.959) [-307.165] * (-308.970) (-307.062) [-307.898] (-308.711) -- 0:00:34
423000 -- [-310.924] (-307.952) (-306.857) (-309.103) * (-310.249) (-306.814) [-307.887] (-308.086) -- 0:00:34
423500 -- (-309.389) [-308.327] (-310.584) (-306.909) * (-309.165) [-309.057] (-310.536) (-307.886) -- 0:00:34
424000 -- (-310.119) [-308.014] (-310.185) (-310.180) * (-307.693) (-308.462) [-310.718] (-310.214) -- 0:00:35
424500 -- [-308.619] (-308.504) (-307.164) (-309.180) * (-308.685) [-308.014] (-309.339) (-307.038) -- 0:00:35
425000 -- (-306.921) [-308.881] (-310.835) (-310.532) * (-311.000) (-309.923) [-310.349] (-308.176) -- 0:00:35
Average standard deviation of split frequencies: 0.010089
425500 -- (-308.783) (-309.834) [-309.342] (-309.118) * (-308.269) (-308.152) [-309.861] (-309.051) -- 0:00:35
426000 -- (-312.641) (-308.865) (-312.760) [-308.665] * (-308.376) (-307.534) (-308.383) [-307.380] -- 0:00:35
426500 -- (-314.186) [-308.470] (-307.143) (-310.272) * (-307.930) (-307.555) (-308.602) [-307.996] -- 0:00:34
427000 -- (-309.830) (-307.668) [-307.609] (-309.310) * (-308.392) (-307.902) (-309.187) [-307.999] -- 0:00:34
427500 -- (-309.420) [-306.807] (-308.358) (-309.149) * [-308.274] (-308.242) (-309.346) (-309.122) -- 0:00:34
428000 -- (-308.003) (-306.321) [-312.469] (-307.280) * (-307.052) [-309.064] (-316.748) (-308.757) -- 0:00:34
428500 -- (-311.524) (-307.961) [-307.140] (-307.684) * (-309.734) (-309.406) [-307.985] (-308.341) -- 0:00:34
429000 -- (-309.012) (-306.695) (-306.809) [-308.490] * [-307.398] (-309.944) (-307.604) (-307.798) -- 0:00:34
429500 -- (-307.959) [-310.321] (-307.756) (-307.339) * (-309.299) (-308.789) (-308.192) [-307.149] -- 0:00:34
430000 -- [-307.626] (-307.625) (-309.599) (-308.463) * (-310.014) (-308.145) [-308.000] (-307.643) -- 0:00:34
Average standard deviation of split frequencies: 0.010109
430500 -- (-311.705) [-307.461] (-308.621) (-314.274) * (-308.013) [-309.697] (-307.290) (-308.427) -- 0:00:34
431000 -- (-310.234) [-310.640] (-309.153) (-310.107) * (-307.134) (-311.741) [-308.476] (-310.340) -- 0:00:34
431500 -- [-309.122] (-309.036) (-306.571) (-310.233) * (-308.249) [-310.004] (-307.355) (-306.812) -- 0:00:34
432000 -- (-307.752) (-307.602) [-309.224] (-308.667) * (-306.461) (-310.919) [-307.661] (-307.698) -- 0:00:34
432500 -- (-306.810) [-308.807] (-308.518) (-309.986) * (-308.067) (-308.287) [-306.847] (-309.693) -- 0:00:34
433000 -- (-312.150) (-309.569) (-307.371) [-309.532] * [-310.967] (-307.477) (-307.250) (-307.837) -- 0:00:34
433500 -- (-308.797) (-310.427) (-307.177) [-308.681] * [-311.680] (-310.691) (-307.981) (-308.729) -- 0:00:33
434000 -- (-308.461) (-312.303) [-308.431] (-309.708) * (-309.976) (-309.305) [-308.968] (-310.611) -- 0:00:33
434500 -- [-307.416] (-308.710) (-307.227) (-309.646) * (-308.095) (-308.486) (-307.946) [-307.977] -- 0:00:33
435000 -- (-307.430) (-310.092) (-307.669) [-308.610] * (-309.362) (-308.392) (-309.362) [-307.061] -- 0:00:33
Average standard deviation of split frequencies: 0.010367
435500 -- (-307.532) (-310.862) [-307.701] (-311.644) * (-309.198) (-307.901) (-308.479) [-309.725] -- 0:00:33
436000 -- [-306.857] (-307.633) (-308.982) (-308.435) * [-307.458] (-311.584) (-311.267) (-307.902) -- 0:00:33
436500 -- (-307.000) (-310.384) [-306.708] (-311.480) * (-306.668) (-308.806) (-307.988) [-306.677] -- 0:00:33
437000 -- [-308.280] (-310.317) (-307.313) (-307.352) * (-308.073) [-309.217] (-307.263) (-307.508) -- 0:00:33
437500 -- [-308.564] (-309.943) (-307.973) (-307.305) * [-308.724] (-308.744) (-314.399) (-307.616) -- 0:00:33
438000 -- (-309.337) (-308.322) [-313.190] (-311.509) * (-307.919) [-310.590] (-308.457) (-307.361) -- 0:00:33
438500 -- (-309.157) (-310.618) [-309.745] (-311.164) * [-313.235] (-307.738) (-308.822) (-308.300) -- 0:00:33
439000 -- (-309.347) (-310.622) [-308.598] (-313.809) * (-310.218) (-311.189) [-307.173] (-311.021) -- 0:00:33
439500 -- (-307.113) (-306.748) [-308.040] (-308.461) * (-309.107) (-307.882) [-306.502] (-308.503) -- 0:00:33
440000 -- (-307.618) [-308.262] (-307.354) (-308.064) * (-309.929) (-308.376) (-306.867) [-308.793] -- 0:00:33
Average standard deviation of split frequencies: 0.009942
440500 -- (-311.365) [-308.619] (-310.420) (-307.881) * [-309.060] (-308.924) (-310.079) (-309.205) -- 0:00:33
441000 -- [-307.242] (-310.367) (-309.533) (-310.088) * (-308.680) (-311.343) [-310.333] (-310.041) -- 0:00:34
441500 -- (-307.524) [-308.060] (-309.843) (-307.489) * (-308.420) (-306.951) (-308.220) [-309.857] -- 0:00:34
442000 -- (-307.032) [-310.583] (-308.704) (-308.763) * (-308.192) (-306.631) (-307.309) [-311.390] -- 0:00:34
442500 -- (-308.140) [-308.602] (-310.814) (-307.992) * (-309.461) (-306.836) [-308.518] (-307.744) -- 0:00:34
443000 -- (-308.404) (-307.265) [-307.111] (-308.728) * (-306.984) (-306.602) (-307.249) [-309.226] -- 0:00:33
443500 -- (-308.641) [-310.680] (-309.818) (-308.038) * (-308.857) [-307.015] (-306.887) (-312.159) -- 0:00:33
444000 -- [-310.593] (-307.623) (-309.286) (-306.648) * (-309.642) (-307.174) [-309.143] (-308.223) -- 0:00:33
444500 -- (-309.964) (-306.761) (-307.906) [-310.626] * (-310.902) (-307.070) [-311.997] (-308.992) -- 0:00:33
445000 -- (-308.650) (-307.728) (-308.682) [-309.002] * (-309.773) [-308.511] (-310.262) (-307.073) -- 0:00:33
Average standard deviation of split frequencies: 0.010197
445500 -- (-307.829) [-309.615] (-308.732) (-307.850) * [-308.722] (-307.412) (-309.338) (-308.743) -- 0:00:33
446000 -- (-310.176) (-311.941) [-310.853] (-308.277) * (-311.766) (-311.325) [-307.482] (-307.934) -- 0:00:33
446500 -- [-309.028] (-308.345) (-310.120) (-308.343) * (-309.447) (-309.558) (-306.971) [-307.702] -- 0:00:33
447000 -- (-310.616) (-311.167) (-310.944) [-310.384] * [-307.101] (-311.443) (-308.019) (-309.040) -- 0:00:33
447500 -- [-307.730] (-311.404) (-308.186) (-307.343) * (-308.392) (-313.338) [-311.790] (-307.316) -- 0:00:33
448000 -- (-310.064) [-309.710] (-308.198) (-308.392) * [-309.120] (-310.094) (-308.113) (-308.590) -- 0:00:33
448500 -- (-313.007) [-307.137] (-311.312) (-306.748) * (-311.268) [-309.046] (-313.196) (-308.412) -- 0:00:33
449000 -- (-307.981) (-308.573) [-312.157] (-307.726) * (-308.067) [-307.917] (-309.573) (-311.573) -- 0:00:33
449500 -- (-308.517) [-306.975] (-309.187) (-308.943) * (-309.842) (-311.279) [-307.638] (-308.758) -- 0:00:33
450000 -- (-309.884) (-310.948) [-309.512] (-307.364) * (-309.021) (-309.045) (-307.020) [-307.816] -- 0:00:33
Average standard deviation of split frequencies: 0.009783
450500 -- (-311.453) (-308.679) (-308.200) [-309.339] * [-309.676] (-309.980) (-306.788) (-310.556) -- 0:00:32
451000 -- (-306.893) (-306.833) [-311.671] (-311.576) * (-307.200) (-307.666) [-308.294] (-311.010) -- 0:00:32
451500 -- (-307.848) (-307.871) (-313.299) [-309.552] * (-308.590) [-310.515] (-308.615) (-307.854) -- 0:00:32
452000 -- (-311.949) (-310.292) [-308.219] (-309.807) * (-312.782) (-307.145) [-308.509] (-310.335) -- 0:00:32
452500 -- (-308.217) (-308.606) [-310.402] (-309.005) * [-309.075] (-308.528) (-310.596) (-314.876) -- 0:00:32
453000 -- (-309.139) (-307.840) (-309.273) [-307.627] * (-307.545) (-309.433) [-307.157] (-312.024) -- 0:00:32
453500 -- (-307.836) [-307.711] (-310.863) (-307.078) * [-307.438] (-308.266) (-309.111) (-307.849) -- 0:00:32
454000 -- [-308.192] (-308.070) (-308.591) (-308.396) * (-308.153) (-307.884) (-309.583) [-307.721] -- 0:00:32
454500 -- (-313.616) (-307.260) (-308.845) [-307.774] * (-307.724) (-307.027) [-307.747] (-307.745) -- 0:00:32
455000 -- (-309.841) [-308.621] (-307.838) (-308.883) * [-306.906] (-308.672) (-309.798) (-311.230) -- 0:00:32
Average standard deviation of split frequencies: 0.009669
455500 -- (-308.762) [-308.002] (-309.063) (-306.662) * (-308.328) (-309.031) [-311.283] (-307.986) -- 0:00:32
456000 -- (-307.397) [-306.789] (-307.999) (-307.905) * (-306.927) (-306.494) (-314.919) [-309.873] -- 0:00:32
456500 -- (-309.163) (-307.486) (-307.132) [-309.476] * [-306.934] (-306.408) (-314.046) (-308.769) -- 0:00:32
457000 -- [-308.879] (-309.991) (-307.844) (-309.780) * (-308.231) (-306.897) (-306.396) [-308.008] -- 0:00:32
457500 -- (-308.337) [-308.669] (-308.713) (-310.577) * [-307.358] (-306.608) (-310.554) (-307.408) -- 0:00:32
458000 -- (-307.731) (-308.058) [-311.303] (-313.122) * (-319.196) (-308.332) [-311.466] (-307.234) -- 0:00:33
458500 -- (-306.485) (-307.943) (-307.871) [-309.319] * (-313.705) (-307.229) (-313.409) [-306.804] -- 0:00:33
459000 -- (-309.449) (-311.878) (-307.628) [-308.668] * (-307.550) (-310.738) (-307.533) [-307.064] -- 0:00:33
459500 -- (-311.534) (-311.467) [-310.516] (-307.037) * [-307.249] (-307.542) (-306.606) (-310.564) -- 0:00:32
460000 -- (-310.053) (-308.585) (-306.912) [-308.756] * (-307.414) (-307.473) (-307.622) [-309.516] -- 0:00:32
Average standard deviation of split frequencies: 0.009330
460500 -- (-307.884) (-307.871) (-307.326) [-307.174] * (-309.170) [-308.204] (-307.891) (-306.620) -- 0:00:32
461000 -- (-308.809) (-309.304) [-309.768] (-307.652) * (-308.501) [-308.253] (-306.905) (-309.212) -- 0:00:32
461500 -- (-307.731) (-307.552) (-308.159) [-308.391] * (-308.293) (-307.165) (-307.469) [-312.278] -- 0:00:32
462000 -- [-308.979] (-309.588) (-307.732) (-308.925) * (-311.847) (-310.725) (-306.965) [-309.705] -- 0:00:32
462500 -- (-311.856) [-307.993] (-308.919) (-307.178) * [-308.159] (-308.773) (-308.700) (-306.977) -- 0:00:32
463000 -- (-308.107) (-308.470) [-309.040] (-311.457) * (-307.316) [-309.011] (-310.782) (-308.514) -- 0:00:32
463500 -- (-306.879) (-308.730) (-313.315) [-307.232] * (-308.589) (-310.000) [-309.827] (-309.320) -- 0:00:32
464000 -- (-309.362) (-308.263) [-307.629] (-307.406) * (-308.834) (-308.958) [-308.897] (-309.192) -- 0:00:32
464500 -- (-307.007) (-309.353) [-309.270] (-306.922) * (-307.316) (-309.430) [-309.883] (-309.057) -- 0:00:32
465000 -- (-309.071) (-309.209) (-306.891) [-306.945] * (-308.627) [-308.252] (-316.183) (-310.251) -- 0:00:32
Average standard deviation of split frequencies: 0.009342
465500 -- [-309.008] (-306.972) (-306.908) (-308.632) * (-308.214) (-309.073) [-307.831] (-309.467) -- 0:00:32
466000 -- (-310.269) [-309.843] (-310.644) (-308.777) * (-312.205) [-306.731] (-309.097) (-308.727) -- 0:00:32
466500 -- (-309.101) (-309.143) (-310.367) [-306.582] * (-308.631) (-307.828) [-308.469] (-311.045) -- 0:00:32
467000 -- [-308.154] (-307.378) (-310.490) (-306.566) * (-309.078) [-308.985] (-309.432) (-310.203) -- 0:00:31
467500 -- (-308.059) (-308.090) (-307.390) [-307.190] * (-311.215) [-308.398] (-309.476) (-309.197) -- 0:00:31
468000 -- (-308.362) (-310.668) (-308.988) [-307.964] * (-309.389) (-309.832) (-307.236) [-306.964] -- 0:00:31
468500 -- [-308.063] (-310.719) (-308.608) (-311.021) * (-314.902) (-310.344) (-309.428) [-308.753] -- 0:00:31
469000 -- (-306.803) (-313.156) (-310.914) [-308.976] * [-309.329] (-310.182) (-307.366) (-306.888) -- 0:00:31
469500 -- (-308.519) (-309.898) [-307.635] (-308.658) * (-309.104) (-310.661) (-308.235) [-306.963] -- 0:00:31
470000 -- [-306.905] (-306.604) (-310.689) (-308.990) * (-308.583) (-311.896) [-306.684] (-309.870) -- 0:00:31
Average standard deviation of split frequencies: 0.009452
470500 -- (-307.547) (-308.797) [-309.603] (-308.755) * (-313.968) (-307.708) (-307.434) [-307.560] -- 0:00:31
471000 -- (-308.036) (-308.601) [-310.960] (-307.538) * [-310.553] (-308.451) (-312.570) (-307.385) -- 0:00:31
471500 -- (-309.746) (-306.702) [-310.752] (-309.080) * (-313.901) (-307.415) (-314.207) [-307.719] -- 0:00:31
472000 -- (-308.982) (-309.050) (-309.479) [-309.314] * (-309.629) [-309.678] (-307.703) (-308.704) -- 0:00:31
472500 -- (-311.186) (-306.676) (-312.447) [-307.841] * (-311.041) [-307.150] (-309.941) (-308.522) -- 0:00:31
473000 -- (-307.784) [-307.465] (-310.495) (-307.186) * (-311.875) (-308.955) (-308.246) [-310.871] -- 0:00:31
473500 -- (-306.785) [-309.210] (-309.852) (-311.462) * (-309.497) [-308.572] (-309.289) (-309.186) -- 0:00:31
474000 -- [-311.278] (-309.636) (-308.119) (-307.286) * (-306.525) (-307.458) [-308.613] (-308.585) -- 0:00:31
474500 -- [-306.997] (-307.116) (-307.306) (-307.191) * [-309.532] (-308.044) (-310.751) (-308.114) -- 0:00:31
475000 -- (-308.779) (-308.786) [-306.278] (-307.184) * (-311.795) (-308.490) [-308.464] (-311.673) -- 0:00:32
Average standard deviation of split frequencies: 0.008851
475500 -- (-308.328) [-308.017] (-307.614) (-308.967) * (-316.469) (-309.819) (-306.821) [-308.492] -- 0:00:31
476000 -- (-306.809) [-307.841] (-307.915) (-308.528) * (-308.972) (-310.850) [-307.858] (-308.923) -- 0:00:31
476500 -- (-309.044) [-307.884] (-309.487) (-307.643) * [-307.784] (-312.515) (-307.737) (-310.922) -- 0:00:31
477000 -- (-308.342) (-307.459) (-309.924) [-308.288] * (-307.022) [-311.041] (-310.715) (-311.441) -- 0:00:31
477500 -- (-312.210) (-308.215) [-307.905] (-307.494) * [-307.179] (-308.732) (-311.620) (-308.400) -- 0:00:31
478000 -- (-308.345) (-308.990) (-309.943) [-309.382] * [-309.244] (-308.206) (-309.439) (-307.392) -- 0:00:31
478500 -- (-307.582) (-307.441) (-311.578) [-306.977] * (-309.683) (-307.195) [-308.320] (-310.934) -- 0:00:31
479000 -- [-309.769] (-311.867) (-310.406) (-310.550) * (-309.540) (-307.209) [-307.185] (-311.650) -- 0:00:31
479500 -- [-310.580] (-310.430) (-309.719) (-308.531) * (-308.590) (-307.579) [-310.112] (-308.072) -- 0:00:31
480000 -- (-310.083) [-309.770] (-307.801) (-308.590) * [-306.524] (-308.138) (-307.726) (-309.919) -- 0:00:31
Average standard deviation of split frequencies: 0.008336
480500 -- [-308.724] (-313.595) (-308.858) (-308.236) * [-308.898] (-308.273) (-309.999) (-309.009) -- 0:00:31
481000 -- (-309.627) (-306.631) (-306.434) [-307.208] * (-309.859) (-308.384) [-309.231] (-311.037) -- 0:00:31
481500 -- (-307.771) (-309.134) [-307.692] (-309.482) * (-307.359) [-308.180] (-311.408) (-309.269) -- 0:00:31
482000 -- [-307.177] (-307.691) (-309.318) (-311.503) * (-308.086) [-311.504] (-309.164) (-311.653) -- 0:00:31
482500 -- [-308.763] (-307.083) (-307.839) (-309.651) * [-309.912] (-310.086) (-310.169) (-309.427) -- 0:00:31
483000 -- (-314.029) (-307.023) (-309.820) [-308.350] * (-308.791) (-306.792) (-310.171) [-311.703] -- 0:00:31
483500 -- (-307.651) [-308.715] (-308.223) (-311.546) * (-312.380) [-307.496] (-312.190) (-308.352) -- 0:00:30
484000 -- (-307.151) (-308.034) [-306.610] (-308.413) * (-308.284) [-310.176] (-310.258) (-309.379) -- 0:00:30
484500 -- (-310.269) (-306.703) [-306.706] (-310.515) * [-307.405] (-312.537) (-307.150) (-310.887) -- 0:00:30
485000 -- (-307.319) [-309.205] (-310.965) (-307.808) * (-307.313) [-307.825] (-308.001) (-312.910) -- 0:00:30
Average standard deviation of split frequencies: 0.008305
485500 -- (-307.979) [-310.026] (-308.186) (-308.197) * (-307.442) (-309.010) [-312.121] (-308.802) -- 0:00:30
486000 -- [-308.476] (-306.593) (-309.783) (-307.882) * [-309.713] (-309.072) (-307.552) (-309.973) -- 0:00:30
486500 -- [-306.558] (-307.651) (-309.693) (-308.953) * [-308.824] (-308.776) (-309.627) (-307.940) -- 0:00:30
487000 -- (-308.801) [-307.562] (-308.134) (-307.810) * (-307.634) (-310.085) (-312.209) [-307.151] -- 0:00:30
487500 -- [-308.652] (-312.406) (-311.492) (-308.741) * (-310.865) [-310.584] (-308.267) (-308.149) -- 0:00:30
488000 -- (-308.007) (-311.493) [-309.691] (-310.788) * (-308.280) [-308.531] (-309.097) (-307.003) -- 0:00:30
488500 -- (-310.793) (-310.970) (-309.051) [-310.414] * (-307.236) [-309.002] (-307.611) (-310.038) -- 0:00:30
489000 -- (-307.107) (-310.083) [-307.130] (-307.736) * (-314.492) (-309.867) (-307.040) [-308.506] -- 0:00:30
489500 -- (-307.987) (-308.605) [-308.985] (-306.789) * (-309.922) (-308.947) (-306.659) [-309.920] -- 0:00:30
490000 -- (-307.077) [-309.661] (-311.950) (-308.002) * (-310.308) [-312.623] (-308.259) (-310.370) -- 0:00:30
Average standard deviation of split frequencies: 0.008226
490500 -- [-307.518] (-309.846) (-309.024) (-309.379) * (-309.031) (-309.276) (-307.381) [-313.179] -- 0:00:30
491000 -- [-309.416] (-310.261) (-308.603) (-308.344) * (-314.605) [-307.661] (-308.036) (-310.548) -- 0:00:30
491500 -- (-307.328) (-308.457) (-307.629) [-308.275] * [-307.401] (-308.372) (-307.755) (-306.824) -- 0:00:30
492000 -- (-311.750) (-310.208) [-309.111] (-308.681) * (-306.633) [-309.018] (-307.493) (-306.911) -- 0:00:30
492500 -- (-310.158) (-306.770) (-311.165) [-306.903] * (-307.691) (-311.976) (-307.863) [-307.437] -- 0:00:30
493000 -- [-308.038] (-308.922) (-308.548) (-309.719) * (-310.406) (-309.257) (-309.387) [-308.854] -- 0:00:30
493500 -- (-312.156) (-308.549) [-308.544] (-308.285) * (-308.052) (-307.570) [-306.445] (-312.038) -- 0:00:30
494000 -- (-309.913) (-308.996) [-312.835] (-308.072) * (-306.960) (-308.331) (-307.075) [-307.602] -- 0:00:30
494500 -- [-306.735] (-308.024) (-307.728) (-306.660) * [-311.104] (-308.493) (-309.537) (-307.860) -- 0:00:30
495000 -- (-307.331) (-308.718) [-307.055] (-308.347) * (-312.999) (-308.878) (-308.459) [-307.516] -- 0:00:30
Average standard deviation of split frequencies: 0.007544
495500 -- (-307.444) (-311.235) [-307.254] (-311.045) * (-308.512) (-308.768) (-310.355) [-310.491] -- 0:00:30
496000 -- (-307.658) (-307.623) (-308.848) [-310.627] * (-307.996) (-306.928) (-310.498) [-309.205] -- 0:00:30
496500 -- [-309.048] (-308.508) (-308.431) (-307.930) * (-311.239) [-307.631] (-307.840) (-307.926) -- 0:00:30
497000 -- (-310.114) [-306.784] (-309.591) (-309.209) * (-316.014) (-309.416) (-307.891) [-312.336] -- 0:00:30
497500 -- (-310.389) (-311.001) [-310.684] (-307.899) * (-319.007) [-307.808] (-308.534) (-309.584) -- 0:00:30
498000 -- [-307.647] (-306.986) (-306.925) (-309.650) * (-311.761) (-308.080) (-306.631) [-308.137] -- 0:00:30
498500 -- (-307.631) (-307.915) (-309.271) [-307.710] * (-309.015) (-308.374) [-308.513] (-308.039) -- 0:00:30
499000 -- (-309.017) (-310.026) (-308.824) [-309.041] * [-308.489] (-309.436) (-310.768) (-308.717) -- 0:00:30
499500 -- [-307.494] (-313.039) (-307.009) (-309.251) * (-308.771) (-307.209) [-312.104] (-308.289) -- 0:00:30
500000 -- (-307.845) (-312.851) [-311.787] (-307.043) * (-308.250) [-310.141] (-309.970) (-309.061) -- 0:00:30
Average standard deviation of split frequencies: 0.007591
500500 -- (-308.078) (-309.487) (-308.598) [-312.806] * (-307.866) (-309.371) (-308.776) [-308.580] -- 0:00:29
501000 -- (-310.062) (-310.424) [-307.385] (-313.739) * [-309.805] (-308.378) (-308.438) (-307.313) -- 0:00:29
501500 -- (-308.901) (-308.069) (-308.589) [-311.905] * [-308.011] (-308.397) (-309.586) (-312.078) -- 0:00:29
502000 -- [-309.314] (-313.094) (-315.746) (-310.840) * (-307.131) [-307.760] (-312.208) (-307.608) -- 0:00:29
502500 -- (-313.173) (-307.957) [-307.754] (-311.565) * [-307.778] (-308.359) (-316.861) (-308.193) -- 0:00:29
503000 -- [-310.057] (-306.814) (-309.461) (-306.974) * (-310.535) (-309.257) [-309.925] (-311.764) -- 0:00:29
503500 -- (-309.332) (-313.629) (-310.406) [-308.030] * [-310.448] (-308.367) (-308.708) (-309.571) -- 0:00:29
504000 -- (-308.016) (-309.048) (-311.763) [-310.598] * (-311.279) [-308.388] (-306.876) (-310.594) -- 0:00:29
504500 -- (-308.932) (-308.124) [-308.213] (-309.224) * (-313.166) [-308.996] (-307.151) (-308.436) -- 0:00:29
505000 -- (-307.184) (-309.794) [-314.751] (-307.574) * (-308.854) [-310.928] (-307.114) (-307.446) -- 0:00:29
Average standard deviation of split frequencies: 0.007337
505500 -- (-309.458) (-308.428) [-308.528] (-309.231) * [-308.104] (-307.605) (-309.822) (-307.950) -- 0:00:29
506000 -- [-311.918] (-309.755) (-309.252) (-307.452) * (-307.085) (-307.612) [-307.679] (-311.136) -- 0:00:29
506500 -- (-308.092) (-308.017) [-307.040] (-308.519) * (-309.193) (-308.821) [-306.826] (-316.250) -- 0:00:29
507000 -- (-309.726) [-310.405] (-307.453) (-308.268) * (-311.157) [-308.158] (-308.222) (-309.811) -- 0:00:29
507500 -- [-307.539] (-310.798) (-312.952) (-309.012) * [-307.168] (-309.664) (-311.248) (-310.749) -- 0:00:29
508000 -- [-307.487] (-308.932) (-312.350) (-308.042) * (-308.644) (-307.647) (-309.024) [-307.387] -- 0:00:29
508500 -- [-311.424] (-312.647) (-307.597) (-308.098) * (-309.710) (-312.109) (-308.889) [-307.050] -- 0:00:29
509000 -- (-312.692) (-309.026) (-310.399) [-308.197] * (-312.071) [-306.891] (-308.111) (-308.498) -- 0:00:29
509500 -- [-309.505] (-309.722) (-308.764) (-309.810) * (-309.093) [-306.861] (-306.963) (-309.091) -- 0:00:29
510000 -- (-307.654) (-307.712) (-311.501) [-308.096] * [-308.670] (-306.654) (-307.213) (-309.835) -- 0:00:29
Average standard deviation of split frequencies: 0.007731
510500 -- [-308.478] (-306.948) (-306.460) (-307.868) * (-309.120) [-307.803] (-310.265) (-308.391) -- 0:00:29
511000 -- (-308.773) (-313.103) (-310.532) [-308.312] * (-311.831) [-308.720] (-307.631) (-307.808) -- 0:00:29
511500 -- (-313.378) [-306.783] (-307.128) (-306.976) * [-309.851] (-309.084) (-310.551) (-308.462) -- 0:00:29
512000 -- (-311.360) (-308.607) (-308.951) [-307.019] * [-306.923] (-310.611) (-307.577) (-311.027) -- 0:00:29
512500 -- (-308.757) (-307.597) [-310.843] (-308.367) * (-308.509) (-313.054) [-309.451] (-311.104) -- 0:00:29
513000 -- (-309.752) (-307.535) (-307.304) [-307.177] * [-309.860] (-311.645) (-309.877) (-313.127) -- 0:00:29
513500 -- (-311.826) [-308.882] (-308.423) (-307.427) * (-307.841) (-312.421) [-306.901] (-313.382) -- 0:00:29
514000 -- (-308.097) (-307.605) (-309.781) [-308.184] * (-308.118) (-310.765) [-307.388] (-307.448) -- 0:00:29
514500 -- (-308.155) [-308.218] (-308.928) (-311.917) * (-310.404) (-314.908) (-308.878) [-308.689] -- 0:00:29
515000 -- (-310.631) [-308.245] (-306.490) (-307.924) * (-308.198) (-314.575) [-308.147] (-307.242) -- 0:00:29
Average standard deviation of split frequencies: 0.007994
515500 -- (-310.578) [-308.476] (-310.281) (-310.476) * (-308.561) [-311.134] (-310.185) (-314.761) -- 0:00:29
516000 -- (-308.985) [-310.144] (-308.691) (-307.719) * (-308.749) (-307.548) [-308.982] (-307.977) -- 0:00:29
516500 -- (-310.165) [-306.527] (-308.982) (-309.692) * (-307.300) (-307.984) (-309.589) [-307.923] -- 0:00:29
517000 -- (-314.343) (-308.899) (-309.248) [-310.795] * [-310.689] (-308.532) (-306.575) (-309.289) -- 0:00:28
517500 -- (-311.344) (-308.496) [-307.887] (-307.271) * (-310.948) [-308.605] (-312.960) (-307.812) -- 0:00:28
518000 -- (-311.871) (-308.228) [-307.525] (-309.397) * (-308.997) (-307.361) (-316.422) [-307.724] -- 0:00:28
518500 -- (-310.763) (-313.096) (-309.039) [-307.555] * (-310.628) [-310.122] (-309.173) (-307.849) -- 0:00:28
519000 -- [-310.251] (-311.965) (-309.859) (-309.939) * (-309.229) (-307.691) [-308.968] (-310.207) -- 0:00:28
519500 -- (-308.427) [-312.161] (-309.813) (-310.822) * [-307.509] (-310.514) (-307.584) (-307.578) -- 0:00:28
520000 -- (-307.033) (-308.095) (-308.231) [-308.251] * (-312.907) [-307.586] (-308.385) (-310.699) -- 0:00:28
Average standard deviation of split frequencies: 0.008488
520500 -- (-307.928) (-309.531) [-307.955] (-311.013) * (-309.706) (-307.848) (-306.787) [-306.628] -- 0:00:28
521000 -- (-308.265) [-307.076] (-311.329) (-319.122) * (-312.991) (-307.395) [-309.716] (-309.698) -- 0:00:28
521500 -- (-307.796) [-308.364] (-311.343) (-308.355) * [-311.500] (-307.424) (-307.626) (-307.782) -- 0:00:28
522000 -- [-309.914] (-307.659) (-307.905) (-309.323) * (-309.509) (-309.092) (-307.338) [-307.908] -- 0:00:28
522500 -- (-308.898) [-311.723] (-308.809) (-309.987) * (-308.754) (-310.140) (-318.322) [-310.141] -- 0:00:28
523000 -- (-308.671) [-307.948] (-308.402) (-308.372) * (-307.760) [-309.307] (-307.574) (-307.661) -- 0:00:28
523500 -- (-310.464) [-308.195] (-309.342) (-309.230) * (-307.559) (-308.704) [-307.670] (-308.019) -- 0:00:28
524000 -- [-309.060] (-314.151) (-307.006) (-308.430) * (-311.420) [-309.502] (-306.693) (-309.451) -- 0:00:28
524500 -- [-308.141] (-312.614) (-307.644) (-307.633) * (-307.208) (-309.790) [-307.518] (-306.745) -- 0:00:28
525000 -- [-307.714] (-308.233) (-308.266) (-309.005) * [-310.388] (-308.715) (-312.284) (-308.386) -- 0:00:28
Average standard deviation of split frequencies: 0.009298
525500 -- [-310.272] (-310.643) (-307.614) (-307.595) * (-306.793) (-311.036) [-308.272] (-309.282) -- 0:00:28
526000 -- [-307.691] (-310.001) (-312.279) (-308.350) * [-309.381] (-308.968) (-311.459) (-306.800) -- 0:00:28
526500 -- (-309.580) [-316.342] (-309.741) (-308.014) * (-307.855) (-309.647) (-308.785) [-306.932] -- 0:00:28
527000 -- (-308.916) [-311.127] (-309.057) (-308.395) * [-308.252] (-308.817) (-311.357) (-309.210) -- 0:00:28
527500 -- (-309.012) (-308.468) [-309.725] (-311.972) * (-308.639) (-308.801) [-309.425] (-308.430) -- 0:00:28
528000 -- (-309.957) [-308.016] (-311.950) (-307.703) * [-310.234] (-309.903) (-312.292) (-308.927) -- 0:00:28
528500 -- (-311.664) [-308.268] (-307.331) (-308.009) * (-307.057) (-309.671) [-308.997] (-313.112) -- 0:00:28
529000 -- (-307.811) [-308.306] (-308.468) (-307.145) * [-306.897] (-308.264) (-306.768) (-311.432) -- 0:00:28
529500 -- [-308.024] (-315.672) (-307.049) (-306.526) * (-307.336) [-308.843] (-310.528) (-308.494) -- 0:00:28
530000 -- (-308.687) (-309.768) (-307.575) [-312.367] * (-309.049) [-306.417] (-311.638) (-309.045) -- 0:00:28
Average standard deviation of split frequencies: 0.009661
530500 -- (-307.229) [-307.335] (-307.595) (-308.297) * (-308.161) [-308.708] (-310.965) (-311.009) -- 0:00:28
531000 -- (-306.578) (-309.794) (-310.799) [-309.561] * (-308.425) (-308.072) [-308.695] (-309.972) -- 0:00:28
531500 -- (-308.353) [-306.846] (-311.101) (-310.300) * (-309.213) (-307.551) [-307.389] (-308.204) -- 0:00:28
532000 -- (-306.582) (-308.887) [-308.574] (-307.139) * (-307.979) [-308.666] (-306.959) (-307.666) -- 0:00:28
532500 -- (-310.951) (-307.306) [-309.521] (-311.027) * (-311.211) [-306.740] (-309.447) (-310.093) -- 0:00:28
533000 -- (-309.743) (-307.931) (-307.085) [-308.583] * (-308.126) (-308.112) [-308.658] (-307.795) -- 0:00:28
533500 -- (-309.438) (-307.901) (-310.735) [-310.003] * [-310.719] (-306.837) (-308.420) (-307.520) -- 0:00:27
534000 -- [-308.269] (-309.311) (-306.936) (-309.142) * [-307.471] (-306.927) (-309.344) (-308.013) -- 0:00:27
534500 -- (-308.275) (-307.742) [-308.394] (-308.972) * (-307.998) (-308.958) (-307.979) [-313.171] -- 0:00:27
535000 -- [-307.284] (-308.159) (-307.732) (-312.158) * [-308.752] (-310.838) (-311.330) (-310.238) -- 0:00:27
Average standard deviation of split frequencies: 0.009364
535500 -- [-307.533] (-309.686) (-309.884) (-309.061) * (-308.009) (-311.550) (-310.600) [-307.317] -- 0:00:27
536000 -- (-313.616) (-310.629) [-306.414] (-309.746) * (-313.147) (-309.147) (-311.824) [-306.856] -- 0:00:27
536500 -- (-308.397) (-309.181) (-306.921) [-310.996] * (-308.284) (-308.834) (-307.697) [-308.355] -- 0:00:27
537000 -- (-309.346) [-307.150] (-314.156) (-308.652) * (-308.867) (-309.222) [-309.201] (-310.242) -- 0:00:27
537500 -- [-307.478] (-308.025) (-310.471) (-310.397) * (-309.991) (-309.138) (-309.199) [-307.937] -- 0:00:27
538000 -- (-311.578) (-310.988) (-308.232) [-310.171] * (-308.326) (-311.910) (-310.457) [-308.068] -- 0:00:27
538500 -- (-309.700) (-308.475) (-312.018) [-313.675] * [-308.811] (-310.680) (-308.906) (-307.921) -- 0:00:27
539000 -- (-308.222) (-307.586) [-308.962] (-307.267) * (-312.715) (-307.746) [-308.276] (-306.945) -- 0:00:27
539500 -- [-307.103] (-312.705) (-311.938) (-307.541) * (-309.517) (-311.977) [-309.480] (-309.440) -- 0:00:27
540000 -- [-308.602] (-309.061) (-313.750) (-309.325) * [-312.290] (-310.113) (-309.230) (-310.276) -- 0:00:27
Average standard deviation of split frequencies: 0.009482
540500 -- (-308.305) [-306.419] (-310.292) (-308.458) * (-310.622) (-308.690) [-307.612] (-309.098) -- 0:00:27
541000 -- (-309.073) (-308.459) [-309.493] (-311.194) * (-312.721) (-307.429) (-307.028) [-307.894] -- 0:00:27
541500 -- (-307.051) [-307.081] (-307.537) (-307.721) * (-310.222) (-308.276) [-309.995] (-310.751) -- 0:00:27
542000 -- (-307.142) [-307.615] (-306.400) (-307.789) * (-309.885) (-309.927) (-310.144) [-307.287] -- 0:00:27
542500 -- (-306.765) (-308.689) (-309.057) [-309.722] * (-310.760) (-309.834) [-306.929] (-307.234) -- 0:00:26
543000 -- [-309.345] (-310.000) (-306.947) (-309.371) * (-310.247) [-309.051] (-307.554) (-308.105) -- 0:00:27
543500 -- (-310.101) (-312.931) [-307.463] (-310.505) * [-309.563] (-309.998) (-308.029) (-307.199) -- 0:00:27
544000 -- (-309.011) [-308.608] (-311.247) (-307.470) * [-307.898] (-311.949) (-307.962) (-310.895) -- 0:00:27
544500 -- [-313.934] (-307.424) (-308.872) (-306.832) * (-310.023) (-310.733) [-307.127] (-308.920) -- 0:00:27
545000 -- [-313.102] (-310.459) (-307.976) (-307.174) * (-308.939) (-310.145) [-310.573] (-310.302) -- 0:00:27
Average standard deviation of split frequencies: 0.009650
545500 -- [-307.499] (-306.718) (-308.532) (-310.254) * (-310.035) (-306.723) [-308.665] (-308.585) -- 0:00:27
546000 -- (-308.253) (-306.695) (-307.897) [-308.414] * [-310.769] (-308.267) (-311.532) (-309.714) -- 0:00:27
546500 -- (-308.270) (-307.812) (-314.575) [-306.654] * [-309.586] (-306.900) (-313.502) (-308.623) -- 0:00:27
547000 -- (-308.248) [-308.700] (-307.290) (-307.818) * (-314.333) [-307.291] (-311.129) (-309.159) -- 0:00:27
547500 -- (-311.633) [-307.798] (-308.022) (-308.159) * (-313.120) (-309.403) [-307.694] (-308.592) -- 0:00:27
548000 -- (-313.693) [-308.318] (-312.747) (-308.689) * [-308.738] (-309.701) (-308.190) (-307.686) -- 0:00:27
548500 -- (-311.946) (-307.360) [-315.041] (-307.437) * (-308.790) (-310.089) [-306.792] (-306.901) -- 0:00:27
549000 -- (-308.257) (-308.532) (-309.441) [-310.581] * (-309.087) (-309.409) (-309.987) [-306.829] -- 0:00:27
549500 -- (-309.457) (-309.299) (-307.930) [-309.418] * (-311.825) (-309.746) (-310.975) [-310.588] -- 0:00:27
550000 -- [-307.317] (-309.562) (-309.341) (-308.061) * (-310.340) (-308.132) [-307.818] (-311.666) -- 0:00:27
Average standard deviation of split frequencies: 0.009618
550500 -- (-307.377) [-309.050] (-307.399) (-306.707) * (-309.032) [-309.138] (-306.546) (-306.824) -- 0:00:26
551000 -- (-312.882) (-313.079) [-307.520] (-309.094) * (-308.343) (-308.451) [-306.867] (-311.900) -- 0:00:26
551500 -- [-309.775] (-310.288) (-307.788) (-310.146) * (-309.403) (-308.447) [-307.224] (-308.998) -- 0:00:26
552000 -- [-310.242] (-312.417) (-307.273) (-312.870) * (-309.056) (-307.212) (-308.339) [-311.588] -- 0:00:26
552500 -- [-308.408] (-312.075) (-307.699) (-309.421) * (-309.844) [-308.746] (-307.379) (-308.788) -- 0:00:26
553000 -- (-312.947) (-312.839) [-308.897] (-308.077) * (-310.290) (-310.955) (-308.419) [-307.062] -- 0:00:26
553500 -- (-308.608) [-314.271] (-307.574) (-307.627) * (-306.672) (-307.484) [-307.540] (-309.335) -- 0:00:26
554000 -- (-307.763) (-310.779) [-307.055] (-307.905) * [-310.354] (-306.944) (-311.324) (-309.016) -- 0:00:26
554500 -- (-307.522) [-309.918] (-310.507) (-307.146) * (-308.434) [-307.593] (-312.608) (-308.912) -- 0:00:26
555000 -- (-308.620) [-306.974] (-307.233) (-310.279) * (-311.564) [-309.538] (-310.897) (-312.552) -- 0:00:26
Average standard deviation of split frequencies: 0.010124
555500 -- (-308.806) [-310.585] (-307.741) (-310.664) * [-308.082] (-306.759) (-308.466) (-307.254) -- 0:00:26
556000 -- (-307.859) [-310.570] (-311.338) (-310.402) * (-306.969) (-309.054) [-311.435] (-308.362) -- 0:00:26
556500 -- [-308.763] (-312.412) (-309.809) (-306.713) * [-310.085] (-310.735) (-311.718) (-308.879) -- 0:00:26
557000 -- (-310.364) [-307.374] (-308.477) (-311.991) * [-307.924] (-308.218) (-308.680) (-312.212) -- 0:00:26
557500 -- (-309.818) [-308.336] (-312.845) (-307.650) * (-310.373) [-307.769] (-311.103) (-306.970) -- 0:00:26
558000 -- (-308.239) (-310.948) [-311.271] (-308.851) * (-307.966) (-307.364) (-309.035) [-307.035] -- 0:00:26
558500 -- [-309.863] (-309.327) (-307.827) (-312.982) * (-308.426) (-310.059) (-310.500) [-308.541] -- 0:00:26
559000 -- (-310.718) (-314.098) [-309.321] (-309.251) * (-306.947) (-312.053) (-309.204) [-311.945] -- 0:00:26
559500 -- (-310.664) (-310.519) [-307.259] (-312.418) * (-308.942) (-309.309) [-311.291] (-313.577) -- 0:00:25
560000 -- [-306.751] (-307.707) (-308.592) (-307.833) * [-310.268] (-310.235) (-308.796) (-313.948) -- 0:00:26
Average standard deviation of split frequencies: 0.010878
560500 -- (-306.739) (-309.584) (-308.115) [-308.654] * (-310.474) (-307.552) [-309.099] (-308.392) -- 0:00:26
561000 -- (-307.156) [-313.685] (-309.169) (-310.945) * [-309.443] (-308.710) (-307.377) (-309.515) -- 0:00:26
561500 -- (-308.912) [-312.156] (-308.777) (-307.873) * (-308.132) [-310.326] (-307.242) (-307.122) -- 0:00:26
562000 -- (-315.829) (-308.428) (-310.632) [-308.311] * [-307.628] (-309.456) (-306.641) (-309.316) -- 0:00:26
562500 -- (-308.933) [-308.157] (-313.623) (-309.409) * (-307.556) (-308.388) (-306.974) [-307.660] -- 0:00:26
563000 -- (-311.537) (-308.917) (-309.812) [-308.310] * [-308.991] (-308.386) (-307.528) (-310.776) -- 0:00:26
563500 -- (-308.474) (-309.475) [-310.359] (-306.902) * [-309.884] (-307.471) (-307.687) (-308.221) -- 0:00:26
564000 -- (-307.946) (-313.253) (-310.191) [-307.994] * (-310.141) [-307.330] (-307.956) (-308.341) -- 0:00:26
564500 -- (-308.995) (-312.117) [-307.718] (-308.288) * (-309.587) (-310.400) [-309.868] (-307.317) -- 0:00:26
565000 -- [-310.514] (-312.082) (-310.640) (-311.822) * [-309.519] (-307.432) (-311.639) (-307.880) -- 0:00:26
Average standard deviation of split frequencies: 0.010307
565500 -- (-310.292) [-309.630] (-308.907) (-307.577) * (-309.531) [-308.440] (-312.783) (-310.271) -- 0:00:26
566000 -- [-309.875] (-308.382) (-308.951) (-309.561) * [-307.876] (-309.289) (-308.422) (-309.125) -- 0:00:26
566500 -- (-307.178) (-310.844) (-310.272) [-309.724] * [-307.148] (-309.367) (-308.324) (-307.723) -- 0:00:26
567000 -- [-307.247] (-308.860) (-307.641) (-307.789) * [-308.558] (-311.605) (-308.733) (-307.884) -- 0:00:25
567500 -- (-307.417) [-307.940] (-307.372) (-310.239) * (-309.196) [-307.087] (-306.923) (-311.607) -- 0:00:25
568000 -- (-314.943) (-308.243) (-307.638) [-307.208] * (-310.312) [-307.018] (-308.642) (-307.619) -- 0:00:25
568500 -- (-308.490) [-307.950] (-309.511) (-308.066) * [-309.102] (-312.098) (-310.680) (-308.807) -- 0:00:25
569000 -- (-309.491) (-306.329) (-310.256) [-311.425] * (-309.876) (-309.163) [-312.177] (-310.518) -- 0:00:25
569500 -- (-309.510) (-307.382) [-306.683] (-309.541) * (-307.638) [-310.419] (-311.059) (-307.755) -- 0:00:25
570000 -- [-307.857] (-308.081) (-307.000) (-311.096) * (-307.026) [-312.779] (-311.562) (-309.490) -- 0:00:25
Average standard deviation of split frequencies: 0.010739
570500 -- (-307.960) [-308.183] (-309.223) (-310.286) * [-307.177] (-310.858) (-311.680) (-308.574) -- 0:00:25
571000 -- [-307.134] (-309.167) (-309.238) (-307.587) * (-308.832) (-308.445) [-312.941] (-307.558) -- 0:00:25
571500 -- [-308.979] (-310.980) (-306.866) (-310.534) * [-306.429] (-307.683) (-314.424) (-308.273) -- 0:00:25
572000 -- (-306.868) [-309.245] (-308.755) (-308.479) * [-308.680] (-310.061) (-311.691) (-309.554) -- 0:00:25
572500 -- (-306.844) (-309.048) [-311.674] (-306.853) * (-308.509) (-312.146) [-306.703] (-308.989) -- 0:00:25
573000 -- (-307.884) (-307.014) [-311.202] (-306.856) * [-309.993] (-307.022) (-310.533) (-306.993) -- 0:00:25
573500 -- (-315.100) (-306.959) (-307.601) [-307.955] * (-306.957) (-307.109) [-308.999] (-313.342) -- 0:00:25
574000 -- (-307.163) [-308.043] (-309.327) (-315.922) * [-308.078] (-307.488) (-310.760) (-313.669) -- 0:00:25
574500 -- (-311.835) (-309.240) (-306.749) [-311.338] * (-309.096) [-306.959] (-311.947) (-311.525) -- 0:00:25
575000 -- (-308.848) [-309.797] (-307.176) (-311.122) * (-308.344) [-306.660] (-313.126) (-309.857) -- 0:00:25
Average standard deviation of split frequencies: 0.011100
575500 -- (-307.944) [-310.189] (-307.629) (-309.336) * (-310.045) (-313.986) (-307.535) [-306.787] -- 0:00:25
576000 -- (-311.957) [-308.562] (-309.829) (-308.248) * (-307.911) [-313.052] (-311.791) (-306.901) -- 0:00:25
576500 -- [-311.560] (-310.238) (-311.435) (-308.104) * (-309.010) (-308.594) (-308.915) [-307.342] -- 0:00:24
577000 -- (-310.646) (-307.936) [-308.163] (-312.263) * [-308.539] (-312.526) (-309.850) (-307.285) -- 0:00:25
577500 -- (-308.867) (-309.476) (-310.254) [-307.929] * (-311.008) [-308.313] (-310.640) (-307.326) -- 0:00:25
578000 -- (-308.941) (-310.378) [-311.124] (-310.134) * (-311.977) [-307.568] (-311.521) (-308.456) -- 0:00:25
578500 -- (-311.036) [-309.195] (-308.353) (-307.660) * (-310.225) [-308.331] (-307.687) (-309.118) -- 0:00:25
579000 -- (-309.362) (-309.485) (-316.807) [-307.354] * (-307.689) [-316.309] (-307.927) (-309.343) -- 0:00:25
579500 -- (-309.582) (-310.377) [-309.661] (-309.776) * (-312.085) (-309.038) (-309.566) [-308.290] -- 0:00:25
580000 -- (-308.086) [-307.041] (-310.287) (-308.498) * (-306.939) (-309.948) [-307.423] (-310.018) -- 0:00:25
Average standard deviation of split frequencies: 0.010808
580500 -- [-310.962] (-310.044) (-310.084) (-307.595) * [-308.379] (-308.518) (-309.532) (-310.631) -- 0:00:25
581000 -- (-312.893) (-310.459) (-308.025) [-306.867] * (-310.237) (-311.281) (-308.121) [-307.765] -- 0:00:25
581500 -- [-307.399] (-307.341) (-307.534) (-311.096) * (-307.430) [-309.794] (-307.660) (-308.485) -- 0:00:25
582000 -- [-307.835] (-308.362) (-309.621) (-308.439) * (-310.510) (-307.641) (-308.266) [-309.160] -- 0:00:25
582500 -- (-310.340) [-308.243] (-308.730) (-311.012) * (-308.046) (-306.840) [-312.561] (-308.732) -- 0:00:25
583000 -- (-308.014) [-307.677] (-309.077) (-309.612) * [-308.729] (-306.608) (-306.841) (-307.911) -- 0:00:25
583500 -- (-307.905) [-307.959] (-310.898) (-308.474) * (-312.095) [-307.984] (-308.297) (-309.133) -- 0:00:24
584000 -- [-307.635] (-306.983) (-310.059) (-310.542) * [-310.581] (-308.321) (-308.105) (-307.305) -- 0:00:24
584500 -- (-308.164) (-310.885) [-309.133] (-306.652) * (-307.588) [-306.651] (-309.241) (-306.740) -- 0:00:24
585000 -- (-309.272) (-308.748) (-309.642) [-314.727] * (-310.349) (-306.655) (-309.638) [-307.122] -- 0:00:24
Average standard deviation of split frequencies: 0.010810
585500 -- [-309.524] (-308.633) (-306.945) (-315.706) * [-307.732] (-307.348) (-309.791) (-308.793) -- 0:00:24
586000 -- [-307.745] (-308.234) (-306.791) (-307.636) * (-312.340) (-310.340) (-307.126) [-307.141] -- 0:00:24
586500 -- [-309.383] (-310.667) (-308.373) (-310.978) * (-312.576) (-309.935) (-309.981) [-308.879] -- 0:00:24
587000 -- (-309.047) [-307.972] (-309.039) (-311.721) * (-308.358) (-310.571) (-309.232) [-315.851] -- 0:00:24
587500 -- (-310.220) (-308.608) [-308.992] (-312.817) * [-311.272] (-309.150) (-307.912) (-308.129) -- 0:00:24
588000 -- (-308.252) (-308.277) (-307.193) [-310.675] * (-307.852) (-307.727) [-310.849] (-306.844) -- 0:00:24
588500 -- [-306.792] (-308.959) (-308.360) (-308.582) * (-308.578) (-308.482) (-308.593) [-307.581] -- 0:00:24
589000 -- (-306.886) (-307.682) [-310.842] (-308.449) * (-308.127) [-307.792] (-309.938) (-309.323) -- 0:00:24
589500 -- (-307.897) (-310.557) [-308.852] (-309.670) * (-308.075) (-309.640) (-312.272) [-307.327] -- 0:00:24
590000 -- [-306.637] (-308.239) (-307.138) (-307.577) * (-308.980) (-310.182) (-308.509) [-308.736] -- 0:00:24
Average standard deviation of split frequencies: 0.010625
590500 -- [-308.852] (-309.190) (-307.336) (-311.951) * (-308.852) (-309.789) [-306.801] (-307.945) -- 0:00:24
591000 -- (-306.907) (-311.575) [-308.166] (-309.351) * (-311.936) (-308.577) [-308.147] (-312.468) -- 0:00:24
591500 -- [-311.234] (-311.384) (-307.715) (-310.582) * [-310.419] (-308.113) (-307.650) (-308.989) -- 0:00:24
592000 -- (-309.102) [-307.819] (-311.831) (-308.778) * (-312.305) (-316.184) (-308.473) [-307.141] -- 0:00:24
592500 -- (-309.503) (-309.419) (-306.997) [-308.277] * (-309.066) [-309.773] (-311.705) (-312.165) -- 0:00:24
593000 -- (-307.618) (-307.986) [-308.620] (-307.706) * [-310.462] (-311.356) (-310.573) (-309.556) -- 0:00:24
593500 -- (-307.656) (-307.103) (-308.307) [-311.638] * (-311.967) [-308.827] (-310.573) (-309.518) -- 0:00:23
594000 -- (-310.607) [-308.919] (-307.113) (-308.515) * (-308.869) (-309.662) (-311.872) [-314.549] -- 0:00:23
594500 -- (-317.503) (-309.418) [-306.589] (-309.502) * (-314.267) [-308.942] (-307.484) (-309.214) -- 0:00:24
595000 -- (-306.875) [-310.399] (-306.533) (-308.586) * (-309.760) (-306.870) [-311.130] (-308.860) -- 0:00:24
Average standard deviation of split frequencies: 0.010233
595500 -- (-309.926) [-307.196] (-308.722) (-309.516) * (-308.354) (-307.050) [-309.837] (-312.255) -- 0:00:24
596000 -- (-307.734) (-308.226) (-307.710) [-308.045] * (-308.152) (-312.301) (-307.727) [-309.374] -- 0:00:24
596500 -- [-307.389] (-308.823) (-311.372) (-307.724) * (-307.334) (-309.700) (-308.998) [-309.490] -- 0:00:24
597000 -- [-308.059] (-308.996) (-316.621) (-311.880) * (-308.022) [-307.897] (-310.999) (-308.279) -- 0:00:24
597500 -- (-307.356) (-308.436) (-309.009) [-310.325] * (-308.976) [-308.617] (-311.863) (-310.550) -- 0:00:24
598000 -- [-308.507] (-307.052) (-308.792) (-309.056) * (-309.338) [-308.899] (-312.653) (-308.399) -- 0:00:24
598500 -- (-309.366) (-309.092) [-307.481] (-308.586) * (-308.195) (-307.896) (-308.092) [-308.825] -- 0:00:24
599000 -- [-309.735] (-307.217) (-320.287) (-308.264) * (-308.389) [-308.215] (-308.537) (-311.063) -- 0:00:24
599500 -- (-307.690) (-307.540) (-318.319) [-314.255] * [-311.530] (-308.635) (-307.637) (-309.172) -- 0:00:24
600000 -- (-308.554) (-310.977) [-307.055] (-311.858) * [-307.474] (-307.752) (-308.542) (-309.540) -- 0:00:24
Average standard deviation of split frequencies: 0.010448
600500 -- (-308.652) (-308.769) (-306.653) [-308.012] * [-308.679] (-308.004) (-309.122) (-310.896) -- 0:00:23
601000 -- (-307.769) [-307.767] (-307.361) (-313.507) * (-309.930) (-306.826) (-308.426) [-312.316] -- 0:00:23
601500 -- (-308.059) (-307.366) [-311.352] (-307.883) * [-307.341] (-308.848) (-308.130) (-311.205) -- 0:00:23
602000 -- [-306.896] (-308.956) (-309.527) (-309.902) * (-308.616) [-309.879] (-307.554) (-309.536) -- 0:00:23
602500 -- (-312.421) (-314.290) [-307.891] (-307.013) * (-308.918) (-308.255) [-308.184] (-310.892) -- 0:00:23
603000 -- (-308.431) (-315.997) (-310.302) [-309.531] * [-310.504] (-308.315) (-309.064) (-313.253) -- 0:00:23
603500 -- [-308.256] (-307.825) (-310.505) (-308.103) * (-310.559) (-311.339) (-307.286) [-308.928] -- 0:00:23
604000 -- (-306.736) (-310.718) [-309.623] (-306.841) * [-306.866] (-310.913) (-307.593) (-310.087) -- 0:00:23
604500 -- [-307.181] (-307.394) (-311.184) (-308.606) * (-309.232) (-307.595) [-307.255] (-311.494) -- 0:00:23
605000 -- [-309.149] (-309.672) (-309.961) (-308.386) * [-308.623] (-309.633) (-307.894) (-308.303) -- 0:00:23
Average standard deviation of split frequencies: 0.010502
605500 -- (-306.661) (-312.037) (-307.024) [-306.519] * (-307.310) (-309.867) (-308.806) [-309.703] -- 0:00:23
606000 -- (-313.161) (-309.520) (-307.260) [-308.225] * (-307.874) [-306.577] (-310.477) (-307.864) -- 0:00:23
606500 -- (-309.090) (-308.597) (-307.021) [-307.147] * (-307.144) (-306.946) [-309.274] (-307.901) -- 0:00:23
607000 -- (-307.389) (-310.855) [-306.505] (-307.393) * (-308.025) [-310.604] (-307.453) (-308.764) -- 0:00:23
607500 -- [-308.277] (-311.481) (-307.222) (-314.529) * [-310.747] (-308.362) (-307.377) (-307.845) -- 0:00:23
608000 -- [-308.092] (-309.651) (-309.513) (-307.140) * (-312.856) [-306.785] (-306.664) (-309.042) -- 0:00:23
608500 -- [-307.640] (-310.028) (-308.241) (-307.987) * (-310.937) [-306.765] (-310.785) (-308.540) -- 0:00:23
609000 -- (-310.513) [-308.634] (-308.290) (-308.972) * (-308.400) (-310.363) [-307.795] (-308.115) -- 0:00:23
609500 -- (-312.246) (-307.325) (-307.911) [-308.752] * [-307.299] (-312.079) (-309.402) (-308.207) -- 0:00:23
610000 -- (-311.109) [-308.306] (-309.894) (-310.115) * [-307.544] (-309.983) (-307.273) (-308.835) -- 0:00:23
Average standard deviation of split frequencies: 0.010952
610500 -- (-307.128) (-312.263) [-311.812] (-310.670) * (-309.153) (-307.334) [-306.499] (-309.408) -- 0:00:22
611000 -- [-308.693] (-308.994) (-309.228) (-307.356) * (-309.822) (-307.567) (-309.335) [-312.453] -- 0:00:22
611500 -- [-309.253] (-309.907) (-308.075) (-308.805) * (-309.547) [-308.458] (-309.518) (-309.520) -- 0:00:23
612000 -- [-308.114] (-308.211) (-307.457) (-308.218) * (-310.903) (-308.956) (-309.583) [-307.211] -- 0:00:23
612500 -- [-308.911] (-306.933) (-311.148) (-308.808) * [-307.098] (-310.612) (-308.695) (-308.288) -- 0:00:23
613000 -- (-306.924) [-307.297] (-314.925) (-309.152) * (-311.090) (-307.584) (-307.708) [-310.253] -- 0:00:23
613500 -- [-310.454] (-306.815) (-309.685) (-307.084) * [-311.636] (-308.046) (-307.189) (-307.989) -- 0:00:23
614000 -- (-309.704) (-308.447) [-307.462] (-307.995) * [-309.937] (-308.447) (-311.106) (-313.485) -- 0:00:23
614500 -- [-311.989] (-308.879) (-309.211) (-307.843) * (-310.160) (-308.223) [-308.286] (-309.871) -- 0:00:23
615000 -- (-309.280) (-309.511) (-307.562) [-307.817] * (-308.575) (-309.169) (-310.162) [-307.652] -- 0:00:23
Average standard deviation of split frequencies: 0.011383
615500 -- [-307.529] (-307.050) (-308.340) (-307.597) * (-308.128) (-307.345) (-308.866) [-310.211] -- 0:00:23
616000 -- (-306.437) [-310.781] (-309.070) (-307.775) * (-307.472) (-309.273) [-307.208] (-309.483) -- 0:00:23
616500 -- (-307.415) (-307.881) [-307.095] (-306.593) * [-307.960] (-309.370) (-308.539) (-306.703) -- 0:00:23
617000 -- (-309.456) (-308.706) (-308.369) [-308.839] * [-308.234] (-308.617) (-310.213) (-308.702) -- 0:00:22
617500 -- (-307.761) (-308.277) (-309.090) [-310.157] * (-311.494) (-307.382) (-307.631) [-308.765] -- 0:00:22
618000 -- (-309.265) (-306.329) [-308.430] (-308.067) * (-307.699) (-308.768) (-308.673) [-308.013] -- 0:00:22
618500 -- (-307.928) (-308.868) (-308.138) [-310.406] * (-309.929) [-309.220] (-313.272) (-309.777) -- 0:00:22
619000 -- (-307.824) (-315.014) [-307.563] (-308.739) * (-309.393) [-306.899] (-308.714) (-310.268) -- 0:00:22
619500 -- (-307.933) (-309.917) [-309.166] (-309.415) * [-308.812] (-310.830) (-308.678) (-312.539) -- 0:00:22
620000 -- [-308.959] (-307.215) (-309.886) (-308.639) * (-307.916) (-308.342) [-309.100] (-313.018) -- 0:00:22
Average standard deviation of split frequencies: 0.011060
620500 -- (-307.892) (-307.440) (-308.789) [-308.758] * (-307.399) (-307.427) (-311.753) [-306.992] -- 0:00:22
621000 -- (-313.416) [-309.523] (-312.349) (-308.740) * (-308.128) (-307.667) [-309.820] (-308.916) -- 0:00:22
621500 -- (-310.432) (-311.344) [-308.320] (-311.921) * [-306.738] (-311.726) (-309.189) (-307.988) -- 0:00:22
622000 -- (-309.012) (-308.018) [-307.899] (-310.002) * [-307.788] (-309.236) (-307.951) (-308.349) -- 0:00:22
622500 -- (-309.262) [-308.478] (-306.674) (-310.436) * (-306.573) [-307.478] (-306.926) (-309.974) -- 0:00:22
623000 -- [-308.443] (-309.280) (-308.115) (-311.149) * [-307.313] (-306.911) (-308.412) (-310.905) -- 0:00:22
623500 -- (-312.262) [-307.073] (-309.443) (-307.667) * [-310.366] (-309.177) (-310.460) (-310.037) -- 0:00:22
624000 -- (-308.729) (-307.975) [-307.541] (-309.943) * [-308.751] (-308.069) (-307.804) (-311.236) -- 0:00:22
624500 -- [-307.456] (-309.108) (-311.555) (-308.813) * (-307.350) [-308.563] (-308.090) (-308.959) -- 0:00:22
625000 -- (-308.151) [-310.698] (-311.012) (-310.456) * (-309.490) (-309.241) [-307.868] (-311.804) -- 0:00:22
Average standard deviation of split frequencies: 0.010543
625500 -- [-312.695] (-308.852) (-314.858) (-311.020) * (-308.447) [-308.483] (-311.068) (-306.958) -- 0:00:22
626000 -- (-310.782) (-309.322) (-310.291) [-310.099] * (-309.036) [-308.219] (-311.033) (-310.924) -- 0:00:22
626500 -- (-307.621) (-307.950) (-309.153) [-311.259] * (-309.906) [-310.948] (-307.474) (-309.028) -- 0:00:22
627000 -- [-308.059] (-310.948) (-309.608) (-309.970) * (-308.896) [-306.556] (-306.671) (-309.880) -- 0:00:22
627500 -- (-308.514) [-308.753] (-308.629) (-307.444) * (-308.613) (-306.614) [-310.542] (-310.981) -- 0:00:21
628000 -- (-309.375) (-308.053) [-307.333] (-306.718) * (-310.301) (-307.900) (-307.555) [-308.274] -- 0:00:21
628500 -- (-309.873) (-308.243) (-307.743) [-309.482] * [-308.348] (-309.187) (-308.972) (-307.611) -- 0:00:22
629000 -- (-308.290) (-309.377) (-306.933) [-306.630] * (-307.623) (-307.355) [-310.628] (-310.293) -- 0:00:22
629500 -- (-307.986) [-307.798] (-308.159) (-309.349) * (-309.149) [-308.566] (-309.001) (-310.409) -- 0:00:22
630000 -- [-307.764] (-310.173) (-308.023) (-307.854) * (-308.506) (-307.693) (-307.743) [-307.843] -- 0:00:22
Average standard deviation of split frequencies: 0.010511
630500 -- [-309.121] (-309.298) (-310.986) (-308.570) * (-306.676) (-309.720) (-307.626) [-311.394] -- 0:00:22
631000 -- (-307.008) (-309.548) [-310.086] (-308.260) * (-307.731) [-311.845] (-307.501) (-310.962) -- 0:00:22
631500 -- (-308.463) [-311.643] (-306.862) (-312.037) * (-309.872) [-307.302] (-306.622) (-308.140) -- 0:00:22
632000 -- [-306.779] (-311.188) (-309.283) (-308.230) * (-309.636) (-308.982) (-307.458) [-310.521] -- 0:00:22
632500 -- (-309.513) (-306.844) (-306.875) [-307.538] * (-308.106) (-309.994) (-307.450) [-313.707] -- 0:00:22
633000 -- (-307.047) [-307.616] (-313.908) (-307.892) * [-307.187] (-310.877) (-307.125) (-307.114) -- 0:00:22
633500 -- [-308.349] (-308.262) (-308.633) (-307.335) * (-308.198) (-308.324) (-308.289) [-308.365] -- 0:00:21
634000 -- (-308.629) [-306.552] (-307.596) (-306.841) * [-307.755] (-309.759) (-308.422) (-308.581) -- 0:00:21
634500 -- (-307.388) (-307.934) [-307.396] (-308.608) * (-308.873) (-308.532) [-308.865] (-307.324) -- 0:00:21
635000 -- (-310.417) (-309.758) (-309.437) [-308.005] * [-307.223] (-311.987) (-308.680) (-308.750) -- 0:00:21
Average standard deviation of split frequencies: 0.010238
635500 -- [-311.573] (-309.034) (-309.067) (-308.396) * (-309.233) (-310.016) [-315.883] (-306.474) -- 0:00:21
636000 -- (-307.246) (-307.891) [-307.766] (-307.629) * (-308.730) (-309.465) (-309.157) [-306.746] -- 0:00:21
636500 -- (-307.345) (-308.387) [-307.781] (-310.843) * (-309.392) (-309.296) (-307.054) [-309.813] -- 0:00:21
637000 -- (-307.732) (-308.344) (-307.694) [-309.051] * (-308.246) [-311.153] (-309.791) (-309.776) -- 0:00:21
637500 -- (-308.603) [-310.253] (-308.218) (-312.789) * (-312.113) [-306.974] (-310.775) (-308.799) -- 0:00:21
638000 -- (-308.344) [-311.312] (-308.260) (-311.038) * [-306.734] (-307.839) (-308.195) (-308.669) -- 0:00:21
638500 -- [-307.255] (-313.789) (-308.653) (-307.892) * (-309.512) [-307.120] (-313.005) (-310.880) -- 0:00:21
639000 -- (-307.434) (-308.534) [-308.450] (-307.158) * (-307.843) [-308.043] (-308.675) (-309.142) -- 0:00:21
639500 -- (-310.689) [-308.803] (-310.769) (-310.265) * (-306.769) [-313.006] (-311.192) (-309.231) -- 0:00:21
640000 -- (-309.152) [-307.545] (-308.077) (-308.457) * (-311.890) (-307.436) (-307.630) [-307.801] -- 0:00:21
Average standard deviation of split frequencies: 0.009887
640500 -- (-311.571) (-306.446) (-309.633) [-308.461] * (-309.109) (-311.298) [-313.555] (-308.749) -- 0:00:21
641000 -- (-312.383) [-306.707] (-307.665) (-307.193) * (-307.316) (-307.674) (-307.090) [-309.863] -- 0:00:21
641500 -- (-308.977) (-306.710) (-308.646) [-307.091] * (-310.807) (-307.823) (-310.729) [-307.872] -- 0:00:21
642000 -- (-307.007) [-308.978] (-307.755) (-308.655) * [-308.011] (-309.914) (-311.443) (-310.630) -- 0:00:21
642500 -- [-307.769] (-309.543) (-307.974) (-308.052) * (-309.057) (-306.944) (-311.250) [-307.600] -- 0:00:21
643000 -- (-308.566) (-311.520) [-307.772] (-307.751) * (-311.277) (-307.040) [-307.996] (-307.196) -- 0:00:21
643500 -- (-308.744) [-306.926] (-306.879) (-306.904) * (-308.687) [-307.747] (-309.504) (-308.144) -- 0:00:21
644000 -- (-312.339) (-307.229) [-307.571] (-306.586) * (-314.196) (-307.487) [-307.122] (-308.237) -- 0:00:21
644500 -- (-310.842) (-309.095) [-308.458] (-310.343) * (-309.312) (-311.592) (-308.193) [-310.635] -- 0:00:20
645000 -- (-308.116) [-306.587] (-306.656) (-309.266) * (-308.673) (-306.723) [-309.799] (-310.157) -- 0:00:20
Average standard deviation of split frequencies: 0.009669
645500 -- (-308.556) (-307.456) (-310.749) [-307.968] * (-308.533) (-309.169) [-307.771] (-311.803) -- 0:00:21
646000 -- (-307.387) [-308.645] (-309.028) (-310.094) * [-307.002] (-320.063) (-311.639) (-311.981) -- 0:00:21
646500 -- (-310.354) (-309.066) (-309.370) [-309.709] * (-307.584) [-309.887] (-308.100) (-309.911) -- 0:00:21
647000 -- (-309.658) (-309.150) [-307.628] (-309.306) * (-308.326) (-309.591) (-312.606) [-308.221] -- 0:00:21
647500 -- (-309.004) [-306.814] (-308.925) (-311.228) * (-309.914) [-310.085] (-308.378) (-307.359) -- 0:00:21
648000 -- [-307.422] (-310.549) (-312.362) (-313.095) * (-307.223) (-306.876) (-309.643) [-308.622] -- 0:00:21
648500 -- (-308.843) [-307.635] (-310.857) (-310.253) * (-307.360) (-307.912) (-308.641) [-309.537] -- 0:00:21
649000 -- [-306.857] (-307.404) (-310.248) (-312.563) * (-309.371) (-307.377) [-308.599] (-307.166) -- 0:00:21
649500 -- (-310.483) [-308.239] (-310.281) (-310.828) * [-307.590] (-306.538) (-308.093) (-310.799) -- 0:00:21
650000 -- (-308.296) (-309.597) (-308.804) [-307.213] * (-307.516) (-311.802) [-311.108] (-308.825) -- 0:00:21
Average standard deviation of split frequencies: 0.009735
650500 -- [-310.001] (-306.509) (-308.432) (-307.629) * [-308.164] (-311.292) (-308.086) (-308.901) -- 0:00:20
651000 -- (-309.050) (-307.053) (-310.024) [-307.041] * (-310.378) (-307.344) (-308.221) [-307.029] -- 0:00:20
651500 -- [-310.008] (-306.960) (-314.511) (-309.247) * (-309.715) (-307.659) [-307.388] (-308.524) -- 0:00:20
652000 -- (-307.194) [-311.637] (-308.286) (-309.688) * [-310.563] (-308.822) (-310.969) (-308.692) -- 0:00:20
652500 -- (-310.785) [-307.436] (-314.692) (-308.074) * [-309.518] (-308.464) (-307.573) (-310.587) -- 0:00:20
653000 -- (-314.274) (-307.303) (-310.690) [-309.833] * [-309.825] (-311.056) (-307.255) (-312.692) -- 0:00:20
653500 -- (-313.484) [-308.071] (-310.139) (-311.068) * (-309.147) (-308.531) (-312.954) [-309.409] -- 0:00:20
654000 -- (-309.191) (-307.742) (-313.160) [-309.445] * (-311.398) (-309.198) (-311.797) [-309.115] -- 0:00:20
654500 -- (-307.528) (-308.043) [-312.652] (-308.029) * (-308.036) (-306.964) (-309.092) [-310.729] -- 0:00:20
655000 -- (-308.636) (-309.426) (-308.863) [-308.161] * (-309.330) (-314.934) [-310.574] (-311.976) -- 0:00:20
Average standard deviation of split frequencies: 0.010060
655500 -- (-307.523) [-311.834] (-307.178) (-306.986) * [-309.508] (-307.214) (-312.948) (-312.279) -- 0:00:20
656000 -- (-309.493) (-307.098) (-308.438) [-308.014] * (-309.655) [-306.755] (-309.402) (-307.541) -- 0:00:20
656500 -- [-308.075] (-308.065) (-311.412) (-308.816) * (-307.371) (-307.032) [-308.706] (-310.242) -- 0:00:20
657000 -- (-309.020) (-308.261) (-309.034) [-309.831] * (-309.970) (-308.270) [-307.906] (-307.946) -- 0:00:20
657500 -- (-312.129) (-314.903) [-306.522] (-308.775) * (-311.306) (-308.138) [-309.549] (-308.047) -- 0:00:20
658000 -- (-310.649) [-311.108] (-307.190) (-307.792) * (-309.424) [-308.898] (-307.894) (-309.647) -- 0:00:20
658500 -- (-307.574) [-309.731] (-309.465) (-310.219) * (-308.979) (-309.336) [-308.371] (-310.585) -- 0:00:20
659000 -- (-307.678) (-310.577) [-309.859] (-309.344) * (-308.535) [-307.532] (-307.519) (-308.680) -- 0:00:20
659500 -- (-307.711) [-307.931] (-308.251) (-313.490) * [-308.246] (-308.910) (-307.851) (-308.484) -- 0:00:20
660000 -- (-308.592) (-308.745) [-309.208] (-308.460) * (-308.071) [-307.662] (-311.937) (-309.318) -- 0:00:20
Average standard deviation of split frequencies: 0.010614
660500 -- (-308.654) (-308.303) (-307.160) [-308.403] * [-309.434] (-306.397) (-309.830) (-307.809) -- 0:00:20
661000 -- (-310.688) (-310.561) (-308.433) [-309.236] * (-307.508) (-309.556) (-314.058) [-308.345] -- 0:00:20
661500 -- [-307.060] (-308.473) (-309.909) (-309.224) * (-309.670) [-307.075] (-307.647) (-308.774) -- 0:00:19
662000 -- (-308.687) (-310.610) [-309.890] (-307.398) * [-307.146] (-311.542) (-308.482) (-309.244) -- 0:00:19
662500 -- (-309.354) [-310.148] (-314.586) (-308.443) * (-308.684) (-313.925) (-314.330) [-310.816] -- 0:00:20
663000 -- (-308.385) [-308.955] (-308.840) (-308.749) * [-306.686] (-309.119) (-309.692) (-311.256) -- 0:00:20
663500 -- [-311.137] (-309.495) (-308.267) (-311.281) * [-309.904] (-310.893) (-312.088) (-307.535) -- 0:00:20
664000 -- (-307.258) (-309.489) (-308.137) [-312.137] * (-310.843) [-309.595] (-309.766) (-314.551) -- 0:00:20
664500 -- [-307.158] (-311.518) (-311.271) (-307.954) * (-306.753) (-307.210) (-308.648) [-307.975] -- 0:00:20
665000 -- (-308.056) (-312.084) [-306.982] (-311.975) * (-308.417) (-307.005) [-307.244] (-308.328) -- 0:00:20
Average standard deviation of split frequencies: 0.010352
665500 -- (-310.481) (-311.946) (-307.487) [-309.115] * (-310.635) [-309.552] (-308.927) (-307.227) -- 0:00:20
666000 -- (-307.879) [-307.211] (-309.574) (-307.003) * [-307.565] (-307.640) (-306.940) (-309.098) -- 0:00:20
666500 -- (-312.389) (-309.533) (-308.480) [-308.124] * (-307.712) (-308.560) [-308.767] (-307.408) -- 0:00:20
667000 -- [-311.262] (-312.680) (-309.734) (-307.985) * (-307.449) [-310.081] (-310.891) (-308.546) -- 0:00:19
667500 -- (-309.650) (-308.011) [-309.572] (-307.186) * (-308.903) [-309.861] (-309.085) (-310.274) -- 0:00:19
668000 -- (-306.522) (-308.550) (-312.794) [-307.243] * [-307.378] (-309.416) (-308.380) (-308.675) -- 0:00:19
668500 -- (-306.759) [-311.414] (-307.958) (-309.454) * (-309.852) (-309.096) (-307.073) [-308.731] -- 0:00:19
669000 -- (-306.886) (-310.157) [-307.816] (-307.603) * (-309.225) (-308.919) [-309.298] (-310.884) -- 0:00:19
669500 -- [-309.152] (-307.763) (-307.968) (-308.254) * (-308.979) (-309.627) (-308.439) [-310.123] -- 0:00:19
670000 -- (-308.043) (-307.747) [-311.650] (-307.181) * (-308.232) (-312.062) (-308.209) [-309.260] -- 0:00:19
Average standard deviation of split frequencies: 0.010280
670500 -- (-307.943) [-310.193] (-312.674) (-309.284) * (-309.335) (-308.080) [-310.010] (-308.182) -- 0:00:19
671000 -- [-310.521] (-308.213) (-311.957) (-311.089) * (-307.741) (-308.227) (-312.182) [-306.940] -- 0:00:19
671500 -- (-311.374) [-308.552] (-307.952) (-308.178) * (-309.783) (-309.383) [-308.942] (-308.431) -- 0:00:19
672000 -- (-309.092) [-308.019] (-308.338) (-311.255) * (-308.812) (-310.508) (-308.425) [-307.884] -- 0:00:19
672500 -- (-308.553) (-308.288) (-309.144) [-308.122] * (-308.190) (-308.436) (-307.533) [-307.129] -- 0:00:19
673000 -- (-306.961) (-308.039) [-308.489] (-307.469) * (-310.573) [-307.382] (-308.350) (-308.430) -- 0:00:19
673500 -- (-307.876) (-309.076) (-308.573) [-309.195] * (-310.653) [-308.363] (-308.853) (-310.361) -- 0:00:19
674000 -- [-309.634] (-309.185) (-307.756) (-310.196) * [-313.477] (-308.900) (-313.826) (-309.569) -- 0:00:19
674500 -- (-309.987) (-307.962) [-307.856] (-310.856) * (-309.741) [-311.283] (-311.565) (-306.586) -- 0:00:19
675000 -- [-308.141] (-307.229) (-307.958) (-312.250) * (-311.159) [-308.312] (-308.658) (-309.310) -- 0:00:19
Average standard deviation of split frequencies: 0.010373
675500 -- (-307.646) (-309.236) [-307.483] (-308.913) * (-310.792) [-308.247] (-307.773) (-309.490) -- 0:00:19
676000 -- (-308.337) [-310.474] (-310.821) (-308.729) * (-306.507) (-309.691) (-309.319) [-310.731] -- 0:00:19
676500 -- [-307.556] (-310.117) (-313.182) (-307.999) * (-306.703) (-308.600) (-307.312) [-308.599] -- 0:00:19
677000 -- (-308.179) (-310.097) [-309.198] (-308.803) * (-307.017) (-308.610) (-311.860) [-307.406] -- 0:00:19
677500 -- (-310.777) (-309.444) [-306.943] (-314.831) * (-307.453) (-310.746) [-306.873] (-310.913) -- 0:00:19
678000 -- (-309.846) (-307.228) (-307.796) [-308.679] * (-309.989) (-310.986) [-306.899] (-309.484) -- 0:00:18
678500 -- (-308.625) (-308.595) [-306.778] (-312.363) * (-310.571) (-309.407) (-308.259) [-308.786] -- 0:00:18
679000 -- (-308.707) [-308.808] (-311.177) (-310.448) * (-309.974) [-306.817] (-307.533) (-308.470) -- 0:00:18
679500 -- [-311.021] (-312.254) (-306.574) (-307.641) * (-309.186) [-313.309] (-307.034) (-313.027) -- 0:00:19
680000 -- (-308.307) [-307.413] (-306.781) (-306.866) * [-309.000] (-310.578) (-307.550) (-314.079) -- 0:00:19
Average standard deviation of split frequencies: 0.010042
680500 -- (-307.022) (-307.870) [-306.641] (-310.228) * (-308.335) [-309.321] (-309.198) (-308.622) -- 0:00:19
681000 -- (-308.920) (-313.483) [-306.580] (-311.433) * [-311.492] (-307.962) (-307.740) (-310.318) -- 0:00:19
681500 -- [-307.158] (-311.164) (-308.867) (-308.368) * [-307.606] (-308.513) (-308.628) (-307.516) -- 0:00:19
682000 -- (-308.560) (-307.744) [-306.730] (-309.966) * (-308.214) [-309.852] (-308.038) (-307.313) -- 0:00:19
682500 -- (-307.521) [-310.851] (-309.109) (-308.582) * (-308.376) (-309.486) (-308.189) [-308.231] -- 0:00:19
683000 -- (-307.678) [-308.721] (-307.177) (-308.707) * (-309.564) (-309.521) [-309.125] (-309.874) -- 0:00:19
683500 -- (-307.987) [-308.439] (-307.794) (-307.689) * (-311.119) (-309.860) (-307.894) [-309.520] -- 0:00:18
684000 -- (-307.418) (-308.291) [-310.387] (-310.403) * (-309.304) (-306.951) [-308.376] (-311.126) -- 0:00:18
684500 -- (-307.582) (-309.862) (-311.847) [-308.051] * (-308.499) [-306.887] (-306.894) (-309.560) -- 0:00:18
685000 -- (-309.359) (-310.065) (-308.340) [-307.569] * (-312.627) (-306.888) [-307.847] (-310.773) -- 0:00:18
Average standard deviation of split frequencies: 0.010007
685500 -- (-311.747) (-308.755) (-309.445) [-308.180] * (-309.140) [-307.938] (-307.174) (-312.947) -- 0:00:18
686000 -- (-307.243) (-310.646) [-307.669] (-309.855) * (-309.777) (-307.573) (-308.196) [-309.420] -- 0:00:18
686500 -- [-310.367] (-307.860) (-310.615) (-312.413) * (-310.605) [-307.579] (-307.574) (-312.991) -- 0:00:18
687000 -- (-311.269) (-314.275) [-309.086] (-309.003) * (-310.169) [-309.217] (-307.601) (-308.374) -- 0:00:18
687500 -- (-309.798) [-308.668] (-309.295) (-306.404) * (-309.394) (-306.748) (-309.231) [-308.562] -- 0:00:18
688000 -- (-309.464) (-308.268) (-309.520) [-308.598] * (-309.805) (-308.213) [-308.381] (-309.168) -- 0:00:18
688500 -- (-313.142) [-309.325] (-309.510) (-310.023) * (-311.276) (-310.121) (-307.904) [-309.555] -- 0:00:18
689000 -- (-307.313) [-308.797] (-307.193) (-309.688) * (-308.717) [-307.379] (-307.877) (-313.051) -- 0:00:18
689500 -- (-311.594) (-311.305) [-308.166] (-308.681) * (-308.728) [-308.567] (-310.044) (-308.978) -- 0:00:18
690000 -- (-310.669) (-307.549) (-308.954) [-309.253] * (-309.541) [-308.381] (-312.818) (-311.583) -- 0:00:18
Average standard deviation of split frequencies: 0.009811
690500 -- [-309.197] (-309.457) (-307.920) (-306.760) * (-311.407) (-307.565) [-313.328] (-307.986) -- 0:00:18
691000 -- (-310.957) (-306.522) [-311.227] (-308.108) * [-309.614] (-310.323) (-307.136) (-309.823) -- 0:00:18
691500 -- (-309.064) (-309.243) (-309.630) [-307.306] * (-308.587) (-309.304) [-308.480] (-309.949) -- 0:00:18
692000 -- (-308.828) [-311.692] (-308.957) (-308.190) * [-308.026] (-306.841) (-309.881) (-310.372) -- 0:00:18
692500 -- (-307.830) (-309.075) [-310.366] (-306.968) * (-308.872) [-307.805] (-317.894) (-309.451) -- 0:00:18
693000 -- [-311.049] (-307.653) (-309.343) (-308.287) * (-308.248) (-306.742) [-306.871] (-309.389) -- 0:00:18
693500 -- (-309.050) (-306.660) (-309.355) [-307.120] * (-308.068) [-306.475] (-307.411) (-309.159) -- 0:00:18
694000 -- (-307.888) [-306.648] (-311.596) (-310.958) * (-307.459) (-309.891) [-308.558] (-310.703) -- 0:00:18
694500 -- (-312.185) [-307.966] (-309.900) (-307.616) * (-310.334) (-308.639) (-307.205) [-310.538] -- 0:00:18
695000 -- (-311.511) (-309.023) [-306.762] (-310.548) * (-309.057) (-307.877) [-307.112] (-316.862) -- 0:00:17
Average standard deviation of split frequencies: 0.009990
695500 -- (-307.716) [-309.113] (-306.768) (-312.195) * [-308.695] (-308.557) (-310.116) (-308.405) -- 0:00:17
696000 -- (-308.764) (-308.870) [-306.448] (-313.227) * [-307.684] (-309.288) (-307.111) (-308.694) -- 0:00:17
696500 -- (-309.387) (-308.478) (-307.320) [-307.642] * [-308.168] (-308.027) (-308.287) (-309.689) -- 0:00:18
697000 -- (-307.367) (-307.995) [-307.743] (-307.234) * (-308.692) (-309.049) (-309.154) [-311.595] -- 0:00:18
697500 -- (-307.337) [-308.217] (-308.126) (-307.748) * [-310.224] (-307.687) (-310.174) (-308.255) -- 0:00:18
698000 -- (-316.095) [-310.053] (-309.610) (-307.764) * (-307.919) (-308.756) (-306.970) [-308.848] -- 0:00:18
698500 -- (-314.853) (-307.408) [-307.013] (-312.010) * (-309.602) (-307.719) [-306.615] (-308.054) -- 0:00:18
699000 -- (-309.004) (-306.909) (-306.550) [-309.600] * (-307.718) (-309.493) (-308.387) [-310.716] -- 0:00:18
699500 -- [-307.434] (-310.176) (-308.361) (-311.668) * (-306.978) [-307.551] (-307.085) (-307.919) -- 0:00:18
700000 -- (-308.914) (-308.884) [-313.200] (-308.559) * (-309.029) (-306.994) [-307.163] (-309.488) -- 0:00:18
Average standard deviation of split frequencies: 0.010218
700500 -- (-311.917) [-307.499] (-306.783) (-309.664) * (-308.332) (-310.856) (-307.538) [-308.856] -- 0:00:17
701000 -- (-307.698) [-312.924] (-308.048) (-311.060) * [-307.076] (-310.676) (-310.442) (-309.789) -- 0:00:17
701500 -- (-306.989) (-308.025) (-308.157) [-307.969] * [-308.649] (-307.952) (-310.993) (-307.486) -- 0:00:17
702000 -- (-308.319) (-312.539) [-308.199] (-307.607) * (-306.497) (-307.625) [-306.855] (-307.293) -- 0:00:17
702500 -- (-308.869) (-308.014) (-308.908) [-307.605] * (-307.475) [-308.355] (-307.417) (-308.015) -- 0:00:17
703000 -- [-307.636] (-307.758) (-309.738) (-310.040) * (-307.573) [-308.121] (-313.722) (-307.729) -- 0:00:17
703500 -- (-307.066) [-307.149] (-307.439) (-310.294) * (-307.587) [-307.308] (-308.205) (-310.887) -- 0:00:17
704000 -- [-311.166] (-311.389) (-311.220) (-308.388) * (-310.152) (-307.455) [-307.468] (-307.407) -- 0:00:17
704500 -- (-312.717) (-309.222) (-310.692) [-309.525] * (-308.254) (-310.530) [-307.154] (-310.035) -- 0:00:17
705000 -- (-308.890) (-306.641) (-307.382) [-307.574] * (-307.415) [-311.122] (-308.193) (-308.420) -- 0:00:17
Average standard deviation of split frequencies: 0.010141
705500 -- (-317.765) [-307.223] (-310.700) (-307.687) * [-307.620] (-308.606) (-308.537) (-307.299) -- 0:00:17
706000 -- (-311.623) [-309.485] (-312.790) (-307.498) * (-307.810) (-310.408) (-308.263) [-309.714] -- 0:00:17
706500 -- (-308.656) [-314.094] (-309.836) (-311.814) * (-308.422) (-307.679) (-311.012) [-309.896] -- 0:00:17
707000 -- (-308.729) (-308.336) (-307.925) [-309.821] * (-308.699) (-307.475) (-307.619) [-307.961] -- 0:00:17
707500 -- [-306.941] (-307.387) (-309.771) (-307.627) * (-307.324) (-307.421) [-309.570] (-310.625) -- 0:00:17
708000 -- (-307.861) (-307.997) (-307.213) [-309.493] * [-308.270] (-307.871) (-313.195) (-307.079) -- 0:00:17
708500 -- (-313.217) (-310.237) (-312.815) [-308.757] * (-307.577) (-310.249) [-313.499] (-308.497) -- 0:00:17
709000 -- (-309.327) [-309.058] (-309.335) (-307.653) * (-306.886) (-311.929) (-310.150) [-311.129] -- 0:00:17
709500 -- (-307.813) (-308.818) [-309.568] (-308.212) * (-306.880) (-312.754) [-309.406] (-312.221) -- 0:00:17
710000 -- (-310.601) [-308.650] (-311.581) (-307.480) * (-309.746) (-307.970) (-307.964) [-311.313] -- 0:00:17
Average standard deviation of split frequencies: 0.010447
710500 -- [-309.747] (-308.314) (-309.197) (-308.813) * (-307.831) (-307.810) (-308.185) [-309.283] -- 0:00:17
711000 -- [-312.216] (-309.388) (-309.317) (-308.760) * (-307.633) (-308.150) (-307.445) [-309.550] -- 0:00:17
711500 -- [-309.096] (-310.083) (-308.552) (-310.407) * (-309.158) (-311.588) (-307.887) [-309.421] -- 0:00:17
712000 -- (-308.131) (-309.011) [-308.803] (-310.222) * [-308.787] (-310.063) (-312.063) (-312.415) -- 0:00:16
712500 -- [-306.972] (-307.206) (-310.412) (-306.964) * (-308.055) [-307.896] (-307.589) (-307.644) -- 0:00:16
713000 -- (-308.657) (-309.253) [-306.908] (-308.626) * [-307.744] (-311.288) (-307.069) (-308.206) -- 0:00:16
713500 -- (-310.857) (-306.543) [-308.944] (-310.417) * (-308.725) (-310.690) (-310.060) [-309.395] -- 0:00:16
714000 -- (-312.426) (-309.593) [-310.854] (-310.260) * (-307.243) [-306.817] (-311.025) (-308.616) -- 0:00:17
714500 -- (-311.197) [-312.172] (-309.734) (-309.571) * [-308.096] (-307.404) (-307.151) (-308.897) -- 0:00:17
715000 -- (-307.862) (-308.598) (-311.169) [-307.553] * (-308.087) (-314.723) [-307.951] (-309.310) -- 0:00:17
Average standard deviation of split frequencies: 0.010411
715500 -- (-308.071) (-308.234) (-306.949) [-307.347] * (-307.170) (-313.640) (-309.819) [-307.248] -- 0:00:17
716000 -- [-308.045] (-309.816) (-309.296) (-306.799) * [-307.528] (-309.980) (-307.047) (-308.127) -- 0:00:17
716500 -- [-308.671] (-312.300) (-308.827) (-307.307) * [-307.108] (-308.530) (-308.496) (-308.130) -- 0:00:17
717000 -- [-307.394] (-308.423) (-307.282) (-306.719) * [-309.183] (-307.390) (-307.313) (-307.143) -- 0:00:16
717500 -- (-306.690) (-307.451) [-306.438] (-308.845) * [-306.883] (-306.938) (-310.749) (-308.130) -- 0:00:16
718000 -- (-309.604) [-307.507] (-310.222) (-310.037) * (-310.540) (-306.532) [-307.830] (-312.611) -- 0:00:16
718500 -- (-311.691) (-308.842) [-312.568] (-310.469) * (-307.136) (-306.976) (-308.799) [-309.441] -- 0:00:16
719000 -- [-309.659] (-307.478) (-316.673) (-307.375) * (-307.754) (-306.737) (-310.055) [-309.253] -- 0:00:16
719500 -- (-309.210) (-308.811) [-310.822] (-308.870) * (-314.305) [-307.901] (-313.613) (-307.627) -- 0:00:16
720000 -- (-308.421) [-308.909] (-312.594) (-313.387) * (-308.425) [-307.730] (-313.688) (-308.857) -- 0:00:16
Average standard deviation of split frequencies: 0.010629
720500 -- (-307.703) (-307.985) [-308.065] (-309.496) * [-310.971] (-307.055) (-311.569) (-308.778) -- 0:00:16
721000 -- (-307.718) (-307.053) (-308.396) [-310.844] * (-307.234) [-312.219] (-310.906) (-307.227) -- 0:00:16
721500 -- (-310.318) [-311.071] (-309.860) (-311.592) * (-310.958) [-306.543] (-309.458) (-307.514) -- 0:00:16
722000 -- (-307.621) (-311.274) (-309.674) [-308.580] * (-310.556) (-306.618) [-307.617] (-310.779) -- 0:00:16
722500 -- (-309.128) [-309.126] (-308.394) (-310.752) * [-307.259] (-307.679) (-307.467) (-309.252) -- 0:00:16
723000 -- [-307.064] (-309.539) (-308.398) (-308.768) * (-311.124) [-307.505] (-308.380) (-310.943) -- 0:00:16
723500 -- (-313.012) (-307.434) [-309.842] (-308.893) * (-315.127) [-310.537] (-309.378) (-307.151) -- 0:00:16
724000 -- [-308.282] (-307.850) (-311.727) (-307.628) * (-308.769) [-309.217] (-309.044) (-309.568) -- 0:00:16
724500 -- (-313.631) (-307.765) (-313.439) [-308.108] * (-309.441) [-307.711] (-309.473) (-309.823) -- 0:00:16
725000 -- (-308.457) (-308.157) [-309.138] (-308.953) * (-309.616) (-309.904) (-309.022) [-308.279] -- 0:00:16
Average standard deviation of split frequencies: 0.010024
725500 -- [-307.192] (-308.322) (-309.801) (-309.241) * (-309.713) (-308.148) (-311.724) [-308.495] -- 0:00:16
726000 -- (-306.664) (-310.697) (-308.434) [-308.574] * (-311.298) (-308.503) (-308.480) [-307.409] -- 0:00:16
726500 -- (-311.255) [-308.057] (-308.338) (-307.983) * [-310.316] (-308.270) (-311.228) (-310.639) -- 0:00:16
727000 -- [-308.450] (-307.116) (-309.574) (-308.019) * (-312.332) (-308.814) [-307.703] (-311.795) -- 0:00:16
727500 -- (-312.180) [-307.669] (-309.868) (-309.079) * (-307.211) [-309.301] (-308.631) (-310.258) -- 0:00:16
728000 -- (-308.158) [-307.996] (-307.591) (-306.900) * [-313.191] (-308.003) (-312.793) (-307.875) -- 0:00:16
728500 -- (-310.307) (-309.235) [-308.124] (-308.024) * [-307.025] (-308.041) (-311.784) (-319.864) -- 0:00:16
729000 -- (-306.599) (-307.800) [-308.157] (-309.621) * [-307.943] (-308.011) (-309.344) (-314.748) -- 0:00:15
729500 -- (-307.213) (-307.383) [-307.197] (-312.984) * (-306.815) [-307.088] (-306.861) (-308.347) -- 0:00:15
730000 -- [-312.586] (-308.069) (-308.225) (-309.692) * [-309.775] (-307.062) (-309.274) (-313.156) -- 0:00:15
Average standard deviation of split frequencies: 0.010000
730500 -- (-308.355) [-307.432] (-310.013) (-311.476) * (-308.828) [-311.414] (-310.314) (-309.488) -- 0:00:16
731000 -- [-308.405] (-308.065) (-307.476) (-312.859) * (-308.045) [-309.116] (-310.585) (-310.601) -- 0:00:16
731500 -- [-309.125] (-307.474) (-306.739) (-315.095) * (-306.662) (-308.225) [-312.559] (-308.712) -- 0:00:16
732000 -- (-309.789) (-307.732) [-310.220] (-311.052) * (-307.309) (-307.198) [-312.538] (-309.291) -- 0:00:16
732500 -- (-312.470) [-309.007] (-310.229) (-310.382) * [-308.177] (-307.711) (-309.698) (-309.226) -- 0:00:16
733000 -- [-309.072] (-310.200) (-307.069) (-308.111) * (-306.470) (-309.121) [-307.307] (-309.556) -- 0:00:16
733500 -- (-309.117) (-309.345) (-309.533) [-307.908] * [-310.277] (-307.266) (-306.609) (-310.174) -- 0:00:15
734000 -- (-310.250) (-308.123) [-308.573] (-306.739) * (-310.193) (-306.871) [-306.478] (-311.328) -- 0:00:15
734500 -- (-311.416) (-309.971) [-307.194] (-306.814) * [-307.578] (-309.659) (-309.038) (-307.954) -- 0:00:15
735000 -- [-308.078] (-312.456) (-310.672) (-308.862) * (-308.911) (-308.878) (-308.357) [-307.167] -- 0:00:15
Average standard deviation of split frequencies: 0.010288
735500 -- (-309.072) (-310.161) (-308.930) [-310.403] * [-309.554] (-312.917) (-307.328) (-309.814) -- 0:00:15
736000 -- (-309.796) (-308.582) [-309.082] (-312.447) * (-310.560) [-309.237] (-310.325) (-309.235) -- 0:00:15
736500 -- (-309.922) (-307.672) [-307.638] (-309.843) * [-307.077] (-310.837) (-309.981) (-318.081) -- 0:00:15
737000 -- (-309.434) (-315.660) (-308.686) [-307.553] * (-309.051) (-312.938) (-314.887) [-307.564] -- 0:00:15
737500 -- [-308.628] (-308.311) (-308.633) (-310.506) * [-311.262] (-307.795) (-311.604) (-311.884) -- 0:00:15
738000 -- (-307.665) (-309.595) [-311.212] (-309.488) * [-307.377] (-310.359) (-307.147) (-307.629) -- 0:00:15
738500 -- [-312.395] (-307.725) (-308.118) (-307.548) * (-306.662) (-309.058) (-307.058) [-311.652] -- 0:00:15
739000 -- (-309.374) (-306.869) (-309.474) [-307.417] * (-309.505) [-307.706] (-307.698) (-311.659) -- 0:00:15
739500 -- (-307.701) (-306.725) (-308.024) [-307.158] * (-308.626) (-308.383) (-309.730) [-308.895] -- 0:00:15
740000 -- (-309.979) (-309.982) [-308.727] (-311.769) * (-313.123) (-307.630) [-307.565] (-311.489) -- 0:00:15
Average standard deviation of split frequencies: 0.010303
740500 -- (-307.156) [-308.824] (-311.202) (-311.755) * (-307.507) [-310.175] (-311.833) (-306.792) -- 0:00:15
741000 -- (-310.965) [-307.518] (-310.846) (-309.439) * (-311.668) (-307.337) [-309.073] (-307.918) -- 0:00:15
741500 -- (-308.416) (-312.105) (-310.120) [-308.181] * (-307.669) (-309.662) (-307.791) [-309.568] -- 0:00:15
742000 -- [-309.470] (-306.924) (-306.803) (-309.432) * [-308.648] (-309.454) (-308.464) (-308.865) -- 0:00:15
742500 -- (-307.500) (-308.317) [-307.167] (-310.799) * (-307.251) (-308.960) [-308.251] (-310.261) -- 0:00:15
743000 -- (-307.358) [-307.382] (-306.750) (-308.274) * (-306.754) (-307.952) (-307.010) [-308.300] -- 0:00:15
743500 -- (-307.764) (-316.583) [-313.194] (-310.622) * [-308.481] (-318.265) (-307.234) (-307.162) -- 0:00:15
744000 -- (-308.425) [-307.494] (-311.066) (-311.439) * [-307.734] (-307.851) (-310.336) (-309.148) -- 0:00:15
744500 -- [-310.111] (-308.359) (-310.635) (-312.334) * (-308.621) (-307.606) [-311.445] (-309.920) -- 0:00:15
745000 -- (-311.748) [-307.188] (-310.233) (-308.072) * (-308.838) [-308.699] (-309.140) (-309.937) -- 0:00:15
Average standard deviation of split frequencies: 0.010150
745500 -- (-311.961) [-307.171] (-310.008) (-307.141) * (-310.735) (-309.543) [-308.843] (-308.009) -- 0:00:15
746000 -- [-313.051] (-307.618) (-307.106) (-308.009) * (-306.583) (-306.953) [-307.759] (-307.116) -- 0:00:14
746500 -- (-306.941) (-308.391) (-308.823) [-308.163] * (-309.211) [-307.945] (-307.000) (-307.990) -- 0:00:14
747000 -- (-306.966) [-310.210] (-312.963) (-307.505) * (-312.181) [-307.359] (-306.657) (-307.711) -- 0:00:14
747500 -- (-308.336) (-309.205) (-312.917) [-307.635] * [-311.660] (-307.468) (-308.734) (-309.003) -- 0:00:15
748000 -- (-309.356) [-310.345] (-312.900) (-309.908) * (-307.888) (-310.944) [-309.036] (-308.221) -- 0:00:15
748500 -- (-310.114) [-308.200] (-309.873) (-309.331) * (-311.836) (-310.375) [-307.870] (-307.087) -- 0:00:15
749000 -- (-310.603) (-310.997) (-307.020) [-308.978] * (-310.110) (-308.082) (-307.850) [-307.684] -- 0:00:15
749500 -- (-309.703) (-309.986) [-307.381] (-308.650) * (-309.732) (-311.911) [-308.803] (-307.854) -- 0:00:15
750000 -- [-306.815] (-308.548) (-307.810) (-311.002) * (-308.536) (-311.600) (-309.175) [-306.306] -- 0:00:15
Average standard deviation of split frequencies: 0.010131
750500 -- [-307.036] (-312.656) (-309.839) (-309.630) * (-308.332) (-307.746) [-308.867] (-306.329) -- 0:00:14
751000 -- (-308.061) (-309.953) [-308.214] (-307.765) * (-309.139) (-311.689) (-310.692) [-307.696] -- 0:00:14
751500 -- [-306.651] (-310.499) (-310.310) (-309.920) * (-309.907) (-311.587) [-309.945] (-309.228) -- 0:00:14
752000 -- (-307.104) [-311.881] (-308.552) (-309.749) * [-308.526] (-309.967) (-307.180) (-306.856) -- 0:00:14
752500 -- [-307.222] (-306.747) (-308.485) (-311.640) * [-309.801] (-318.768) (-307.926) (-308.136) -- 0:00:14
753000 -- (-306.817) [-307.503] (-310.061) (-307.747) * (-308.663) (-315.913) (-307.306) [-310.860] -- 0:00:14
753500 -- (-308.042) (-307.396) (-309.065) [-309.098] * [-307.235] (-314.087) (-307.600) (-306.890) -- 0:00:14
754000 -- (-308.112) [-308.417] (-309.952) (-309.382) * (-307.916) (-311.727) [-307.882] (-307.332) -- 0:00:14
754500 -- (-308.982) [-307.654] (-312.051) (-313.829) * (-310.601) [-308.168] (-308.747) (-310.342) -- 0:00:14
755000 -- [-309.264] (-310.578) (-311.111) (-310.285) * [-307.266] (-308.322) (-308.238) (-309.690) -- 0:00:14
Average standard deviation of split frequencies: 0.010060
755500 -- (-308.688) (-307.653) (-308.394) [-308.855] * (-315.391) (-309.703) [-308.564] (-308.329) -- 0:00:14
756000 -- (-311.987) (-309.968) [-309.573] (-308.447) * (-310.614) (-310.289) (-308.501) [-307.334] -- 0:00:14
756500 -- [-309.185] (-307.923) (-308.641) (-309.836) * (-309.984) (-308.515) (-310.072) [-308.951] -- 0:00:14
757000 -- [-309.745] (-310.147) (-309.526) (-307.619) * [-307.286] (-308.457) (-308.044) (-308.598) -- 0:00:14
757500 -- (-309.358) [-307.926] (-310.291) (-308.753) * (-307.489) (-309.292) [-308.143] (-306.889) -- 0:00:14
758000 -- (-309.154) (-309.179) (-310.475) [-310.367] * (-309.998) [-313.097] (-313.231) (-309.879) -- 0:00:14
758500 -- (-308.155) (-317.239) (-309.344) [-307.853] * (-311.786) [-306.320] (-312.154) (-308.098) -- 0:00:14
759000 -- [-307.906] (-313.880) (-315.798) (-309.271) * [-310.462] (-308.711) (-311.910) (-309.270) -- 0:00:14
759500 -- (-313.747) (-308.314) (-313.957) [-308.638] * [-308.088] (-308.189) (-308.431) (-314.989) -- 0:00:14
760000 -- (-307.406) [-308.387] (-309.558) (-312.995) * (-311.373) (-309.355) [-308.715] (-309.824) -- 0:00:14
Average standard deviation of split frequencies: 0.010264
760500 -- (-308.194) (-310.769) [-308.815] (-311.894) * (-308.193) [-308.657] (-308.680) (-309.915) -- 0:00:14
761000 -- (-310.110) (-310.599) (-312.888) [-308.809] * (-307.427) [-306.975] (-308.091) (-310.991) -- 0:00:14
761500 -- (-312.262) [-308.549] (-308.300) (-310.730) * [-306.520] (-309.095) (-308.067) (-308.427) -- 0:00:14
762000 -- (-310.015) (-308.261) [-308.287] (-309.525) * (-307.200) [-308.616] (-309.331) (-306.895) -- 0:00:14
762500 -- (-310.447) (-308.085) [-309.330] (-308.178) * (-308.464) (-306.570) [-309.442] (-308.593) -- 0:00:14
763000 -- (-311.229) [-308.504] (-314.110) (-308.934) * (-307.814) [-308.523] (-311.634) (-307.227) -- 0:00:13
763500 -- (-307.314) (-310.564) (-310.335) [-307.606] * [-309.071] (-314.302) (-312.188) (-307.128) -- 0:00:13
764000 -- (-308.928) (-308.869) (-306.910) [-306.947] * [-308.613] (-310.132) (-309.414) (-311.773) -- 0:00:13
764500 -- (-307.667) (-309.615) [-312.341] (-307.448) * (-306.503) [-307.398] (-308.580) (-312.291) -- 0:00:14
765000 -- (-308.091) [-308.171] (-310.465) (-309.400) * [-308.651] (-309.262) (-312.247) (-310.199) -- 0:00:14
Average standard deviation of split frequencies: 0.009577
765500 -- (-313.149) (-308.583) [-310.213] (-309.678) * (-309.175) [-310.114] (-310.211) (-307.921) -- 0:00:14
766000 -- (-307.278) [-307.638] (-312.520) (-307.536) * (-306.910) [-307.397] (-310.917) (-307.736) -- 0:00:14
766500 -- [-308.592] (-306.937) (-314.908) (-309.817) * (-306.609) (-309.863) [-307.781] (-307.433) -- 0:00:14
767000 -- (-308.144) [-307.894] (-309.053) (-307.745) * (-306.866) (-309.058) (-311.072) [-308.119] -- 0:00:13
767500 -- (-315.393) [-309.284] (-311.815) (-308.841) * (-308.130) (-308.550) (-306.999) [-308.315] -- 0:00:13
768000 -- (-307.741) (-306.913) (-309.814) [-307.463] * [-307.658] (-308.405) (-307.408) (-307.905) -- 0:00:13
768500 -- [-308.972] (-309.735) (-307.968) (-308.860) * (-308.255) (-308.555) (-312.551) [-308.774] -- 0:00:13
769000 -- [-306.449] (-313.072) (-310.836) (-306.915) * (-308.287) [-307.628] (-307.988) (-310.550) -- 0:00:13
769500 -- (-307.236) (-307.257) (-307.011) [-306.909] * (-314.026) [-310.465] (-307.942) (-309.026) -- 0:00:13
770000 -- [-312.561] (-309.137) (-310.398) (-306.877) * (-311.775) [-311.115] (-307.670) (-309.250) -- 0:00:13
Average standard deviation of split frequencies: 0.009596
770500 -- (-308.946) (-307.692) (-308.537) [-308.224] * [-310.856] (-309.526) (-307.766) (-307.072) -- 0:00:13
771000 -- (-307.971) [-309.459] (-307.324) (-307.853) * (-310.725) [-310.999] (-307.678) (-308.914) -- 0:00:13
771500 -- [-308.038] (-310.081) (-308.470) (-309.181) * (-312.546) (-307.612) [-307.772] (-308.280) -- 0:00:13
772000 -- (-310.148) (-307.811) (-306.911) [-309.528] * [-308.992] (-309.236) (-309.092) (-309.207) -- 0:00:13
772500 -- [-308.717] (-308.756) (-309.970) (-308.734) * (-308.933) (-311.271) [-308.502] (-309.827) -- 0:00:13
773000 -- (-309.787) (-308.725) (-308.264) [-306.934] * (-307.574) [-308.107] (-307.678) (-313.181) -- 0:00:13
773500 -- [-308.430] (-308.463) (-310.246) (-307.199) * (-309.647) [-308.581] (-310.671) (-309.996) -- 0:00:13
774000 -- (-307.229) (-310.113) (-309.949) [-308.547] * (-309.885) [-309.764] (-309.876) (-308.106) -- 0:00:13
774500 -- (-308.947) (-311.634) (-308.003) [-307.122] * (-308.548) (-308.293) [-308.534] (-307.933) -- 0:00:13
775000 -- [-307.421] (-307.378) (-307.654) (-311.765) * [-307.487] (-309.745) (-307.933) (-309.862) -- 0:00:13
Average standard deviation of split frequencies: 0.009302
775500 -- (-311.391) (-308.940) (-308.502) [-308.883] * (-307.381) (-306.867) [-307.401] (-308.162) -- 0:00:13
776000 -- (-310.798) (-307.101) [-309.376] (-312.759) * (-308.094) [-310.293] (-307.773) (-311.415) -- 0:00:13
776500 -- (-309.168) [-307.567] (-306.963) (-312.524) * (-309.168) (-308.496) (-310.995) [-310.485] -- 0:00:13
777000 -- (-309.817) [-306.731] (-306.986) (-308.556) * (-307.933) [-308.384] (-309.247) (-311.779) -- 0:00:13
777500 -- [-310.707] (-307.063) (-308.118) (-308.558) * (-307.098) (-312.589) (-310.123) [-309.168] -- 0:00:13
778000 -- (-307.178) (-308.946) [-307.329] (-312.024) * [-310.493] (-311.841) (-308.063) (-308.690) -- 0:00:13
778500 -- (-307.301) [-308.668] (-308.621) (-308.584) * (-311.747) (-314.648) [-307.548] (-311.217) -- 0:00:13
779000 -- [-307.104] (-308.628) (-307.603) (-307.944) * [-307.509] (-311.209) (-306.909) (-307.252) -- 0:00:13
779500 -- (-307.008) (-308.185) [-309.649] (-309.725) * (-310.343) (-309.711) (-310.724) [-308.220] -- 0:00:13
780000 -- (-307.438) (-314.508) (-308.328) [-307.497] * (-307.518) (-311.265) [-310.046] (-307.054) -- 0:00:12
Average standard deviation of split frequencies: 0.009322
780500 -- [-308.294] (-307.821) (-307.749) (-307.689) * (-308.360) (-310.801) (-308.863) [-309.955] -- 0:00:12
781000 -- [-314.168] (-306.583) (-308.566) (-307.618) * (-308.568) (-308.181) [-307.774] (-307.739) -- 0:00:12
781500 -- [-309.457] (-307.008) (-307.770) (-307.185) * (-309.514) (-309.147) (-306.748) [-307.312] -- 0:00:13
782000 -- (-306.657) [-306.470] (-309.198) (-307.022) * (-306.464) [-310.644] (-311.213) (-308.569) -- 0:00:13
782500 -- [-307.760] (-309.830) (-313.582) (-308.885) * (-308.078) (-307.090) (-310.847) [-307.378] -- 0:00:13
783000 -- (-308.354) (-306.545) (-308.595) [-309.910] * (-308.972) (-311.971) [-309.926] (-310.420) -- 0:00:13
783500 -- (-313.892) (-307.914) [-308.444] (-309.387) * (-310.553) (-308.810) (-308.604) [-307.822] -- 0:00:12
784000 -- (-312.815) [-309.128] (-311.038) (-309.756) * [-311.340] (-307.030) (-308.795) (-308.785) -- 0:00:12
784500 -- (-313.316) [-307.890] (-308.343) (-308.135) * (-310.266) (-307.495) (-307.026) [-306.855] -- 0:00:12
785000 -- [-308.857] (-308.195) (-310.145) (-307.537) * (-311.642) (-308.471) [-307.340] (-306.862) -- 0:00:12
Average standard deviation of split frequencies: 0.009420
785500 -- (-307.158) (-307.663) (-308.831) [-309.867] * (-313.553) (-308.742) (-307.437) [-306.821] -- 0:00:12
786000 -- [-308.693] (-306.920) (-307.049) (-314.907) * (-309.094) (-307.851) (-308.693) [-309.342] -- 0:00:12
786500 -- [-309.721] (-310.913) (-310.780) (-310.832) * [-307.868] (-310.297) (-307.852) (-307.129) -- 0:00:12
787000 -- (-311.474) (-310.650) [-307.216] (-306.965) * (-309.011) (-308.546) (-307.670) [-310.081] -- 0:00:12
787500 -- (-313.114) (-309.226) [-310.182] (-307.994) * (-311.507) (-307.820) (-308.468) [-307.459] -- 0:00:12
788000 -- (-307.321) (-308.547) [-310.473] (-307.841) * (-310.362) (-308.294) (-308.264) [-309.741] -- 0:00:12
788500 -- (-306.934) (-307.799) [-310.228] (-309.587) * (-308.817) (-310.396) (-308.041) [-308.905] -- 0:00:12
789000 -- [-308.473] (-307.679) (-309.032) (-309.809) * (-308.471) [-308.175] (-306.995) (-308.049) -- 0:00:12
789500 -- (-309.832) [-309.494] (-308.863) (-309.845) * (-306.919) [-310.047] (-311.326) (-308.778) -- 0:00:12
790000 -- (-308.509) (-307.375) (-313.822) [-308.576] * [-307.867] (-310.734) (-309.080) (-311.114) -- 0:00:12
Average standard deviation of split frequencies: 0.009577
790500 -- (-309.102) (-310.333) (-310.070) [-306.585] * (-309.700) (-311.563) [-309.540] (-307.788) -- 0:00:12
791000 -- [-309.463] (-308.211) (-309.777) (-306.796) * (-307.558) [-310.696] (-312.979) (-306.573) -- 0:00:12
791500 -- (-310.492) (-307.784) [-309.123] (-308.338) * (-306.734) [-308.669] (-312.179) (-308.993) -- 0:00:12
792000 -- (-315.137) [-307.299] (-311.009) (-314.006) * [-310.359] (-308.433) (-307.852) (-308.980) -- 0:00:12
792500 -- [-307.913] (-307.182) (-308.610) (-308.127) * (-309.295) (-308.206) (-308.162) [-308.733] -- 0:00:12
793000 -- (-310.168) [-312.145] (-309.209) (-308.466) * (-309.154) [-306.453] (-309.842) (-309.808) -- 0:00:12
793500 -- (-312.229) (-307.163) [-311.044] (-306.658) * (-310.742) (-307.871) (-309.322) [-307.079] -- 0:00:12
794000 -- [-309.250] (-309.599) (-308.455) (-309.413) * (-307.854) (-308.446) [-309.554] (-307.114) -- 0:00:12
794500 -- (-311.712) [-308.623] (-314.399) (-309.697) * (-307.518) (-307.267) [-307.985] (-309.736) -- 0:00:12
795000 -- (-309.483) [-308.873] (-308.123) (-316.153) * (-307.206) (-310.213) [-308.582] (-308.163) -- 0:00:12
Average standard deviation of split frequencies: 0.009441
795500 -- (-312.931) (-313.542) (-308.114) [-309.509] * (-316.690) [-307.471] (-306.776) (-308.260) -- 0:00:12
796000 -- [-310.074] (-307.952) (-307.751) (-309.109) * (-311.366) (-310.051) (-307.711) [-308.682] -- 0:00:12
796500 -- (-308.410) (-310.879) (-307.314) [-309.303] * (-313.094) (-307.610) [-307.566] (-311.050) -- 0:00:12
797000 -- [-308.324] (-308.127) (-311.698) (-311.855) * (-310.548) (-309.053) [-307.053] (-308.505) -- 0:00:11
797500 -- (-311.583) [-307.882] (-309.193) (-309.394) * (-310.745) (-311.720) [-309.982] (-307.136) -- 0:00:11
798000 -- (-308.947) [-307.877] (-312.519) (-308.547) * [-310.942] (-308.213) (-309.678) (-307.973) -- 0:00:11
798500 -- (-307.402) (-310.805) (-308.128) [-308.603] * [-310.143] (-308.632) (-313.308) (-307.127) -- 0:00:12
799000 -- (-307.341) (-310.645) [-307.012] (-307.030) * (-308.605) [-309.751] (-308.625) (-306.746) -- 0:00:12
799500 -- (-313.215) [-307.283] (-307.633) (-311.890) * [-307.019] (-311.766) (-309.508) (-308.131) -- 0:00:12
800000 -- [-311.879] (-309.723) (-308.582) (-312.055) * (-307.745) (-309.904) [-308.921] (-309.257) -- 0:00:12
Average standard deviation of split frequencies: 0.009678
800500 -- [-309.219] (-307.652) (-310.223) (-310.864) * (-307.900) (-307.642) (-308.536) [-309.748] -- 0:00:11
801000 -- [-308.227] (-311.567) (-308.012) (-310.421) * (-308.193) [-309.306] (-310.862) (-311.176) -- 0:00:11
801500 -- [-308.171] (-309.924) (-308.793) (-311.467) * (-308.939) (-308.816) [-313.515] (-309.002) -- 0:00:11
802000 -- (-309.102) (-309.152) (-307.382) [-308.616] * (-308.023) (-307.066) (-308.900) [-309.381] -- 0:00:11
802500 -- (-308.041) [-307.160] (-309.419) (-308.094) * (-308.770) [-308.876] (-311.260) (-308.113) -- 0:00:11
803000 -- [-306.573] (-309.453) (-309.189) (-308.380) * (-308.715) [-309.028] (-311.170) (-307.927) -- 0:00:11
803500 -- (-310.355) (-310.286) (-310.865) [-307.184] * (-308.560) [-308.372] (-306.735) (-306.980) -- 0:00:11
804000 -- (-312.473) (-311.542) (-312.586) [-307.094] * [-307.100] (-312.085) (-309.695) (-308.214) -- 0:00:11
804500 -- (-309.612) (-309.955) (-310.788) [-307.753] * (-308.915) [-308.000] (-308.598) (-310.607) -- 0:00:11
805000 -- (-311.724) (-308.528) (-310.901) [-306.567] * (-313.779) (-308.104) [-307.573] (-308.841) -- 0:00:11
Average standard deviation of split frequencies: 0.009760
805500 -- (-310.150) [-307.150] (-308.398) (-306.987) * (-308.205) (-309.270) (-310.918) [-308.677] -- 0:00:11
806000 -- [-308.621] (-308.375) (-307.549) (-310.079) * (-311.511) [-306.884] (-307.474) (-307.736) -- 0:00:11
806500 -- [-311.753] (-310.862) (-306.774) (-307.966) * (-308.303) (-309.161) [-311.133] (-314.006) -- 0:00:11
807000 -- (-307.861) [-307.832] (-308.435) (-307.662) * (-308.601) (-309.836) (-310.071) [-309.724] -- 0:00:11
807500 -- (-307.527) (-309.108) (-308.619) [-309.194] * (-310.241) [-308.567] (-308.210) (-308.996) -- 0:00:11
808000 -- (-309.374) (-306.881) [-306.986] (-307.970) * (-306.564) (-309.020) [-310.475] (-307.694) -- 0:00:11
808500 -- (-311.227) [-307.302] (-314.577) (-307.467) * [-308.690] (-309.918) (-310.050) (-307.459) -- 0:00:11
809000 -- (-310.343) (-307.741) [-311.986] (-308.282) * (-309.256) [-307.332] (-309.072) (-312.615) -- 0:00:11
809500 -- [-308.259] (-307.886) (-309.018) (-309.576) * (-309.526) [-308.300] (-310.208) (-308.526) -- 0:00:11
810000 -- [-307.123] (-308.471) (-310.157) (-311.518) * [-306.766] (-310.149) (-308.151) (-308.148) -- 0:00:11
Average standard deviation of split frequencies: 0.009509
810500 -- [-307.408] (-308.773) (-311.396) (-307.993) * (-308.218) [-308.025] (-308.070) (-309.288) -- 0:00:11
811000 -- (-312.055) [-309.455] (-312.172) (-310.303) * (-308.998) [-309.373] (-309.049) (-310.060) -- 0:00:11
811500 -- (-311.069) (-308.642) [-309.309] (-307.407) * (-306.542) (-309.768) (-309.092) [-308.718] -- 0:00:11
812000 -- (-310.593) (-312.496) [-308.100] (-309.035) * [-311.337] (-307.794) (-308.212) (-309.320) -- 0:00:11
812500 -- (-307.714) [-309.054] (-307.658) (-309.778) * (-311.299) (-315.879) [-309.380] (-307.079) -- 0:00:11
813000 -- (-306.532) (-309.148) (-307.506) [-308.278] * (-307.870) [-309.868] (-311.168) (-307.738) -- 0:00:11
813500 -- (-307.850) (-309.143) [-308.055] (-308.688) * (-309.018) [-309.968] (-307.956) (-307.248) -- 0:00:11
814000 -- (-308.763) [-309.314] (-308.374) (-307.743) * (-309.163) (-307.073) (-309.324) [-312.135] -- 0:00:10
814500 -- [-309.576] (-310.205) (-310.889) (-308.986) * [-310.034] (-308.594) (-308.122) (-310.312) -- 0:00:10
815000 -- (-310.019) (-311.671) [-309.565] (-309.237) * [-308.178] (-308.111) (-307.446) (-308.964) -- 0:00:10
Average standard deviation of split frequencies: 0.008774
815500 -- (-310.758) [-311.527] (-307.352) (-308.187) * [-313.510] (-307.443) (-307.300) (-308.767) -- 0:00:11
816000 -- (-308.219) [-309.866] (-307.042) (-308.510) * (-307.111) (-309.041) [-307.137] (-311.203) -- 0:00:11
816500 -- (-308.252) [-308.278] (-309.233) (-308.368) * (-307.739) (-308.615) [-308.821] (-312.433) -- 0:00:11
817000 -- (-307.528) (-310.880) [-307.756] (-309.039) * (-307.593) (-309.873) (-308.732) [-307.684] -- 0:00:10
817500 -- [-308.753] (-310.323) (-309.107) (-310.147) * (-306.924) (-309.512) (-308.606) [-307.391] -- 0:00:10
818000 -- (-309.562) (-309.008) (-308.262) [-307.867] * (-310.145) (-307.278) (-309.532) [-307.891] -- 0:00:10
818500 -- (-307.967) (-309.089) (-311.660) [-309.196] * (-308.563) (-306.991) (-312.980) [-307.737] -- 0:00:10
819000 -- [-310.052] (-310.475) (-310.345) (-309.239) * [-306.938] (-308.749) (-315.057) (-307.781) -- 0:00:10
819500 -- [-308.729] (-310.001) (-310.681) (-308.017) * (-308.351) (-308.891) (-310.289) [-307.309] -- 0:00:10
820000 -- (-309.926) [-307.870] (-308.862) (-306.785) * (-307.586) (-309.480) [-308.769] (-309.803) -- 0:00:10
Average standard deviation of split frequencies: 0.009344
820500 -- (-310.172) (-307.187) (-308.447) [-310.207] * (-307.541) (-307.098) [-308.578] (-311.530) -- 0:00:10
821000 -- [-308.924] (-307.490) (-307.659) (-309.424) * (-311.969) [-308.052] (-311.165) (-308.857) -- 0:00:10
821500 -- [-310.032] (-310.482) (-310.153) (-309.680) * [-311.100] (-307.126) (-308.525) (-306.911) -- 0:00:10
822000 -- [-307.320] (-307.677) (-307.297) (-309.288) * [-311.871] (-313.038) (-309.925) (-307.505) -- 0:00:10
822500 -- (-310.450) [-307.647] (-307.603) (-308.902) * (-310.756) [-311.552] (-311.023) (-311.234) -- 0:00:10
823000 -- (-313.306) (-311.867) (-311.784) [-307.890] * (-311.967) (-308.047) (-307.446) [-308.394] -- 0:00:10
823500 -- (-312.180) (-308.728) (-315.922) [-307.852] * [-311.337] (-307.525) (-306.881) (-307.660) -- 0:00:10
824000 -- (-311.920) [-308.799] (-315.507) (-307.544) * (-309.698) (-309.016) (-308.000) [-308.175] -- 0:00:10
824500 -- (-311.323) [-307.735] (-310.023) (-308.629) * (-310.205) (-306.853) (-308.926) [-308.005] -- 0:00:10
825000 -- (-310.235) (-307.904) [-308.271] (-308.574) * (-306.747) (-309.401) (-308.987) [-309.562] -- 0:00:10
Average standard deviation of split frequencies: 0.009467
825500 -- (-310.481) [-307.969] (-309.028) (-308.730) * [-309.532] (-308.598) (-308.586) (-310.895) -- 0:00:10
826000 -- (-309.762) (-307.287) (-307.795) [-311.294] * (-307.822) [-307.590] (-311.247) (-307.616) -- 0:00:10
826500 -- (-312.189) [-308.369] (-307.436) (-309.175) * (-307.929) (-307.694) [-309.469] (-308.088) -- 0:00:10
827000 -- (-311.150) (-306.530) (-308.375) [-308.624] * (-311.599) [-307.112] (-311.109) (-307.432) -- 0:00:10
827500 -- (-308.217) (-309.432) [-309.424] (-310.376) * (-309.456) [-309.294] (-308.998) (-311.701) -- 0:00:10
828000 -- (-309.731) (-311.821) (-307.268) [-307.286] * (-307.680) (-312.305) (-308.249) [-309.652] -- 0:00:10
828500 -- (-310.572) (-308.342) (-309.561) [-309.859] * [-309.352] (-307.272) (-309.708) (-310.028) -- 0:00:10
829000 -- (-309.294) [-309.810] (-309.679) (-310.548) * [-308.595] (-309.048) (-309.760) (-310.873) -- 0:00:10
829500 -- (-308.132) (-308.366) [-313.904] (-308.719) * (-308.127) [-307.566] (-309.046) (-311.709) -- 0:00:10
830000 -- (-311.246) (-310.499) [-309.768] (-307.882) * (-310.862) [-308.708] (-312.851) (-312.202) -- 0:00:10
Average standard deviation of split frequencies: 0.009194
830500 -- (-307.627) [-308.273] (-314.588) (-307.627) * (-307.715) (-309.137) [-309.127] (-309.517) -- 0:00:10
831000 -- [-306.672] (-307.941) (-309.273) (-308.646) * (-308.398) (-307.807) (-308.989) [-308.885] -- 0:00:10
831500 -- (-308.791) [-308.731] (-309.961) (-309.491) * (-309.746) (-307.881) [-307.780] (-306.862) -- 0:00:10
832000 -- (-309.390) [-310.874] (-307.568) (-307.527) * [-310.402] (-307.600) (-314.820) (-306.566) -- 0:00:10
832500 -- (-310.148) [-310.290] (-311.007) (-310.874) * [-308.260] (-309.784) (-307.816) (-309.623) -- 0:00:10
833000 -- (-310.617) [-307.494] (-310.184) (-308.233) * [-312.585] (-309.113) (-308.844) (-308.928) -- 0:00:10
833500 -- (-308.835) (-307.187) (-309.552) [-308.237] * [-309.671] (-306.625) (-306.758) (-312.115) -- 0:00:09
834000 -- (-309.994) (-308.656) [-309.544] (-308.090) * (-306.712) (-307.999) (-311.407) [-310.647] -- 0:00:09
834500 -- [-308.926] (-310.660) (-309.723) (-307.399) * [-309.865] (-311.303) (-310.616) (-309.620) -- 0:00:09
835000 -- (-308.254) (-308.030) [-308.494] (-309.182) * (-316.905) (-309.110) (-309.888) [-308.345] -- 0:00:09
Average standard deviation of split frequencies: 0.009548
835500 -- (-308.764) [-307.679] (-307.699) (-308.378) * (-307.873) [-310.844] (-308.957) (-307.501) -- 0:00:09
836000 -- (-310.062) (-307.973) (-310.218) [-309.011] * (-307.415) (-314.632) [-311.100] (-309.800) -- 0:00:09
836500 -- (-308.653) (-308.658) (-313.295) [-309.232] * (-307.452) (-311.630) (-314.111) [-308.284] -- 0:00:09
837000 -- [-307.867] (-308.182) (-310.816) (-308.094) * [-307.057] (-315.286) (-314.210) (-311.354) -- 0:00:09
837500 -- (-308.886) [-308.367] (-306.905) (-310.234) * (-307.533) (-310.055) [-309.605] (-308.410) -- 0:00:09
838000 -- (-308.399) [-306.634] (-306.808) (-308.894) * [-307.088] (-308.103) (-306.710) (-310.462) -- 0:00:09
838500 -- (-309.596) [-309.464] (-307.418) (-306.903) * (-307.282) (-309.923) [-308.354] (-308.256) -- 0:00:09
839000 -- (-311.096) (-309.294) [-310.122] (-312.739) * (-309.799) [-307.203] (-310.545) (-311.790) -- 0:00:09
839500 -- (-309.479) (-308.659) (-309.899) [-307.803] * (-308.537) [-308.305] (-307.435) (-312.436) -- 0:00:09
840000 -- (-309.640) (-308.465) [-313.401] (-310.063) * (-308.177) [-309.514] (-307.866) (-313.589) -- 0:00:09
Average standard deviation of split frequencies: 0.009084
840500 -- (-311.921) [-311.571] (-309.574) (-313.224) * [-307.984] (-312.230) (-309.234) (-308.657) -- 0:00:09
841000 -- [-308.937] (-314.646) (-315.202) (-311.824) * (-306.787) (-308.704) (-306.893) [-307.031] -- 0:00:09
841500 -- [-310.744] (-308.698) (-311.747) (-308.058) * (-307.955) (-308.133) [-307.165] (-313.983) -- 0:00:09
842000 -- (-307.896) (-307.437) (-308.769) [-307.808] * (-308.942) [-308.049] (-308.682) (-308.246) -- 0:00:09
842500 -- [-307.801] (-307.551) (-313.806) (-310.454) * [-308.535] (-314.669) (-312.611) (-308.091) -- 0:00:09
843000 -- (-310.030) [-311.741] (-312.107) (-307.194) * (-310.672) (-311.192) [-309.962] (-309.249) -- 0:00:09
843500 -- (-308.643) (-310.080) [-309.200] (-309.045) * [-309.538] (-309.099) (-307.997) (-310.745) -- 0:00:09
844000 -- (-309.492) [-309.981] (-310.479) (-310.227) * (-309.435) [-310.472] (-307.023) (-306.717) -- 0:00:09
844500 -- [-311.078] (-309.591) (-308.999) (-307.265) * (-308.076) (-307.445) [-308.401] (-307.632) -- 0:00:09
845000 -- [-310.431] (-310.673) (-309.618) (-308.017) * (-308.422) [-307.892] (-311.306) (-309.056) -- 0:00:09
Average standard deviation of split frequencies: 0.009403
845500 -- (-308.724) (-309.460) [-309.883] (-306.895) * [-307.360] (-307.903) (-307.898) (-308.184) -- 0:00:09
846000 -- (-311.275) (-308.248) [-310.581] (-307.995) * (-308.132) (-307.985) [-308.279] (-310.243) -- 0:00:09
846500 -- [-309.107] (-308.265) (-310.355) (-309.339) * (-307.100) (-308.994) [-308.445] (-310.611) -- 0:00:09
847000 -- (-309.521) (-309.091) [-307.116] (-309.267) * (-308.051) [-309.817] (-308.363) (-311.190) -- 0:00:09
847500 -- (-307.150) (-307.184) [-310.811] (-311.581) * [-307.063] (-309.073) (-308.679) (-308.200) -- 0:00:09
848000 -- [-311.383] (-311.794) (-308.786) (-310.362) * [-308.226] (-310.540) (-306.432) (-309.037) -- 0:00:09
848500 -- [-308.137] (-311.949) (-309.665) (-308.524) * (-307.134) (-311.215) (-307.145) [-309.626] -- 0:00:09
849000 -- (-307.136) (-315.624) [-308.005] (-306.708) * (-309.428) (-309.801) [-307.796] (-309.242) -- 0:00:09
849500 -- (-308.652) (-306.856) (-309.759) [-308.749] * (-309.877) (-313.330) (-310.295) [-308.843] -- 0:00:09
850000 -- [-309.229] (-308.478) (-311.231) (-313.415) * [-306.816] (-312.197) (-310.735) (-307.618) -- 0:00:09
Average standard deviation of split frequencies: 0.009384
850500 -- (-309.319) [-307.761] (-313.036) (-312.399) * [-306.924] (-307.534) (-307.138) (-310.235) -- 0:00:08
851000 -- (-306.621) [-308.045] (-314.158) (-312.556) * (-308.147) (-309.475) [-308.309] (-309.634) -- 0:00:08
851500 -- [-307.855] (-310.438) (-311.170) (-309.008) * (-309.585) (-308.112) [-308.571] (-310.075) -- 0:00:08
852000 -- (-307.799) (-309.808) (-309.603) [-307.175] * [-307.887] (-307.021) (-308.238) (-307.613) -- 0:00:08
852500 -- [-308.986] (-311.521) (-306.921) (-308.103) * (-308.522) [-311.021] (-307.105) (-311.752) -- 0:00:08
853000 -- (-308.592) (-313.081) (-313.079) [-307.277] * (-310.628) (-310.657) (-308.925) [-308.292] -- 0:00:08
853500 -- (-308.545) [-309.810] (-307.219) (-307.095) * [-307.937] (-308.060) (-310.175) (-308.678) -- 0:00:08
854000 -- (-308.407) (-309.432) [-310.631] (-308.629) * (-310.055) (-309.395) [-309.118] (-310.635) -- 0:00:08
854500 -- (-309.685) (-308.089) [-307.776] (-307.185) * (-308.336) (-308.911) (-308.456) [-309.508] -- 0:00:08
855000 -- (-308.430) (-306.822) (-310.062) [-310.200] * (-312.071) (-310.058) (-311.097) [-308.940] -- 0:00:08
Average standard deviation of split frequencies: 0.009325
855500 -- [-309.404] (-307.823) (-306.978) (-311.054) * (-310.105) (-308.320) [-308.401] (-308.440) -- 0:00:08
856000 -- (-309.465) (-307.955) [-308.247] (-309.453) * (-308.532) [-308.482] (-307.447) (-312.176) -- 0:00:08
856500 -- (-311.268) [-308.555] (-309.652) (-307.462) * (-308.159) [-309.568] (-307.175) (-310.593) -- 0:00:08
857000 -- [-309.382] (-309.101) (-310.923) (-307.749) * (-308.658) [-311.817] (-309.970) (-308.405) -- 0:00:08
857500 -- (-309.496) (-309.256) [-309.861] (-311.748) * (-309.336) (-308.013) [-307.600] (-310.360) -- 0:00:08
858000 -- (-308.413) [-310.392] (-308.542) (-308.523) * (-306.734) [-307.234] (-309.597) (-310.041) -- 0:00:08
858500 -- (-307.474) [-309.853] (-309.373) (-312.747) * [-312.726] (-309.671) (-309.122) (-306.709) -- 0:00:08
859000 -- (-307.873) [-308.824] (-308.151) (-307.682) * (-310.067) (-308.852) (-308.254) [-307.020] -- 0:00:08
859500 -- (-308.935) (-307.221) (-310.631) [-308.128] * (-312.595) (-308.050) [-308.449] (-309.337) -- 0:00:08
860000 -- (-318.314) (-308.168) [-306.978] (-310.394) * (-310.984) (-308.204) (-310.170) [-307.906] -- 0:00:08
Average standard deviation of split frequencies: 0.009530
860500 -- [-311.212] (-310.168) (-307.802) (-307.531) * (-312.150) (-320.026) (-307.331) [-307.842] -- 0:00:08
861000 -- (-314.774) (-309.218) (-306.769) [-309.241] * (-310.082) [-307.344] (-309.089) (-308.704) -- 0:00:08
861500 -- (-314.167) (-307.832) (-309.487) [-306.568] * (-308.069) [-308.115] (-307.885) (-309.148) -- 0:00:08
862000 -- [-307.560] (-311.833) (-311.855) (-306.602) * (-309.422) [-308.543] (-306.853) (-307.867) -- 0:00:08
862500 -- [-315.247] (-315.387) (-308.210) (-308.919) * (-308.999) (-309.595) (-306.835) [-307.502] -- 0:00:08
863000 -- (-308.490) (-309.419) (-308.155) [-312.168] * (-311.074) (-313.346) (-311.785) [-307.195] -- 0:00:08
863500 -- (-307.495) (-308.385) (-307.541) [-309.374] * [-309.350] (-309.585) (-308.937) (-308.329) -- 0:00:08
864000 -- (-311.088) (-306.896) [-307.209] (-308.224) * (-308.446) [-307.788] (-310.559) (-309.594) -- 0:00:08
864500 -- [-307.937] (-308.189) (-310.823) (-309.879) * (-308.214) (-308.066) [-309.458] (-311.377) -- 0:00:08
865000 -- (-307.953) (-307.109) [-307.122] (-309.806) * (-307.688) (-312.765) (-317.120) [-308.071] -- 0:00:08
Average standard deviation of split frequencies: 0.009218
865500 -- [-306.994] (-306.438) (-311.682) (-309.799) * [-307.706] (-308.726) (-309.383) (-306.444) -- 0:00:08
866000 -- [-307.099] (-308.607) (-308.084) (-317.635) * (-306.771) (-316.739) (-307.247) [-308.216] -- 0:00:08
866500 -- (-308.809) (-307.231) (-308.368) [-309.747] * (-308.750) (-310.798) [-307.540] (-307.908) -- 0:00:08
867000 -- (-308.346) (-309.053) (-314.925) [-307.886] * (-309.810) (-307.359) [-307.271] (-307.859) -- 0:00:07
867500 -- (-309.057) (-308.987) [-308.224] (-309.410) * (-313.526) [-307.578] (-306.961) (-309.744) -- 0:00:07
868000 -- (-310.648) [-308.979] (-310.747) (-308.875) * (-310.076) [-308.691] (-306.726) (-309.064) -- 0:00:07
868500 -- (-313.022) (-311.433) [-309.560] (-307.273) * (-310.433) (-309.143) (-307.142) [-309.364] -- 0:00:07
869000 -- (-311.378) (-307.756) [-307.554] (-306.893) * [-309.911] (-306.690) (-307.011) (-309.074) -- 0:00:07
869500 -- (-315.454) [-311.760] (-306.654) (-316.545) * [-311.158] (-308.068) (-309.697) (-309.107) -- 0:00:07
870000 -- (-315.286) (-312.074) (-307.560) [-310.907] * (-308.667) (-308.458) [-310.214] (-308.917) -- 0:00:07
Average standard deviation of split frequencies: 0.008879
870500 -- (-310.121) (-308.976) (-307.957) [-311.314] * (-308.481) (-307.865) (-308.452) [-309.428] -- 0:00:07
871000 -- (-311.185) [-308.333] (-308.488) (-310.440) * (-311.191) (-307.702) (-310.085) [-309.753] -- 0:00:07
871500 -- (-310.693) [-307.160] (-308.798) (-309.390) * [-312.572] (-307.799) (-309.006) (-313.156) -- 0:00:07
872000 -- [-308.258] (-306.753) (-307.533) (-307.308) * (-309.307) [-308.931] (-310.088) (-308.769) -- 0:00:07
872500 -- (-310.675) (-306.918) (-308.617) [-307.309] * [-310.383] (-309.675) (-308.993) (-310.282) -- 0:00:07
873000 -- (-306.670) (-310.086) (-311.163) [-307.794] * (-309.146) (-308.715) (-307.046) [-307.498] -- 0:00:07
873500 -- (-311.165) [-309.519] (-314.210) (-308.803) * (-308.076) (-308.725) (-307.644) [-308.979] -- 0:00:07
874000 -- (-309.456) [-310.936] (-310.539) (-307.857) * (-312.137) (-309.558) (-307.536) [-309.233] -- 0:00:07
874500 -- (-307.599) (-311.255) [-310.940] (-307.749) * (-307.804) (-308.940) [-308.408] (-308.970) -- 0:00:07
875000 -- (-308.999) [-306.853] (-310.655) (-313.560) * (-307.806) (-309.559) [-307.336] (-308.214) -- 0:00:07
Average standard deviation of split frequencies: 0.009112
875500 -- (-308.991) (-307.435) [-311.978] (-308.994) * (-306.973) [-307.618] (-310.833) (-308.162) -- 0:00:07
876000 -- (-307.114) (-310.991) (-307.076) [-308.943] * [-307.564] (-309.779) (-308.730) (-309.336) -- 0:00:07
876500 -- (-307.432) (-307.763) (-308.012) [-309.804] * (-313.848) [-309.422] (-308.465) (-308.061) -- 0:00:07
877000 -- [-306.953] (-311.221) (-310.222) (-308.421) * (-308.237) [-313.000] (-312.670) (-306.874) -- 0:00:07
877500 -- [-308.892] (-307.894) (-312.648) (-311.151) * (-307.913) [-308.147] (-310.661) (-309.761) -- 0:00:07
878000 -- (-311.713) (-309.369) (-312.095) [-307.859] * (-308.816) [-308.780] (-307.507) (-307.679) -- 0:00:07
878500 -- (-310.916) [-307.742] (-308.159) (-309.519) * (-310.262) (-307.618) (-308.663) [-311.409] -- 0:00:07
879000 -- (-308.837) (-310.105) (-307.758) [-306.669] * (-306.883) (-306.862) [-308.974] (-312.927) -- 0:00:07
879500 -- (-308.810) [-309.436] (-307.594) (-306.796) * (-311.259) [-307.852] (-308.535) (-308.819) -- 0:00:07
880000 -- (-311.492) [-306.963] (-311.568) (-312.513) * [-310.023] (-314.064) (-312.243) (-310.330) -- 0:00:07
Average standard deviation of split frequencies: 0.008866
880500 -- (-307.468) [-307.665] (-310.198) (-314.162) * (-311.585) [-308.655] (-309.343) (-309.291) -- 0:00:07
881000 -- (-310.114) (-308.460) [-312.043] (-309.603) * [-307.612] (-308.428) (-310.110) (-309.746) -- 0:00:07
881500 -- [-307.133] (-307.062) (-310.951) (-318.409) * (-307.685) [-310.182] (-309.357) (-308.442) -- 0:00:07
882000 -- (-311.000) (-308.901) (-306.987) [-309.121] * (-309.727) (-309.659) (-310.355) [-307.551] -- 0:00:07
882500 -- (-309.056) [-310.946] (-307.588) (-308.421) * (-308.904) [-307.421] (-308.443) (-306.945) -- 0:00:07
883000 -- [-307.377] (-309.851) (-308.006) (-309.695) * (-307.004) (-307.360) (-307.414) [-313.492] -- 0:00:07
883500 -- [-308.141] (-314.454) (-308.782) (-308.493) * (-308.998) (-314.115) [-307.593] (-310.532) -- 0:00:06
884000 -- [-310.853] (-309.886) (-312.192) (-308.864) * (-309.251) (-307.764) (-307.124) [-307.690] -- 0:00:06
884500 -- (-308.536) [-307.503] (-308.591) (-309.196) * [-309.040] (-308.768) (-309.182) (-308.406) -- 0:00:06
885000 -- [-308.871] (-307.398) (-311.273) (-307.676) * (-309.951) (-308.156) (-314.053) [-309.307] -- 0:00:06
Average standard deviation of split frequencies: 0.009012
885500 -- (-310.777) [-308.949] (-310.390) (-308.194) * [-307.618] (-310.445) (-309.669) (-310.203) -- 0:00:06
886000 -- [-308.439] (-309.792) (-309.613) (-309.168) * [-307.976] (-311.335) (-309.667) (-308.027) -- 0:00:06
886500 -- (-308.353) (-310.924) (-309.774) [-306.868] * (-309.765) (-306.739) [-310.737] (-307.635) -- 0:00:06
887000 -- [-306.940] (-312.069) (-311.740) (-307.781) * (-308.490) [-307.713] (-311.495) (-308.411) -- 0:00:06
887500 -- (-312.482) (-309.566) (-311.278) [-306.817] * (-309.490) (-307.864) (-308.371) [-312.031] -- 0:00:06
888000 -- (-312.085) (-306.754) (-307.936) [-307.104] * (-312.480) [-309.863] (-308.419) (-306.707) -- 0:00:06
888500 -- [-309.850] (-308.570) (-308.267) (-310.952) * (-308.015) [-307.193] (-312.058) (-308.618) -- 0:00:06
889000 -- [-308.424] (-310.766) (-307.191) (-312.081) * [-306.676] (-307.679) (-310.273) (-310.834) -- 0:00:06
889500 -- (-308.247) [-306.574] (-310.139) (-310.415) * (-310.338) (-308.095) [-310.801] (-309.744) -- 0:00:06
890000 -- [-309.007] (-307.424) (-307.918) (-315.975) * [-307.388] (-309.237) (-313.603) (-308.062) -- 0:00:06
Average standard deviation of split frequencies: 0.008733
890500 -- (-309.807) [-307.620] (-307.920) (-309.628) * (-308.949) (-307.822) (-313.083) [-308.537] -- 0:00:06
891000 -- (-308.299) (-308.403) (-307.770) [-307.737] * [-310.405] (-309.337) (-307.886) (-309.445) -- 0:00:06
891500 -- (-308.477) (-309.132) (-312.491) [-307.390] * (-308.366) (-307.736) (-308.504) [-309.305] -- 0:00:06
892000 -- (-307.552) (-309.008) [-308.351] (-308.561) * [-307.409] (-310.299) (-308.148) (-308.431) -- 0:00:06
892500 -- (-311.097) (-307.796) (-308.736) [-308.403] * (-308.914) (-309.925) [-308.153] (-309.195) -- 0:00:06
893000 -- (-307.954) [-307.758] (-316.028) (-312.664) * (-310.793) [-309.795] (-307.983) (-310.355) -- 0:00:06
893500 -- (-310.932) [-308.844] (-309.657) (-311.394) * (-311.529) (-312.623) [-308.855] (-308.173) -- 0:00:06
894000 -- (-309.441) (-307.541) [-308.526] (-309.000) * (-307.171) (-313.302) [-309.530] (-309.589) -- 0:00:06
894500 -- (-311.404) (-307.845) [-306.801] (-308.201) * (-309.560) [-307.955] (-308.342) (-306.579) -- 0:00:06
895000 -- (-309.021) (-308.991) (-306.369) [-309.657] * [-308.385] (-307.471) (-307.077) (-307.916) -- 0:00:06
Average standard deviation of split frequencies: 0.008356
895500 -- (-308.936) (-307.850) (-313.406) [-307.914] * (-311.911) (-308.466) (-306.831) [-307.211] -- 0:00:06
896000 -- (-308.485) [-308.953] (-307.783) (-311.268) * (-308.710) [-308.822] (-314.857) (-310.530) -- 0:00:06
896500 -- [-308.525] (-309.771) (-307.881) (-312.733) * [-312.778] (-308.205) (-309.138) (-306.878) -- 0:00:06
897000 -- (-309.662) [-308.033] (-308.135) (-308.164) * (-309.128) (-308.049) (-311.405) [-311.319] -- 0:00:06
897500 -- (-311.124) (-307.569) [-308.454] (-309.905) * [-308.129] (-309.463) (-308.371) (-306.717) -- 0:00:06
898000 -- (-308.970) (-308.293) [-307.477] (-310.955) * (-313.986) (-309.419) [-308.340] (-311.197) -- 0:00:06
898500 -- (-314.842) (-311.258) [-310.934] (-308.733) * [-308.768] (-309.687) (-309.142) (-308.887) -- 0:00:06
899000 -- (-307.903) (-309.752) [-307.219] (-312.786) * (-310.170) [-312.076] (-308.934) (-309.320) -- 0:00:06
899500 -- (-311.590) (-308.089) (-307.450) [-307.472] * (-307.728) (-311.551) [-306.544] (-311.163) -- 0:00:06
900000 -- [-312.084] (-306.624) (-307.699) (-307.365) * (-311.093) (-307.093) [-308.931] (-309.799) -- 0:00:06
Average standard deviation of split frequencies: 0.008178
900500 -- [-312.384] (-309.524) (-313.414) (-309.488) * (-309.624) [-306.577] (-308.950) (-308.427) -- 0:00:05
901000 -- (-308.368) (-310.136) (-307.595) [-307.808] * (-312.566) (-311.376) [-309.651] (-311.420) -- 0:00:05
901500 -- (-309.458) (-309.816) (-309.558) [-309.876] * (-313.005) [-306.940] (-308.155) (-309.037) -- 0:00:05
902000 -- (-310.307) [-309.711] (-309.819) (-309.126) * (-308.974) [-307.831] (-308.026) (-308.005) -- 0:00:05
902500 -- (-309.433) (-308.770) [-309.314] (-313.341) * (-309.543) (-309.726) [-306.758] (-307.026) -- 0:00:05
903000 -- (-307.031) (-312.795) [-308.892] (-307.758) * [-310.659] (-310.468) (-307.697) (-309.219) -- 0:00:05
903500 -- [-307.472] (-309.310) (-310.062) (-308.826) * (-308.638) (-307.904) [-307.149] (-309.395) -- 0:00:05
904000 -- (-308.373) (-313.301) (-307.474) [-308.988] * [-308.193] (-307.970) (-309.498) (-311.446) -- 0:00:05
904500 -- (-308.609) [-309.140] (-311.560) (-315.671) * (-309.738) (-310.676) (-308.187) [-312.261] -- 0:00:05
905000 -- (-306.601) (-311.018) (-314.923) [-312.231] * (-309.606) (-307.342) (-308.795) [-308.897] -- 0:00:05
Average standard deviation of split frequencies: 0.008097
905500 -- (-308.761) [-306.978] (-310.916) (-307.807) * (-310.144) [-307.661] (-307.554) (-308.214) -- 0:00:05
906000 -- (-311.101) [-307.803] (-312.441) (-312.101) * (-307.035) (-308.248) [-312.523] (-307.550) -- 0:00:05
906500 -- (-310.552) [-308.676] (-311.104) (-311.950) * (-307.618) [-308.375] (-308.785) (-308.714) -- 0:00:05
907000 -- (-308.753) (-306.789) [-307.419] (-308.864) * [-308.031] (-314.250) (-308.017) (-310.640) -- 0:00:05
907500 -- (-310.578) (-307.930) [-307.536] (-310.178) * (-308.149) (-310.628) [-307.233] (-309.339) -- 0:00:05
908000 -- (-309.250) [-307.504] (-309.303) (-310.323) * (-309.649) (-312.070) (-308.865) [-308.595] -- 0:00:05
908500 -- [-308.376] (-307.404) (-311.805) (-312.691) * (-308.070) (-313.765) (-310.399) [-308.973] -- 0:00:05
909000 -- (-308.557) [-307.806] (-307.563) (-312.100) * (-307.491) (-307.739) [-308.285] (-309.096) -- 0:00:05
909500 -- (-309.876) (-309.621) [-308.190] (-308.831) * [-307.359] (-309.239) (-310.174) (-308.880) -- 0:00:05
910000 -- (-309.173) (-309.480) (-308.486) [-308.691] * (-308.993) (-308.806) (-314.332) [-309.271] -- 0:00:05
Average standard deviation of split frequencies: 0.008347
910500 -- (-308.547) [-307.784] (-308.373) (-307.765) * (-308.115) (-311.499) [-309.480] (-311.975) -- 0:00:05
911000 -- (-307.812) (-307.789) [-308.512] (-308.060) * (-310.852) (-307.957) [-309.046] (-309.595) -- 0:00:05
911500 -- [-307.296] (-307.408) (-308.790) (-307.889) * (-313.741) (-307.813) [-310.278] (-307.058) -- 0:00:05
912000 -- (-310.140) (-308.034) [-309.724] (-307.047) * (-307.718) (-309.196) [-307.390] (-309.177) -- 0:00:05
912500 -- [-308.640] (-307.660) (-308.599) (-308.174) * (-309.965) (-313.128) (-307.219) [-307.873] -- 0:00:05
913000 -- (-306.816) (-309.525) [-308.825] (-308.556) * (-308.002) (-309.581) [-312.129] (-308.193) -- 0:00:05
913500 -- (-309.126) [-307.085] (-310.766) (-307.919) * [-309.021] (-308.858) (-309.742) (-308.049) -- 0:00:05
914000 -- (-308.595) [-307.882] (-309.705) (-308.318) * [-309.151] (-308.979) (-309.486) (-310.369) -- 0:00:05
914500 -- (-310.630) (-307.697) (-307.691) [-308.991] * [-308.321] (-306.264) (-309.835) (-308.642) -- 0:00:05
915000 -- [-307.335] (-307.507) (-307.985) (-310.067) * (-313.023) (-308.694) (-308.594) [-309.414] -- 0:00:05
Average standard deviation of split frequencies: 0.008491
915500 -- [-309.438] (-307.712) (-310.476) (-314.725) * (-309.089) (-309.041) [-307.904] (-307.541) -- 0:00:05
916000 -- (-306.441) [-308.683] (-309.101) (-307.410) * (-306.983) (-306.801) (-308.281) [-307.387] -- 0:00:05
916500 -- [-307.016] (-310.074) (-308.145) (-310.244) * (-306.750) (-311.839) [-308.811] (-311.245) -- 0:00:05
917000 -- (-310.452) (-312.276) (-307.541) [-309.075] * (-308.462) (-310.812) [-307.693] (-311.833) -- 0:00:04
917500 -- [-308.025] (-310.070) (-307.745) (-309.556) * [-307.636] (-309.162) (-307.399) (-307.531) -- 0:00:04
918000 -- (-307.582) (-307.588) (-306.604) [-309.874] * [-307.052] (-310.526) (-316.547) (-308.647) -- 0:00:04
918500 -- (-310.605) (-308.350) (-310.429) [-308.107] * [-308.451] (-311.530) (-311.025) (-308.228) -- 0:00:04
919000 -- (-310.323) [-307.014] (-309.327) (-309.483) * (-308.996) (-310.160) (-311.219) [-308.566] -- 0:00:04
919500 -- [-309.066] (-307.757) (-307.125) (-307.150) * [-310.933] (-307.639) (-311.107) (-307.830) -- 0:00:04
920000 -- (-309.893) (-306.465) (-310.645) [-309.371] * (-308.375) [-309.526] (-307.039) (-309.634) -- 0:00:04
Average standard deviation of split frequencies: 0.008320
920500 -- [-308.400] (-306.676) (-308.324) (-310.722) * [-307.118] (-308.089) (-310.294) (-310.058) -- 0:00:04
921000 -- (-307.397) (-308.398) (-308.267) [-307.960] * (-306.992) (-307.417) [-307.100] (-310.610) -- 0:00:04
921500 -- [-308.915] (-307.010) (-310.256) (-308.240) * (-309.211) (-309.431) [-307.043] (-310.447) -- 0:00:04
922000 -- (-309.090) [-313.376] (-311.643) (-309.239) * (-313.598) (-309.380) [-308.118] (-310.939) -- 0:00:04
922500 -- (-308.501) (-312.205) (-312.739) [-310.718] * (-310.590) [-309.638] (-308.583) (-310.550) -- 0:00:04
923000 -- (-313.413) [-310.883] (-309.389) (-307.027) * (-311.683) (-313.615) (-307.414) [-311.299] -- 0:00:04
923500 -- [-307.004] (-310.240) (-308.658) (-308.001) * (-310.779) (-312.396) [-309.005] (-308.347) -- 0:00:04
924000 -- [-308.567] (-307.599) (-309.636) (-309.792) * (-307.729) (-309.630) [-307.391] (-311.947) -- 0:00:04
924500 -- [-307.087] (-306.982) (-309.312) (-311.427) * (-307.899) (-309.485) (-308.295) [-310.054] -- 0:00:04
925000 -- (-307.500) [-310.567] (-309.420) (-310.175) * (-308.393) [-308.959] (-306.583) (-313.645) -- 0:00:04
Average standard deviation of split frequencies: 0.008527
925500 -- (-309.634) (-311.925) [-311.263] (-307.534) * (-310.811) [-309.540] (-306.907) (-310.179) -- 0:00:04
926000 -- [-308.159] (-312.881) (-309.734) (-308.581) * [-307.482] (-308.174) (-309.374) (-306.572) -- 0:00:04
926500 -- (-306.825) [-309.458] (-309.963) (-307.849) * (-310.385) (-309.025) (-310.711) [-309.378] -- 0:00:04
927000 -- (-308.771) (-307.902) (-308.174) [-308.681] * (-308.867) [-307.210] (-308.145) (-308.397) -- 0:00:04
927500 -- (-307.731) [-308.532] (-308.535) (-306.275) * [-307.738] (-308.253) (-308.119) (-310.953) -- 0:00:04
928000 -- (-307.105) [-307.184] (-308.624) (-307.862) * (-310.632) (-309.825) (-312.098) [-311.710] -- 0:00:04
928500 -- (-307.258) (-310.234) [-310.128] (-313.442) * [-307.551] (-308.162) (-312.424) (-309.227) -- 0:00:04
929000 -- (-311.752) [-308.677] (-314.959) (-309.310) * (-308.322) [-307.127] (-309.295) (-310.396) -- 0:00:04
929500 -- [-308.132] (-310.581) (-310.400) (-307.333) * (-316.864) (-314.837) (-309.463) [-310.314] -- 0:00:04
930000 -- (-307.988) (-308.257) [-308.225] (-307.041) * [-306.814] (-308.968) (-310.487) (-308.279) -- 0:00:04
Average standard deviation of split frequencies: 0.008421
930500 -- [-311.356] (-309.491) (-308.973) (-307.226) * [-307.520] (-309.138) (-310.816) (-309.506) -- 0:00:04
931000 -- [-307.438] (-307.902) (-312.281) (-307.232) * (-308.850) (-306.429) [-308.338] (-310.116) -- 0:00:04
931500 -- (-308.522) (-309.972) (-309.094) [-308.309] * (-312.884) [-306.791] (-311.244) (-307.269) -- 0:00:04
932000 -- (-313.349) (-308.083) [-307.071] (-307.586) * (-307.211) (-307.968) [-307.545] (-306.964) -- 0:00:04
932500 -- (-313.119) (-307.476) [-308.267] (-310.005) * (-307.775) (-310.305) [-308.180] (-306.347) -- 0:00:04
933000 -- (-310.272) (-311.586) (-307.370) [-310.768] * (-310.759) (-307.578) (-308.382) [-306.407] -- 0:00:04
933500 -- [-307.533] (-307.369) (-307.614) (-311.514) * [-307.815] (-306.994) (-307.850) (-307.058) -- 0:00:03
934000 -- (-306.864) (-310.723) [-307.566] (-312.006) * (-312.722) (-307.027) [-307.249] (-311.119) -- 0:00:03
934500 -- [-307.048] (-310.644) (-308.441) (-314.141) * (-308.966) (-307.694) [-309.462] (-310.657) -- 0:00:03
935000 -- [-308.338] (-310.924) (-310.875) (-307.665) * (-308.077) [-311.088] (-308.651) (-313.235) -- 0:00:03
Average standard deviation of split frequencies: 0.008898
935500 -- (-309.819) (-308.461) (-307.873) [-308.171] * [-309.131] (-307.929) (-308.133) (-306.961) -- 0:00:03
936000 -- (-308.075) (-308.330) (-309.323) [-308.180] * (-307.457) (-307.393) [-307.351] (-311.789) -- 0:00:03
936500 -- [-310.791] (-307.814) (-308.393) (-309.762) * (-309.115) [-307.918] (-307.399) (-311.112) -- 0:00:03
937000 -- [-308.533] (-307.861) (-309.226) (-307.836) * [-311.597] (-308.324) (-307.118) (-307.508) -- 0:00:03
937500 -- (-307.808) (-307.542) [-308.879] (-308.016) * (-309.048) (-310.103) [-308.794] (-307.505) -- 0:00:03
938000 -- (-308.578) (-312.027) [-308.324] (-308.340) * (-315.592) [-307.891] (-306.888) (-306.944) -- 0:00:03
938500 -- (-311.649) (-312.510) (-308.744) [-308.669] * (-309.313) (-308.743) (-306.658) [-308.795] -- 0:00:03
939000 -- (-308.229) [-308.372] (-308.333) (-307.854) * (-312.927) (-311.017) [-310.011] (-310.227) -- 0:00:03
939500 -- [-310.252] (-309.698) (-306.704) (-310.419) * (-313.952) (-310.491) (-312.040) [-310.047] -- 0:00:03
940000 -- (-308.682) [-307.010] (-311.900) (-308.423) * (-309.894) (-308.995) (-311.514) [-309.447] -- 0:00:03
Average standard deviation of split frequencies: 0.008720
940500 -- (-307.609) [-308.586] (-307.426) (-308.570) * (-308.825) [-310.397] (-307.867) (-310.438) -- 0:00:03
941000 -- (-310.279) (-308.241) [-307.806] (-307.549) * [-308.052] (-308.219) (-310.957) (-307.927) -- 0:00:03
941500 -- (-310.113) (-314.202) (-308.468) [-308.891] * (-309.798) [-308.014] (-308.115) (-311.100) -- 0:00:03
942000 -- (-312.285) [-310.203] (-308.395) (-308.734) * [-308.246] (-309.080) (-311.523) (-308.297) -- 0:00:03
942500 -- [-310.760] (-313.691) (-307.355) (-307.778) * (-309.795) [-308.679] (-307.153) (-308.455) -- 0:00:03
943000 -- (-307.358) (-317.297) (-306.822) [-307.719] * (-310.770) (-307.580) [-309.364] (-313.613) -- 0:00:03
943500 -- (-308.584) [-310.404] (-307.053) (-306.291) * [-311.265] (-306.973) (-310.126) (-308.048) -- 0:00:03
944000 -- [-311.220] (-309.560) (-311.760) (-311.605) * (-308.964) [-308.008] (-314.587) (-307.916) -- 0:00:03
944500 -- (-311.722) (-307.559) [-306.676] (-309.614) * (-307.906) (-315.856) (-309.530) [-308.215] -- 0:00:03
945000 -- (-306.592) [-310.537] (-310.699) (-312.968) * (-309.186) (-311.348) (-308.097) [-308.415] -- 0:00:03
Average standard deviation of split frequencies: 0.009069
945500 -- (-307.951) (-308.755) [-306.601] (-312.740) * (-312.047) (-307.401) (-310.608) [-309.609] -- 0:00:03
946000 -- (-311.285) [-310.412] (-308.120) (-307.807) * (-310.045) (-307.239) (-308.521) [-306.748] -- 0:00:03
946500 -- (-309.528) [-308.837] (-308.786) (-309.543) * (-309.920) (-312.901) [-307.111] (-309.784) -- 0:00:03
947000 -- [-309.693] (-310.383) (-307.571) (-309.824) * (-310.066) (-312.675) (-308.160) [-309.681] -- 0:00:03
947500 -- [-309.009] (-307.525) (-307.806) (-308.597) * (-306.946) (-311.847) (-307.496) [-310.605] -- 0:00:03
948000 -- (-310.357) (-311.556) (-307.328) [-311.021] * (-306.652) (-311.239) [-308.004] (-307.830) -- 0:00:03
948500 -- (-309.596) [-309.093] (-309.761) (-311.844) * (-307.943) [-310.184] (-309.079) (-308.326) -- 0:00:03
949000 -- (-309.326) [-310.011] (-312.527) (-307.781) * (-310.391) [-308.009] (-307.605) (-307.306) -- 0:00:03
949500 -- [-309.245] (-308.003) (-308.944) (-307.919) * (-309.492) [-308.497] (-309.952) (-307.606) -- 0:00:03
950000 -- (-307.512) (-309.582) [-308.119] (-308.826) * (-311.043) [-309.244] (-308.433) (-307.679) -- 0:00:03
Average standard deviation of split frequencies: 0.009322
950500 -- (-307.198) (-306.957) (-308.523) [-308.700] * (-307.949) [-308.204] (-307.749) (-312.064) -- 0:00:02
951000 -- (-307.914) [-308.986] (-308.081) (-308.050) * [-308.355] (-312.040) (-313.287) (-307.379) -- 0:00:02
951500 -- (-308.191) (-306.965) [-309.414] (-308.999) * (-306.892) (-308.947) (-311.476) [-309.805] -- 0:00:02
952000 -- (-309.343) (-308.385) [-308.765] (-308.218) * [-307.281] (-311.327) (-309.199) (-307.290) -- 0:00:02
952500 -- (-308.119) [-309.774] (-307.533) (-307.993) * (-309.568) [-307.446] (-307.292) (-307.879) -- 0:00:02
953000 -- [-309.718] (-307.810) (-309.228) (-310.827) * (-311.264) (-312.394) (-307.509) [-307.620] -- 0:00:02
953500 -- (-310.630) (-307.330) [-307.008] (-309.366) * (-307.626) (-307.918) [-309.298] (-309.067) -- 0:00:02
954000 -- (-313.255) [-308.568] (-307.919) (-308.010) * (-309.595) (-308.759) (-313.252) [-309.096] -- 0:00:02
954500 -- (-309.908) (-307.974) (-311.859) [-307.091] * [-308.438] (-309.021) (-307.870) (-308.008) -- 0:00:02
955000 -- (-307.254) (-310.641) [-308.854] (-308.550) * [-310.009] (-308.249) (-307.073) (-311.366) -- 0:00:02
Average standard deviation of split frequencies: 0.009237
955500 -- (-309.836) [-308.422] (-308.188) (-309.175) * (-310.337) (-310.426) (-306.909) [-308.165] -- 0:00:02
956000 -- (-307.803) (-310.491) [-311.920] (-313.574) * (-308.444) (-310.049) [-308.987] (-308.225) -- 0:00:02
956500 -- (-308.427) (-312.405) (-308.097) [-311.404] * [-307.007] (-310.504) (-310.427) (-309.013) -- 0:00:02
957000 -- [-307.714] (-312.425) (-307.683) (-310.291) * [-307.123] (-310.876) (-310.840) (-309.932) -- 0:00:02
957500 -- (-306.993) [-307.383] (-308.651) (-307.216) * (-307.671) [-307.647] (-308.389) (-306.598) -- 0:00:02
958000 -- (-308.550) (-307.260) [-309.289] (-310.510) * (-309.062) [-308.039] (-307.952) (-306.634) -- 0:00:02
958500 -- [-310.824] (-311.041) (-309.707) (-309.843) * (-308.532) (-307.146) [-307.278] (-311.774) -- 0:00:02
959000 -- (-308.651) [-313.197] (-310.151) (-315.125) * [-310.729] (-309.564) (-313.726) (-312.703) -- 0:00:02
959500 -- (-312.560) (-313.983) [-312.832] (-310.120) * (-309.173) (-307.104) (-307.399) [-307.330] -- 0:00:02
960000 -- (-309.135) [-308.088] (-309.465) (-307.627) * (-306.805) (-307.741) [-309.074] (-309.234) -- 0:00:02
Average standard deviation of split frequencies: 0.009356
960500 -- (-308.370) (-306.837) [-312.481] (-308.025) * (-307.935) (-312.262) (-307.315) [-308.664] -- 0:00:02
961000 -- (-309.441) (-313.100) (-311.429) [-308.555] * [-308.694] (-312.256) (-307.912) (-310.882) -- 0:00:02
961500 -- (-308.637) (-308.828) (-308.303) [-307.312] * (-311.384) (-309.315) (-307.903) [-306.706] -- 0:00:02
962000 -- (-311.701) (-307.323) (-307.070) [-307.765] * [-306.880] (-307.587) (-308.641) (-308.882) -- 0:00:02
962500 -- (-311.120) [-308.369] (-309.492) (-309.445) * [-307.564] (-307.372) (-307.937) (-310.389) -- 0:00:02
963000 -- [-309.592] (-307.085) (-307.690) (-308.555) * (-309.586) (-307.926) (-313.787) [-313.133] -- 0:00:02
963500 -- (-312.549) (-308.488) (-307.843) [-308.134] * [-308.459] (-307.521) (-308.647) (-311.360) -- 0:00:02
964000 -- (-308.405) [-308.995] (-313.703) (-313.109) * [-307.547] (-307.677) (-310.823) (-309.765) -- 0:00:02
964500 -- (-307.250) [-308.334] (-310.627) (-307.971) * (-307.578) (-307.155) [-309.325] (-307.346) -- 0:00:02
965000 -- [-307.695] (-309.352) (-308.212) (-307.324) * [-309.047] (-307.918) (-307.751) (-307.690) -- 0:00:02
Average standard deviation of split frequencies: 0.009500
965500 -- (-309.300) [-308.594] (-308.827) (-309.347) * (-307.139) [-310.214] (-311.830) (-309.301) -- 0:00:02
966000 -- (-308.343) (-311.754) (-308.534) [-311.979] * [-307.981] (-310.742) (-309.000) (-309.650) -- 0:00:02
966500 -- (-306.828) (-310.862) [-308.723] (-307.691) * [-307.638] (-313.307) (-308.106) (-310.247) -- 0:00:02
967000 -- (-307.269) [-309.580] (-308.420) (-309.011) * (-308.868) [-311.551] (-308.658) (-311.730) -- 0:00:01
967500 -- (-306.838) (-309.270) (-309.126) [-307.012] * (-308.487) (-311.435) (-307.892) [-307.686] -- 0:00:01
968000 -- (-309.883) (-310.057) [-306.816] (-307.925) * [-307.061] (-309.643) (-308.878) (-307.454) -- 0:00:01
968500 -- (-310.262) (-314.767) [-307.374] (-308.834) * (-306.422) (-307.701) [-308.332] (-308.252) -- 0:00:01
969000 -- (-308.548) (-308.956) (-306.971) [-313.203] * (-307.401) (-307.426) [-307.283] (-311.748) -- 0:00:01
969500 -- (-307.514) [-309.602] (-306.692) (-312.778) * (-308.690) (-310.231) (-307.563) [-308.851] -- 0:00:01
970000 -- (-310.282) (-311.881) [-306.801] (-309.886) * (-309.605) [-307.921] (-308.083) (-307.855) -- 0:00:01
Average standard deviation of split frequencies: 0.009422
970500 -- (-307.726) (-310.255) (-312.700) [-309.190] * [-309.169] (-311.157) (-308.020) (-308.022) -- 0:00:01
971000 -- (-309.022) [-306.900] (-309.117) (-310.176) * (-310.183) (-310.134) [-309.158] (-307.360) -- 0:00:01
971500 -- (-309.390) [-307.282] (-309.776) (-308.962) * [-311.570] (-308.308) (-307.692) (-307.986) -- 0:00:01
972000 -- [-307.149] (-307.870) (-310.238) (-309.537) * (-311.266) [-307.646] (-312.179) (-310.782) -- 0:00:01
972500 -- (-306.847) (-306.750) (-308.255) [-309.410] * (-309.014) (-307.525) (-313.160) [-308.354] -- 0:00:01
973000 -- (-307.502) [-306.737] (-309.256) (-307.891) * (-308.458) (-309.790) [-308.170] (-308.318) -- 0:00:01
973500 -- (-307.125) (-307.189) (-310.267) [-307.571] * [-307.191] (-307.303) (-307.304) (-307.587) -- 0:00:01
974000 -- (-307.532) [-309.017] (-307.562) (-307.820) * (-310.402) [-307.472] (-312.047) (-309.406) -- 0:00:01
974500 -- [-308.370] (-311.062) (-310.105) (-308.186) * (-308.473) (-308.593) (-308.497) [-307.565] -- 0:00:01
975000 -- (-309.484) [-308.881] (-308.571) (-306.683) * (-307.457) (-308.314) (-308.729) [-308.037] -- 0:00:01
Average standard deviation of split frequencies: 0.009628
975500 -- [-308.488] (-307.371) (-307.980) (-314.230) * (-308.258) (-308.834) (-309.212) [-309.383] -- 0:00:01
976000 -- (-312.648) (-309.183) (-307.119) [-307.174] * (-308.434) [-309.250] (-313.257) (-311.910) -- 0:00:01
976500 -- (-310.541) (-312.168) [-308.186] (-308.046) * (-307.642) (-307.015) [-306.838] (-307.817) -- 0:00:01
977000 -- [-307.104] (-309.680) (-308.405) (-306.996) * [-309.066] (-307.192) (-308.069) (-307.655) -- 0:00:01
977500 -- (-311.785) [-309.597] (-308.684) (-308.147) * (-310.736) (-309.382) [-309.635] (-306.474) -- 0:00:01
978000 -- (-309.001) [-308.598] (-308.327) (-307.998) * (-311.731) (-309.638) [-309.645] (-307.765) -- 0:00:01
978500 -- (-308.033) (-308.565) (-308.815) [-306.899] * (-314.554) (-308.550) [-308.295] (-311.518) -- 0:00:01
979000 -- (-307.826) (-308.810) (-310.595) [-308.811] * [-307.501] (-310.719) (-306.752) (-308.635) -- 0:00:01
979500 -- (-306.973) [-309.696] (-312.281) (-309.380) * (-306.997) [-313.021] (-309.889) (-308.797) -- 0:00:01
980000 -- (-307.371) [-310.702] (-308.198) (-309.647) * (-309.668) (-307.719) [-307.378] (-307.139) -- 0:00:01
Average standard deviation of split frequencies: 0.009101
980500 -- (-308.107) (-307.520) [-310.321] (-310.486) * (-313.142) (-310.609) (-306.838) [-310.585] -- 0:00:01
981000 -- (-309.728) (-309.287) (-306.691) [-307.786] * [-307.736] (-308.591) (-306.735) (-312.382) -- 0:00:01
981500 -- (-307.978) (-310.011) [-307.190] (-308.642) * (-307.758) [-309.887] (-307.363) (-310.934) -- 0:00:01
982000 -- (-308.017) [-309.312] (-307.414) (-306.908) * [-310.156] (-307.211) (-309.146) (-308.925) -- 0:00:01
982500 -- (-308.214) (-308.827) (-306.634) [-310.226] * [-311.045] (-319.215) (-310.189) (-308.634) -- 0:00:01
983000 -- (-307.839) (-309.413) (-309.003) [-308.202] * [-308.989] (-309.738) (-309.080) (-312.030) -- 0:00:01
983500 -- (-306.444) [-307.404] (-307.647) (-307.436) * (-308.666) [-312.764] (-309.808) (-309.782) -- 0:00:00
984000 -- [-306.916] (-308.603) (-308.183) (-310.775) * (-309.956) (-309.905) [-308.520] (-309.342) -- 0:00:00
984500 -- (-307.636) [-309.178] (-308.595) (-309.929) * (-307.609) (-310.126) (-307.948) [-308.397] -- 0:00:00
985000 -- (-307.659) (-308.214) (-308.046) [-308.974] * (-307.009) [-306.331] (-310.514) (-307.937) -- 0:00:00
Average standard deviation of split frequencies: 0.009179
985500 -- (-308.754) (-310.137) (-308.290) [-308.090] * (-306.860) [-308.148] (-307.252) (-307.710) -- 0:00:00
986000 -- (-306.713) [-307.262] (-308.972) (-310.452) * (-309.376) (-308.924) [-313.314] (-306.871) -- 0:00:00
986500 -- (-306.832) [-308.663] (-307.605) (-310.266) * [-308.054] (-307.638) (-311.073) (-306.878) -- 0:00:00
987000 -- [-306.488] (-309.517) (-312.696) (-310.054) * [-307.426] (-307.726) (-309.254) (-307.039) -- 0:00:00
987500 -- (-311.480) (-313.584) (-311.486) [-310.052] * [-307.879] (-309.508) (-308.903) (-308.509) -- 0:00:00
988000 -- (-308.335) [-308.466] (-307.161) (-312.616) * (-311.795) (-306.781) (-310.485) [-308.448] -- 0:00:00
988500 -- (-308.244) [-308.353] (-310.395) (-312.355) * (-309.432) (-309.790) (-308.471) [-309.367] -- 0:00:00
989000 -- [-307.599] (-311.584) (-309.332) (-312.133) * (-310.970) (-307.964) (-308.683) [-308.927] -- 0:00:00
989500 -- (-310.172) [-309.028] (-307.253) (-312.191) * (-308.573) (-308.228) (-309.231) [-306.505] -- 0:00:00
990000 -- (-309.895) (-306.813) [-307.223] (-310.027) * [-307.585] (-313.148) (-311.024) (-316.702) -- 0:00:00
Average standard deviation of split frequencies: 0.009073
990500 -- (-307.771) (-308.852) [-307.247] (-310.936) * [-309.973] (-310.540) (-306.708) (-311.735) -- 0:00:00
991000 -- [-307.678] (-308.321) (-309.058) (-309.300) * [-308.062] (-311.596) (-308.579) (-313.532) -- 0:00:00
991500 -- (-308.637) [-310.305] (-309.419) (-307.430) * (-307.595) (-310.519) [-308.983] (-308.745) -- 0:00:00
992000 -- [-313.468] (-311.789) (-310.445) (-309.886) * (-313.154) (-312.973) [-309.060] (-310.199) -- 0:00:00
992500 -- (-310.764) [-306.934] (-309.228) (-309.879) * (-310.221) (-310.053) [-307.733] (-307.321) -- 0:00:00
993000 -- (-307.173) (-307.808) (-309.228) [-310.228] * (-310.004) (-308.275) [-307.961] (-308.334) -- 0:00:00
993500 -- (-307.497) [-311.947] (-309.849) (-308.201) * (-308.163) (-309.660) (-309.172) [-307.107] -- 0:00:00
994000 -- [-307.659] (-309.263) (-306.988) (-309.573) * (-311.242) (-309.035) [-310.554] (-309.929) -- 0:00:00
994500 -- (-307.665) (-307.951) [-307.363] (-309.696) * (-307.439) (-312.563) (-307.611) [-308.908] -- 0:00:00
995000 -- (-306.987) (-308.144) (-309.956) [-308.922] * (-307.510) (-310.382) [-308.584] (-308.609) -- 0:00:00
Average standard deviation of split frequencies: 0.009466
995500 -- (-307.986) [-311.434] (-309.632) (-310.029) * (-308.638) (-309.973) [-307.313] (-308.984) -- 0:00:00
996000 -- [-308.231] (-308.181) (-310.742) (-310.644) * (-307.922) [-307.393] (-308.019) (-309.629) -- 0:00:00
996500 -- (-308.340) [-309.174] (-310.535) (-307.593) * [-307.296] (-307.961) (-308.069) (-313.431) -- 0:00:00
997000 -- (-307.603) [-308.063] (-312.515) (-307.223) * [-307.205] (-310.583) (-309.558) (-308.043) -- 0:00:00
997500 -- [-310.562] (-309.041) (-309.261) (-307.695) * (-308.615) (-313.480) [-307.575] (-309.300) -- 0:00:00
998000 -- (-310.296) (-311.173) [-307.733] (-311.220) * [-311.166] (-310.443) (-311.781) (-309.409) -- 0:00:00
998500 -- [-308.693] (-309.701) (-307.959) (-308.786) * (-308.584) (-308.094) (-309.779) [-307.089] -- 0:00:00
999000 -- [-307.535] (-309.183) (-308.358) (-309.507) * (-308.255) (-311.602) [-314.889] (-307.550) -- 0:00:00
999500 -- (-307.815) [-314.508] (-309.802) (-308.882) * [-308.377] (-310.299) (-306.672) (-312.040) -- 0:00:00
1000000 -- (-310.398) (-311.084) (-311.428) [-308.760] * (-306.538) [-308.960] (-308.858) (-307.449) -- 0:00:00
Average standard deviation of split frequencies: 0.009265
Analysis completed in 59 seconds
Analysis used 57.91 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -306.28
Likelihood of best state for "cold" chain of run 2 was -306.28
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 79 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
44.8 % ( 33 %) Dirichlet(Pi{all})
42.2 % ( 32 %) Slider(Pi{all})
78.1 % ( 50 %) Multiplier(Alpha{1,2})
78.0 % ( 61 %) Multiplier(Alpha{3})
27.8 % ( 30 %) Slider(Pinvar{all})
98.5 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.3 % ( 25 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 74 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
45.3 % ( 39 %) Dirichlet(Pi{all})
42.5 % ( 24 %) Slider(Pi{all})
78.9 % ( 52 %) Multiplier(Alpha{1,2})
77.8 % ( 56 %) Multiplier(Alpha{3})
27.4 % ( 23 %) Slider(Pinvar{all})
98.7 % ( 96 %) ExtSPR(Tau{all},V{all})
70.4 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 17 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165727 0.82 0.67
3 | 167628 166639 0.84
4 | 166600 166146 167260
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166511 0.82 0.67
3 | 166657 166223 0.84
4 | 166689 167218 166702
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -308.03
| 1 |
| 1 1 1 |
| 2 2 2 |
| 2 1 1 2 1 1 2 1 2 2 1 |
| 2 1 * 2 1 1 1 1 |
|2 2 2 2 1 22 2 1 1 2 2 2|
| 2 1 2 2 1 22 22 *2 2*1 |
| 2 1 22 * 2 1 1 1 1 |
| 1 2 1 2 11 212* 2 1 22 2 |
| 2 1 1 1 2 1 2 2 1 |
|1 2 2 1 2 1 1|
| 1 1 2 1 1 22 1 2 |
| 11 1 1 1 1 2 1 1 |
| 2 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -309.55
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -308.04 -311.22
2 -307.98 -311.10
--------------------------------------
TOTAL -308.01 -311.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890954 0.085765 0.363507 1.469787 0.862850 1297.91 1399.46 1.000
r(A<->C){all} 0.170013 0.020479 0.000139 0.456787 0.130758 177.76 183.28 1.000
r(A<->G){all} 0.160539 0.019009 0.000023 0.440450 0.122401 144.69 239.08 1.001
r(A<->T){all} 0.179374 0.021419 0.000028 0.462845 0.138539 202.80 205.04 1.000
r(C<->G){all} 0.161319 0.017438 0.000054 0.433210 0.131655 208.57 291.16 1.008
r(C<->T){all} 0.164928 0.019065 0.000031 0.445068 0.130793 151.75 152.59 1.001
r(G<->T){all} 0.163828 0.019146 0.000020 0.447042 0.126309 230.96 239.01 1.006
pi(A){all} 0.192718 0.000648 0.145691 0.244122 0.191700 1120.36 1166.59 1.000
pi(C){all} 0.261933 0.000845 0.203375 0.315796 0.261801 1419.55 1422.26 1.000
pi(G){all} 0.335798 0.001017 0.273066 0.397036 0.335207 1187.17 1248.61 1.000
pi(T){all} 0.209551 0.000737 0.158689 0.263132 0.208871 1117.75 1186.32 1.000
alpha{1,2} 0.414520 0.225391 0.000124 1.419198 0.249505 1169.35 1246.33 1.000
alpha{3} 0.459834 0.244457 0.000191 1.456592 0.288472 1018.64 1239.28 1.000
pinvar{all} 0.992436 0.000083 0.975275 0.999993 0.995295 1362.88 1431.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*.*..
9 -- ..****
10 -- .*.***
11 -- ..*.*.
12 -- .***.*
13 -- .*..*.
14 -- .****.
15 -- .**...
16 -- .*...*
17 -- ....**
18 -- ..**..
19 -- ..*..*
20 -- ...**.
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 484 0.161226 0.025439 0.143238 0.179214 2
8 458 0.152565 0.008480 0.146569 0.158561 2
9 452 0.150566 0.003769 0.147901 0.153231 2
10 440 0.146569 0.001884 0.145237 0.147901 2
11 439 0.146236 0.006124 0.141905 0.150566 2
12 436 0.145237 0.013191 0.135909 0.154564 2
13 435 0.144903 0.017430 0.132578 0.157229 2
14 427 0.142239 0.003298 0.139907 0.144570 2
15 420 0.139907 0.010364 0.132578 0.147235 2
16 416 0.138574 0.003769 0.135909 0.141239 2
17 412 0.137242 0.016017 0.125916 0.148568 2
18 410 0.136576 0.001884 0.135243 0.137908 2
19 409 0.136243 0.014604 0.125916 0.146569 2
20 405 0.134910 0.003298 0.132578 0.137242 2
21 372 0.123917 0.009422 0.117255 0.130580 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100006 0.009877 0.000016 0.302675 0.069156 1.000 2
length{all}[2] 0.099019 0.010142 0.000005 0.296900 0.068031 1.000 2
length{all}[3] 0.097275 0.009494 0.000029 0.290756 0.068165 1.000 2
length{all}[4] 0.100130 0.010288 0.000028 0.304742 0.069186 1.000 2
length{all}[5] 0.096577 0.009701 0.000024 0.287948 0.066492 1.000 2
length{all}[6] 0.097599 0.009385 0.000014 0.295418 0.069475 1.000 2
length{all}[7] 0.094325 0.008428 0.000189 0.280906 0.063194 0.998 2
length{all}[8] 0.103572 0.011535 0.000135 0.297993 0.067800 1.003 2
length{all}[9] 0.099135 0.009568 0.000306 0.288526 0.068625 1.006 2
length{all}[10] 0.100251 0.009273 0.000009 0.297341 0.070270 1.000 2
length{all}[11] 0.104020 0.012838 0.000293 0.309947 0.066573 0.998 2
length{all}[12] 0.101763 0.011852 0.000021 0.311435 0.064182 1.000 2
length{all}[13] 0.098067 0.008580 0.000105 0.283175 0.070986 0.998 2
length{all}[14] 0.103332 0.010127 0.000209 0.313586 0.072306 0.998 2
length{all}[15] 0.101449 0.010005 0.000017 0.306463 0.071125 0.998 2
length{all}[16] 0.110858 0.011802 0.000323 0.342903 0.075911 0.998 2
length{all}[17] 0.091265 0.007149 0.000952 0.253955 0.063374 1.008 2
length{all}[18] 0.103911 0.010014 0.000125 0.288788 0.072836 0.999 2
length{all}[19] 0.092626 0.007409 0.000080 0.267557 0.066017 0.999 2
length{all}[20] 0.096905 0.009006 0.000144 0.275990 0.070116 0.998 2
length{all}[21] 0.099524 0.009216 0.000035 0.274434 0.066007 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009265
Maximum standard deviation of split frequencies = 0.025439
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 225
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 39 patterns at 75 / 75 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 39 patterns at 75 / 75 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
38064 bytes for conP
3432 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042181 0.093393 0.074186 0.050654 0.012065 0.103584 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -319.754710
Iterating by ming2
Initial: fx= 319.754710
x= 0.04218 0.09339 0.07419 0.05065 0.01206 0.10358 0.30000 1.30000
1 h-m-p 0.0000 0.0002 180.6719 +++ 314.463171 m 0.0002 14 | 1/8
2 h-m-p 0.0012 0.0172 22.5132 -----------.. | 1/8
3 h-m-p 0.0000 0.0004 164.9882 +++ 303.360650 m 0.0004 46 | 2/8
4 h-m-p 0.0034 0.0242 17.7285 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 148.2113 ++ 300.841080 m 0.0001 78 | 3/8
6 h-m-p 0.0011 0.0372 13.5008 -----------.. | 3/8
7 h-m-p 0.0000 0.0003 128.3165 +++ 295.564112 m 0.0003 110 | 4/8
8 h-m-p 0.0033 0.0565 10.1836 ------------.. | 4/8
9 h-m-p 0.0000 0.0003 105.0837 +++ 292.665695 m 0.0003 143 | 5/8
10 h-m-p 0.0030 0.1236 6.5902 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 74.5094 ++ 291.891606 m 0.0001 175 | 6/8
12 h-m-p 1.0278 8.0000 0.0000 ++ 291.891606 m 8.0000 186 | 6/8
13 h-m-p 0.4141 8.0000 0.0000 -Y 291.891606 0 0.0259 200 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 +++++ 291.891606 m 8.0000 216 | 6/8
15 h-m-p 0.0160 8.0000 0.3162 +++C 291.891606 0 1.0240 232 | 6/8
16 h-m-p 1.6000 8.0000 0.0088 Y 291.891606 0 1.2555 245 | 6/8
17 h-m-p 1.6000 8.0000 0.0010 --Y 291.891606 0 0.0018 260 | 6/8
18 h-m-p 1.6000 8.0000 0.0000 ----------N 291.891606 0 0.0000 283
Out..
lnL = -291.891606
284 lfun, 284 eigenQcodon, 1704 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089979 0.105053 0.052328 0.075228 0.074707 0.049002 0.605652 0.674163 0.207238
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.189574
np = 9
lnL0 = -323.743990
Iterating by ming2
Initial: fx= 323.743990
x= 0.08998 0.10505 0.05233 0.07523 0.07471 0.04900 0.60565 0.67416 0.20724
1 h-m-p 0.0000 0.0007 166.6018 ++++ 303.241432 m 0.0007 16 | 1/9
2 h-m-p 0.0000 0.0002 88.0451 ++ 302.017338 m 0.0002 28 | 2/9
3 h-m-p 0.0000 0.0001 2395.3123 ++ 295.160046 m 0.0001 40 | 3/9
4 h-m-p 0.0000 0.0000 578.2458 ++ 295.038530 m 0.0000 52 | 4/9
5 h-m-p 0.0000 0.0000 1029.2695 ++ 294.572852 m 0.0000 64 | 5/9
6 h-m-p 0.0009 0.1801 6.3108 -----------.. | 5/9
7 h-m-p 0.0000 0.0002 104.2131 ++ 292.913852 m 0.0002 97 | 6/9
8 h-m-p 0.0128 6.1289 0.8731 -------------.. | 6/9
9 h-m-p 0.0000 0.0002 74.5175 +++ 291.891622 m 0.0002 136 | 7/9
10 h-m-p 1.4769 8.0000 0.0000 ++ 291.891622 m 8.0000 148 | 6/9
11 h-m-p 0.1943 8.0000 0.0001 +++ 291.891622 m 8.0000 163 | 6/9
12 h-m-p 0.0210 8.0000 0.0258 +++++ 291.891620 m 8.0000 181 | 6/9
13 h-m-p 0.1052 0.5260 0.8685 ++ 291.891617 m 0.5260 196 | 6/9
14 h-m-p -0.0000 -0.0000 1.3169
h-m-p: -1.84690304e-18 -9.23451522e-18 1.31693087e+00 291.891617
.. | 6/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 291.891617 m 8.0000 223 | 6/9
16 h-m-p 0.0021 0.0105 0.0203 ------Y 291.891617 0 0.0000 244 | 6/9
17 h-m-p 0.0026 1.3107 0.0001 +++++ 291.891617 m 1.3107 262 | 6/9
18 h-m-p -0.0000 -0.0000 0.3773
h-m-p: -0.00000000e+00 -0.00000000e+00 3.77268834e-01 291.891617
.. | 6/9
19 h-m-p 0.0160 8.0000 0.0000 +++++ 291.891617 m 8.0000 292 | 6/9
20 h-m-p 0.0042 2.1228 0.2910 +++++ 291.891609 m 2.1228 310 | 7/9
21 h-m-p 1.6000 8.0000 0.0060 ++ 291.891609 m 8.0000 325 | 7/9
22 h-m-p 0.0189 0.1965 2.5472 ----------C 291.891609 0 0.0000 349 | 7/9
23 h-m-p 1.5369 8.0000 0.0000 ---------------Y 291.891609 0 0.0000 376 | 7/9
24 h-m-p 0.0160 8.0000 0.0000 ------------- | 7/9
25 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -291.891609
427 lfun, 1281 eigenQcodon, 5124 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068182 0.073938 0.052373 0.045190 0.019304 0.047941 0.097976 1.047869 0.135272 0.240252 1.616713
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.136959
np = 11
lnL0 = -313.731857
Iterating by ming2
Initial: fx= 313.731857
x= 0.06818 0.07394 0.05237 0.04519 0.01930 0.04794 0.09798 1.04787 0.13527 0.24025 1.61671
1 h-m-p 0.0000 0.0003 165.8645 +++ 305.820365 m 0.0003 28 | 1/11
2 h-m-p 0.0009 0.0047 49.2194 ++ 296.251144 m 0.0047 53 | 2/11
3 h-m-p 0.0000 0.0000 4603.8972 ++ 295.435751 m 0.0000 77 | 3/11
4 h-m-p 0.0000 0.0000 275.9056 ++ 295.404866 m 0.0000 100 | 4/11
5 h-m-p 0.0001 0.0118 9.7672 ---------.. | 4/11
6 h-m-p 0.0000 0.0001 125.7199 ++ 294.512550 m 0.0001 150 | 5/11
7 h-m-p 0.0026 0.1185 2.1920 ------------.. | 5/11
8 h-m-p 0.0000 0.0002 103.3148 +++ 292.302238 m 0.0002 202 | 6/11
9 h-m-p 0.0124 0.2847 1.2029 -------------.. | 6/11
10 h-m-p 0.0000 0.0001 74.7352 ++ 291.891618 m 0.0001 252 | 7/11
11 h-m-p 0.0518 8.0000 0.0000 ++++ 291.891618 m 8.0000 273 | 6/11
12 h-m-p 0.0001 0.0702 14.7930 +++++ 291.891615 m 0.0702 294 | 6/11
13 h-m-p -0.0000 -0.0000 0.8744
h-m-p: -0.00000000e+00 -0.00000000e+00 8.74361636e-01 291.891615
.. | 6/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 291.891615 m 8.0000 332 | 6/11
15 h-m-p 0.0057 2.8575 0.4741 +++++ 291.891609 m 2.8575 354 | 7/11
16 h-m-p 1.6000 8.0000 0.0537 ++ 291.891609 m 8.0000 373 | 7/11
17 h-m-p 1.2409 8.0000 0.3460 C 291.891609 0 1.2409 391 | 7/11
18 h-m-p 1.6000 8.0000 0.0102 Y 291.891609 0 1.1217 409 | 7/11
19 h-m-p 1.6000 8.0000 0.0006 ++ 291.891609 m 8.0000 427 | 7/11
20 h-m-p 1.2929 8.0000 0.0039 ++ 291.891609 m 8.0000 445 | 7/11
21 h-m-p 1.6000 8.0000 0.0016 ++ 291.891609 m 8.0000 463 | 7/11
22 h-m-p 0.0454 8.0000 0.2837 +++Y 291.891608 0 4.2851 484 | 7/11
23 h-m-p 1.6000 8.0000 0.1312 ++ 291.891607 m 8.0000 502 | 7/11
24 h-m-p 0.5327 3.9156 1.9706 -------------Y 291.891607 0 0.0000 533 | 7/11
25 h-m-p 0.0160 8.0000 2.7888 +++Y 291.891605 0 2.5208 554 | 7/11
26 h-m-p 1.6000 8.0000 0.2735 Y 291.891605 0 3.2474 572 | 7/11
27 h-m-p 1.6000 8.0000 0.0443 C 291.891605 0 0.5895 590 | 7/11
28 h-m-p 1.6000 8.0000 0.0014 ----C 291.891605 0 0.0016 612 | 7/11
29 h-m-p 0.0160 8.0000 0.0052 +++++ 291.891605 m 8.0000 633 | 7/11
30 h-m-p 0.0038 1.8579 10.9779 +++++ 291.891601 m 1.8579 654 | 8/11
31 h-m-p 0.4500 2.2500 12.5991 Y 291.891599 0 1.0243 672 | 8/11
32 h-m-p 0.5759 2.8794 5.3631 Y 291.891599 0 0.3534 689 | 8/11
33 h-m-p 1.6000 8.0000 0.5202 Y 291.891599 0 0.8794 706 | 8/11
34 h-m-p 1.6000 8.0000 0.0135 ++ 291.891599 m 8.0000 723 | 8/11
35 h-m-p 0.2762 8.0000 0.3923 +Y 291.891599 0 2.5655 741 | 8/11
36 h-m-p 1.6000 8.0000 0.0171 ++ 291.891599 m 8.0000 758 | 8/11
37 h-m-p 0.0158 7.9089 16.7111 ++C 291.891592 0 0.3961 777 | 8/11
38 h-m-p 0.7572 8.0000 8.7403 +Y 291.891590 0 5.0935 795 | 8/11
39 h-m-p 1.6000 8.0000 1.1420 ++ 291.891589 m 8.0000 812 | 8/11
40 h-m-p 1.6000 8.0000 1.2666 ++ 291.891589 m 8.0000 829 | 8/11
41 h-m-p 1.0753 8.0000 9.4231 ++ 291.891589 m 8.0000 846 | 8/11
42 h-m-p 1.6000 8.0000 24.2635 ++ 291.891589 m 8.0000 863 | 8/11
43 h-m-p 1.6000 8.0000 35.2312 ++ 291.891589 m 8.0000 880 | 8/11
44 h-m-p 0.0409 0.2043 171.5086 ++ 291.891589 m 0.2043 897 | 8/11
45 h-m-p -0.0000 -0.0000 100.5975
h-m-p: -0.00000000e+00 -0.00000000e+00 1.00597472e+02 291.891589
.. | 8/11
46 h-m-p 0.0160 8.0000 0.0000 +Y 291.891589 0 0.0640 929 | 8/11
47 h-m-p 0.2500 8.0000 0.0000 ---Y 291.891589 0 0.0010 949
Out..
lnL = -291.891589
950 lfun, 3800 eigenQcodon, 17100 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -291.889822 S = -291.889816 -0.000003
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:06
did 20 / 39 patterns 0:06
did 30 / 39 patterns 0:06
did 39 / 39 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108275 0.081927 0.070300 0.068752 0.035323 0.042862 0.000100 0.379245 1.250182
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.595016
np = 9
lnL0 = -321.126245
Iterating by ming2
Initial: fx= 321.126245
x= 0.10828 0.08193 0.07030 0.06875 0.03532 0.04286 0.00011 0.37924 1.25018
1 h-m-p 0.0000 0.0000 167.2320 ++ 320.859770 m 0.0000 23 | 1/9
2 h-m-p 0.0001 0.0591 11.0861 ----------.. | 1/9
3 h-m-p 0.0000 0.0005 167.3901 +++ 306.520042 m 0.0005 73 | 2/9
4 h-m-p 0.0092 0.0941 8.2429 -------------.. | 2/9
5 h-m-p 0.0000 0.0001 160.3252 ++ 303.798602 m 0.0001 123 | 3/9
6 h-m-p 0.0031 0.2340 4.8635 ------------.. | 3/9
7 h-m-p 0.0000 0.0004 144.3196 +++ 296.093112 m 0.0004 171 | 4/9
8 h-m-p 0.0144 0.4381 3.1594 -------------.. | 4/9
9 h-m-p 0.0000 0.0000 128.7819 ++ 295.738334 m 0.0000 217 | 5/9
10 h-m-p 0.0014 0.7047 2.7114 -----------.. | 5/9
11 h-m-p 0.0000 0.0002 104.8806 +++ 293.954438 m 0.0002 260 | 6/9
12 h-m-p 0.0058 1.0526 2.0583 ------------.. | 6/9
13 h-m-p 0.0000 0.0004 74.4300 +++ 291.891635 m 0.0004 302 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 291.891635 m 8.0000 317 | 7/9
15 h-m-p 0.0000 0.0093 95.6869 -------C 291.891635 0 0.0000 338 | 7/9
16 h-m-p 0.0160 8.0000 0.0004 +++++ 291.891635 m 8.0000 355 | 7/9
17 h-m-p 0.0160 8.0000 0.5686 +++++ 291.891630 m 8.0000 372 | 7/9
18 h-m-p 1.6000 8.0000 0.1881 ++ 291.891630 m 8.0000 386 | 7/9
19 h-m-p 0.5926 8.0000 2.5395 ++ 291.891629 m 8.0000 400 | 7/9
20 h-m-p 1.6000 8.0000 1.5283 ++ 291.891629 m 8.0000 414 | 7/9
21 h-m-p 1.1838 6.6987 10.3278 ++ 291.891629 m 6.6987 428 | 7/9
22 h-m-p 0.0000 0.0000 10.2999
h-m-p: 0.00000000e+00 0.00000000e+00 1.02999229e+01 291.891629
.. | 7/9
23 h-m-p 0.0160 8.0000 0.0000 C 291.891629 0 0.0160 453 | 6/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 291.891629 m 8.0000 470 | 6/9
25 h-m-p 0.0160 8.0000 0.0251 +++++ 291.891627 m 8.0000 488 | 6/9
26 h-m-p 0.1909 8.0000 1.0508 +++ 291.891609 m 8.0000 504 | 6/9
27 h-m-p 1.6000 8.0000 0.3896 ++ 291.891607 m 8.0000 519 | 6/9
28 h-m-p 0.8012 8.0000 3.8895 ++ 291.891606 m 8.0000 534 | 6/9
29 h-m-p 1.6000 8.0000 1.5119 +C 291.891606 0 5.6681 550 | 6/9
30 h-m-p 1.6000 8.0000 0.5619 Y 291.891606 0 0.6492 565 | 6/9
31 h-m-p 1.6000 8.0000 0.0229 Y 291.891606 0 0.1042 580 | 6/9
32 h-m-p 1.2571 8.0000 0.0019 ++ 291.891606 m 8.0000 595 | 6/9
33 h-m-p 1.6000 8.0000 0.0004 ++ 291.891606 m 8.0000 610 | 6/9
34 h-m-p 0.0202 8.0000 0.1431 +++Y 291.891606 0 2.0762 628 | 6/9
35 h-m-p 1.6000 8.0000 0.0616 C 291.891606 0 2.1331 643 | 6/9
36 h-m-p 1.6000 8.0000 0.0178 ++ 291.891606 m 8.0000 658 | 6/9
37 h-m-p 0.1428 8.0000 0.9969 ++C 291.891606 0 2.2846 675 | 6/9
38 h-m-p 1.6000 8.0000 0.0681 ++ 291.891606 m 8.0000 690 | 6/9
39 h-m-p 0.0008 0.0376 718.1841 +++ 291.891604 m 0.0376 706 | 7/9
40 h-m-p 0.0061 0.0306 2043.6409 -----------Y 291.891604 0 0.0000 732 | 7/9
41 h-m-p 0.0109 5.4502 23.3237 +++++ 291.891593 m 5.4502 749 | 8/9
42 h-m-p 1.6000 8.0000 32.5574 ++ 291.891593 m 8.0000 763 | 8/9
43 h-m-p 1.6000 8.0000 47.8143 ++ 291.891592 m 8.0000 776 | 8/9
44 h-m-p 0.2974 1.4868 127.5267 ++ 291.891592 m 1.4868 789 | 9/9
45 h-m-p 0.0160 8.0000 0.0000 Y 291.891592 0 0.0160 802 | 9/9
46 h-m-p 0.0160 8.0000 0.0000 Y 291.891592 0 0.0160 814
Out..
lnL = -291.891592
815 lfun, 8965 eigenQcodon, 48900 P(t)
Time used: 0:20
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095293 0.105640 0.074263 0.076755 0.016914 0.062463 999.000000 0.900000 0.592332 1.946791 1.437797
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.030235
np = 11
lnL0 = -321.396192
Iterating by ming2
Initial: fx= 321.396192
x= 0.09529 0.10564 0.07426 0.07676 0.01691 0.06246 951.42857 0.90000 0.59233 1.94679 1.43780
1 h-m-p 0.0000 0.0003 156.2063 +++ 315.085651 m 0.0003 28 | 1/11
2 h-m-p 0.0004 0.0025 91.6082 ++ 299.191166 m 0.0025 53 | 2/11
3 h-m-p 0.0000 0.0001 599.8404 ++ 295.927366 m 0.0001 77 | 3/11
4 h-m-p 0.0076 0.0382 8.6413 -------------.. | 3/11
5 h-m-p 0.0000 0.0000 125.2543 ++ 295.389040 m 0.0000 133 | 4/11
6 h-m-p 0.0006 0.0830 5.3656 -----------.. | 4/11
7 h-m-p 0.0000 0.0003 102.1446 +++ 292.672709 m 0.0003 186 | 5/11
8 h-m-p 0.0059 0.1378 3.1235 ------------.. | 5/11
9 h-m-p 0.0000 0.0001 73.9015 ++ 291.891608 m 0.0001 237 | 6/11
10 h-m-p 0.3154 8.0000 0.0000 +++ 291.891608 m 8.0000 258 | 6/11
11 h-m-p 0.0110 5.4901 0.2449 ----------Y 291.891608 0 0.0000 287 | 6/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 291.891608 m 8.0000 309 | 6/11
13 h-m-p 0.0006 0.3126 6.1689 ---------Y 291.891608 0 0.0000 337 | 6/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 291.891608 m 8.0000 359 | 6/11
15 h-m-p 0.0015 0.7313 0.7476 +++++ 291.891606 m 0.7313 381 | 7/11
16 h-m-p 0.7016 3.8999 0.3270 ++ 291.891604 m 3.8999 400 | 8/11
17 h-m-p 0.4134 8.0000 2.9923 -----------C 291.891604 0 0.0000 429 | 8/11
18 h-m-p 0.0160 8.0000 0.0001 ----N 291.891604 0 0.0000 450 | 8/11
19 h-m-p 0.0160 8.0000 0.0000 --Y 291.891604 0 0.0003 469
Out..
lnL = -291.891604
470 lfun, 5640 eigenQcodon, 31020 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -291.897622 S = -291.890936 -0.002930
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:28
did 20 / 39 patterns 0:28
did 30 / 39 patterns 0:29
did 39 / 39 patterns 0:29
Time used: 0:29
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=75
NC_011896_1_WP_010907720_1_438_MLBR_RS02080 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
NC_002677_1_NP_301396_1_268_ML0425 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
**************************************************
NC_011896_1_WP_010907720_1_438_MLBR_RS02080 PAVIAALVSCAVLTVIVVVRKVKNR
NC_002677_1_NP_301396_1_268_ML0425 PAVIAALVSCAVLTVIVVVRKVKNR
NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020 PAVIAALVSCAVLTVIVVVRKVKNR
NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365 PAVIAALVSCAVLTVIVVVRKVKNR
NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280 PAVIAALVSCAVLTVIVVVRKVKNR
NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365 PAVIAALVSCAVLTVIVVVRKVKNR
*************************
>NC_011896_1_WP_010907720_1_438_MLBR_RS02080 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT TGTGGTACGCAAGGTCAAGAATCGC >NC_002677_1_NP_301396_1_268_ML0425 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT TGTGGTACGCAAGGTCAAGAATCGC >NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT TGTGGTACGCAAGGTCAAGAATCGC >NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT TGTGGTACGCAAGGTCAAGAATCGC >NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT TGTGGTACGCAAGGTCAAGAATCGC >NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365 GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT TGTGGTACGCAAGGTCAAGAATCGC
>NC_011896_1_WP_010907720_1_438_MLBR_RS02080 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR PAVIAALVSCAVLTVIVVVRKVKNR >NC_002677_1_NP_301396_1_268_ML0425 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR PAVIAALVSCAVLTVIVVVRKVKNR >NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR PAVIAALVSCAVLTVIVVVRKVKNR >NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR PAVIAALVSCAVLTVIVVVRKVKNR >NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR PAVIAALVSCAVLTVIVVVRKVKNR >NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365 VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR PAVIAALVSCAVLTVIVVVRKVKNR
#NEXUS
[ID: 1746845858]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907720_1_438_MLBR_RS02080
NC_002677_1_NP_301396_1_268_ML0425
NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020
NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365
NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280
NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907720_1_438_MLBR_RS02080,
2 NC_002677_1_NP_301396_1_268_ML0425,
3 NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020,
4 NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365,
5 NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280,
6 NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06915638,2:0.06803088,3:0.0681652,4:0.06918591,5:0.06649244,6:0.06947549);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06915638,2:0.06803088,3:0.0681652,4:0.06918591,5:0.06649244,6:0.06947549);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -308.04 -311.22
2 -307.98 -311.10
--------------------------------------
TOTAL -308.01 -311.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890954 0.085765 0.363507 1.469787 0.862850 1297.91 1399.46 1.000
r(A<->C){all} 0.170013 0.020479 0.000139 0.456787 0.130758 177.76 183.28 1.000
r(A<->G){all} 0.160539 0.019009 0.000023 0.440450 0.122401 144.69 239.08 1.001
r(A<->T){all} 0.179374 0.021419 0.000028 0.462845 0.138539 202.80 205.04 1.000
r(C<->G){all} 0.161319 0.017438 0.000054 0.433210 0.131655 208.57 291.16 1.008
r(C<->T){all} 0.164928 0.019065 0.000031 0.445068 0.130793 151.75 152.59 1.001
r(G<->T){all} 0.163828 0.019146 0.000020 0.447042 0.126309 230.96 239.01 1.006
pi(A){all} 0.192718 0.000648 0.145691 0.244122 0.191700 1120.36 1166.59 1.000
pi(C){all} 0.261933 0.000845 0.203375 0.315796 0.261801 1419.55 1422.26 1.000
pi(G){all} 0.335798 0.001017 0.273066 0.397036 0.335207 1187.17 1248.61 1.000
pi(T){all} 0.209551 0.000737 0.158689 0.263132 0.208871 1117.75 1186.32 1.000
alpha{1,2} 0.414520 0.225391 0.000124 1.419198 0.249505 1169.35 1246.33 1.000
alpha{3} 0.459834 0.244457 0.000191 1.456592 0.288472 1018.64 1239.28 1.000
pinvar{all} 0.992436 0.000083 0.975275 0.999993 0.995295 1362.88 1431.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0425/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 75
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 3 3 3 3 3 3
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 1 1 1 1 1 1 | ACC 3 3 3 3 3 3 | AAC 0 0 0 0 0 0 | AGC 0 0 0 0 0 0
ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 0 0 0 0 0 0 | ACG 0 0 0 0 0 0 | AAG 4 4 4 4 4 4 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 1 1 1 1 1 1 | Asp GAT 1 1 1 1 1 1 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 5 5 5 5 5 5 | GAC 4 4 4 4 4 4 | GGC 0 0 0 0 0 0
GTA 3 3 3 3 3 3 | GCA 1 1 1 1 1 1 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 5 5 5 5 5 5 | GCG 5 5 5 5 5 5 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907720_1_438_MLBR_RS02080
position 1: T:0.06667 C:0.24000 A:0.21333 G:0.48000
position 2: T:0.33333 C:0.25333 A:0.22667 G:0.18667
position 3: T:0.22667 C:0.29333 A:0.13333 G:0.34667
Average T:0.20889 C:0.26222 A:0.19111 G:0.33778
#2: NC_002677_1_NP_301396_1_268_ML0425
position 1: T:0.06667 C:0.24000 A:0.21333 G:0.48000
position 2: T:0.33333 C:0.25333 A:0.22667 G:0.18667
position 3: T:0.22667 C:0.29333 A:0.13333 G:0.34667
Average T:0.20889 C:0.26222 A:0.19111 G:0.33778
#3: NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020
position 1: T:0.06667 C:0.24000 A:0.21333 G:0.48000
position 2: T:0.33333 C:0.25333 A:0.22667 G:0.18667
position 3: T:0.22667 C:0.29333 A:0.13333 G:0.34667
Average T:0.20889 C:0.26222 A:0.19111 G:0.33778
#4: NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365
position 1: T:0.06667 C:0.24000 A:0.21333 G:0.48000
position 2: T:0.33333 C:0.25333 A:0.22667 G:0.18667
position 3: T:0.22667 C:0.29333 A:0.13333 G:0.34667
Average T:0.20889 C:0.26222 A:0.19111 G:0.33778
#5: NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280
position 1: T:0.06667 C:0.24000 A:0.21333 G:0.48000
position 2: T:0.33333 C:0.25333 A:0.22667 G:0.18667
position 3: T:0.22667 C:0.29333 A:0.13333 G:0.34667
Average T:0.20889 C:0.26222 A:0.19111 G:0.33778
#6: NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365
position 1: T:0.06667 C:0.24000 A:0.21333 G:0.48000
position 2: T:0.33333 C:0.25333 A:0.22667 G:0.18667
position 3: T:0.22667 C:0.29333 A:0.13333 G:0.34667
Average T:0.20889 C:0.26222 A:0.19111 G:0.33778
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 6
TTC 6 | TCC 0 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 18
CTC 12 | CCC 6 | CAC 0 | CGC 18
CTA 0 | CCA 6 | Gln Q CAA 0 | CGA 0
CTG 12 | CCG 6 | CAG 6 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 12 | Ser S AGT 6
ATC 6 | ACC 18 | AAC 0 | AGC 0
ATA 12 | ACA 0 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 0 | ACG 0 | AAG 24 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 6 | Asp D GAT 6 | Gly G GGT 6
GTC 12 | GCC 30 | GAC 24 | GGC 0
GTA 18 | GCA 6 | Glu E GAA 6 | GGA 0
GTG 30 | GCG 30 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06667 C:0.24000 A:0.21333 G:0.48000
position 2: T:0.33333 C:0.25333 A:0.22667 G:0.18667
position 3: T:0.22667 C:0.29333 A:0.13333 G:0.34667
Average T:0.20889 C:0.26222 A:0.19111 G:0.33778
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -291.891606 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.605652 1.437797
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907720_1_438_MLBR_RS02080: 0.000004, NC_002677_1_NP_301396_1_268_ML0425: 0.000004, NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020: 0.000004, NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365: 0.000004, NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280: 0.000004, NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.60565
omega (dN/dS) = 1.43780
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 159.7 65.3 1.4378 0.0000 0.0000 0.0 0.0
7..2 0.000 159.7 65.3 1.4378 0.0000 0.0000 0.0 0.0
7..3 0.000 159.7 65.3 1.4378 0.0000 0.0000 0.0 0.0
7..4 0.000 159.7 65.3 1.4378 0.0000 0.0000 0.0 0.0
7..5 0.000 159.7 65.3 1.4378 0.0000 0.0000 0.0 0.0
7..6 0.000 159.7 65.3 1.4378 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 9): -291.891609 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.097976 0.000010 0.525770
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907720_1_438_MLBR_RS02080: 0.000004, NC_002677_1_NP_301396_1_268_ML0425: 0.000004, NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020: 0.000004, NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365: 0.000004, NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280: 0.000004, NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.09798
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.52577 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 162.0 63.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 162.0 63.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 162.0 63.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 162.0 63.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 162.0 63.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 162.0 63.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -291.891589 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 1.000000 649.939908
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907720_1_438_MLBR_RS02080: 0.000004, NC_002677_1_NP_301396_1_268_ML0425: 0.000004, NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020: 0.000004, NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365: 0.000004, NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280: 0.000004, NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 649.93991
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 162.5 62.5 649.9399 0.0000 0.0000 0.0 0.0
7..2 0.000 162.5 62.5 649.9399 0.0000 0.0000 0.0 0.0
7..3 0.000 162.5 62.5 649.9399 0.0000 0.0000 0.0 0.0
7..4 0.000 162.5 62.5 649.9399 0.0000 0.0000 0.0 0.0
7..5 0.000 162.5 62.5 649.9399 0.0000 0.0000 0.0 0.0
7..6 0.000 162.5 62.5 649.9399 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907720_1_438_MLBR_RS02080)
Pr(w>1) post mean +- SE for w
1 V 1.000** 649.940
2 A 1.000** 649.940
3 D 1.000** 649.940
4 R 1.000** 649.940
5 H 1.000** 649.940
6 P 1.000** 649.940
7 D 1.000** 649.940
8 T 1.000** 649.940
9 I 1.000** 649.940
10 K 1.000** 649.940
11 L 1.000** 649.940
12 E 1.000** 649.940
13 I 1.000** 649.940
14 D 1.000** 649.940
15 V 1.000** 649.940
16 A 1.000** 649.940
17 R 1.000** 649.940
18 E 1.000** 649.940
19 Q 1.000** 649.940
20 F 1.000** 649.940
21 A 1.000** 649.940
22 A 1.000** 649.940
23 T 1.000** 649.940
24 V 1.000** 649.940
25 D 1.000** 649.940
26 S 1.000** 649.940
27 L 1.000** 649.940
28 A 1.000** 649.940
29 E 1.000** 649.940
30 R 1.000** 649.940
31 A 1.000** 649.940
32 N 1.000** 649.940
33 P 1.000** 649.940
34 R 1.000** 649.940
35 R 1.000** 649.940
36 L 1.000** 649.940
37 A 1.000** 649.940
38 G 1.000** 649.940
39 D 1.000** 649.940
40 L 1.000** 649.940
41 K 1.000** 649.940
42 A 1.000** 649.940
43 R 1.000** 649.940
44 V 1.000** 649.940
45 V 1.000** 649.940
46 E 1.000** 649.940
47 F 1.000** 649.940
48 G 1.000** 649.940
49 R 1.000** 649.940
50 R 1.000** 649.940
51 P 1.000** 649.940
52 A 1.000** 649.940
53 V 1.000** 649.940
54 I 1.000** 649.940
55 A 1.000** 649.940
56 A 1.000** 649.940
57 L 1.000** 649.940
58 V 1.000** 649.940
59 S 1.000** 649.940
60 C 1.000** 649.940
61 A 1.000** 649.940
62 V 1.000** 649.940
63 L 1.000** 649.940
64 T 1.000** 649.940
65 V 1.000** 649.940
66 I 1.000** 649.940
67 V 1.000** 649.940
68 V 1.000** 649.940
69 V 1.000** 649.940
70 R 1.000** 649.940
71 K 1.000** 649.940
72 V 1.000** 649.940
73 K 1.000** 649.940
74 N 1.000** 649.940
75 R 1.000** 649.940
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907720_1_438_MLBR_RS02080)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -291.891592 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 999.000000 0.005000 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907720_1_438_MLBR_RS02080: 0.000004, NC_002677_1_NP_301396_1_268_ML0425: 0.000004, NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020: 0.000004, NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365: 0.000004, NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280: 0.000004, NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M7 (beta):
p = 0.00500 q = 99.00000
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 150.7 74.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 150.7 74.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 150.7 74.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 150.7 74.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 150.7 74.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 150.7 74.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:20
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -291.891604 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.436977 0.999990 1.678118 2.851670 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907720_1_438_MLBR_RS02080: 0.000004, NC_002677_1_NP_301396_1_268_ML0425: 0.000004, NZ_LVXE01000046_1_WP_010907720_1_1957_A3216_RS11020: 0.000004, NZ_LYPH01000052_1_WP_010907720_1_1959_A8144_RS09365: 0.000004, NZ_CP029543_1_WP_010907720_1_446_DIJ64_RS02280: 0.000004, NZ_AP014567_1_WP_010907720_1_463_JK2ML_RS02365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.43698
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 1.67812 q = 2.85167
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.07145 0.14514 0.20615 0.26359 0.32077 0.38002 0.44384 0.51609 0.60487 0.73958 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 150.7 74.3 0.3692 0.0000 0.0000 0.0 0.0
7..2 0.000 150.7 74.3 0.3692 0.0000 0.0000 0.0 0.0
7..3 0.000 150.7 74.3 0.3692 0.0000 0.0000 0.0 0.0
7..4 0.000 150.7 74.3 0.3692 0.0000 0.0000 0.0 0.0
7..5 0.000 150.7 74.3 0.3692 0.0000 0.0000 0.0 0.0
7..6 0.000 150.7 74.3 0.3692 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907720_1_438_MLBR_RS02080)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:29
Model 1: NearlyNeutral -291.891609 Model 2: PositiveSelection -291.891589 Model 0: one-ratio -291.891606 Model 7: beta -291.891592 Model 8: beta&w>1 -291.891604 Model 0 vs 1 5.999999984851456E-6 Model 2 vs 1 4.0000000012696546E-5 Model 8 vs 7 2.3999999939405825E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
