--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 17:36:21 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0425/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -308.04          -311.22
2       -307.98          -311.10
--------------------------------------
TOTAL     -308.01          -311.16
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890954    0.085765    0.363507    1.469787    0.862850   1297.91   1399.46    1.000
r(A<->C){all}   0.170013    0.020479    0.000139    0.456787    0.130758    177.76    183.28    1.000
r(A<->G){all}   0.160539    0.019009    0.000023    0.440450    0.122401    144.69    239.08    1.001
r(A<->T){all}   0.179374    0.021419    0.000028    0.462845    0.138539    202.80    205.04    1.000
r(C<->G){all}   0.161319    0.017438    0.000054    0.433210    0.131655    208.57    291.16    1.008
r(C<->T){all}   0.164928    0.019065    0.000031    0.445068    0.130793    151.75    152.59    1.001
r(G<->T){all}   0.163828    0.019146    0.000020    0.447042    0.126309    230.96    239.01    1.006
pi(A){all}      0.192718    0.000648    0.145691    0.244122    0.191700   1120.36   1166.59    1.000
pi(C){all}      0.261933    0.000845    0.203375    0.315796    0.261801   1419.55   1422.26    1.000
pi(G){all}      0.335798    0.001017    0.273066    0.397036    0.335207   1187.17   1248.61    1.000
pi(T){all}      0.209551    0.000737    0.158689    0.263132    0.208871   1117.75   1186.32    1.000
alpha{1,2}      0.414520    0.225391    0.000124    1.419198    0.249505   1169.35   1246.33    1.000
alpha{3}        0.459834    0.244457    0.000191    1.456592    0.288472   1018.64   1239.28    1.000
pinvar{all}     0.992436    0.000083    0.975275    0.999993    0.995295   1362.88   1431.94    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-291.891609
Model 2: PositiveSelection	-291.891589
Model 0: one-ratio	-291.891606
Model 7: beta	-291.891592
Model 8: beta&w>1	-291.891604


Model 0 vs 1	5.999999984851456E-6

Model 2 vs 1	4.0000000012696546E-5

Model 8 vs 7	2.3999999939405825E-5
>C1
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C2
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C3
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C4
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C5
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C6
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=75 

C1              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C2              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C3              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C4              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C5              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C6              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
                **************************************************

C1              PAVIAALVSCAVLTVIVVVRKVKNR
C2              PAVIAALVSCAVLTVIVVVRKVKNR
C3              PAVIAALVSCAVLTVIVVVRKVKNR
C4              PAVIAALVSCAVLTVIVVVRKVKNR
C5              PAVIAALVSCAVLTVIVVVRKVKNR
C6              PAVIAALVSCAVLTVIVVVRKVKNR
                *************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2250]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2250]--->[2250]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.447 Mb, Max= 30.595 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C2              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C3              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C4              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C5              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
C6              VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
                **************************************************

C1              PAVIAALVSCAVLTVIVVVRKVKNR
C2              PAVIAALVSCAVLTVIVVVRKVKNR
C3              PAVIAALVSCAVLTVIVVVRKVKNR
C4              PAVIAALVSCAVLTVIVVVRKVKNR
C5              PAVIAALVSCAVLTVIVVVRKVKNR
C6              PAVIAALVSCAVLTVIVVVRKVKNR
                *************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C2              GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C3              GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C4              GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C5              GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
C6              GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
                **************************************************

C1              TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C2              TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C3              TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C4              TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C5              TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
C6              TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
                **************************************************

C1              GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C2              GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C3              GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C4              GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C5              GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
C6              GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
                **************************************************

C1              CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C2              CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C3              CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C4              CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C5              CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
C6              CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
                **************************************************

C1              TGTGGTACGCAAGGTCAAGAATCGC
C2              TGTGGTACGCAAGGTCAAGAATCGC
C3              TGTGGTACGCAAGGTCAAGAATCGC
C4              TGTGGTACGCAAGGTCAAGAATCGC
C5              TGTGGTACGCAAGGTCAAGAATCGC
C6              TGTGGTACGCAAGGTCAAGAATCGC
                *************************



>C1
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C2
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C3
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C4
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C5
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C6
GTGGCGGACCGGCATCCAGACACCATAAAGCTGGAGATTGACGTTGCCCG
TGAACAGTTCGCGGCGACCGTCGACTCACTTGCTGAGCGTGCCAATCCCC
GCCGTCTCGCCGGTGATCTCAAGGCCCGGGTGGTAGAGTTTGGGAGAAGG
CCGGCGGTGATCGCCGCGCTGGTAAGTTGTGCAGTTTTGACCGTGATAGT
TGTGGTACGCAAGGTCAAGAATCGC
>C1
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C2
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C3
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C4
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C5
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR
>C6
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRR
PAVIAALVSCAVLTVIVVVRKVKNR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 225 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579800890
      Setting output file names to "/data/4res/ML0425/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 986755636
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1746845858
      Seed = 1257424353
      Swapseed = 1579800890
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -503.560786 -- -24.965149
         Chain 2 -- -503.560756 -- -24.965149
         Chain 3 -- -503.560786 -- -24.965149
         Chain 4 -- -503.560756 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -503.560786 -- -24.965149
         Chain 2 -- -503.560786 -- -24.965149
         Chain 3 -- -503.560786 -- -24.965149
         Chain 4 -- -503.560786 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-503.561] (-503.561) (-503.561) (-503.561) * [-503.561] (-503.561) (-503.561) (-503.561) 
        500 -- (-312.034) (-317.872) (-316.973) [-318.639] * (-318.159) (-320.155) (-318.870) [-316.875] -- 0:00:00
       1000 -- (-319.304) (-315.912) [-319.210] (-322.303) * [-316.759] (-316.274) (-319.028) (-312.667) -- 0:00:00
       1500 -- (-312.975) [-313.399] (-314.071) (-318.034) * [-320.170] (-320.743) (-319.856) (-318.873) -- 0:00:00
       2000 -- [-315.441] (-318.534) (-319.148) (-317.781) * (-319.453) [-318.849] (-314.401) (-321.442) -- 0:00:00
       2500 -- (-316.094) (-320.941) [-317.014] (-314.657) * (-319.164) (-316.920) (-316.142) [-318.644] -- 0:06:39
       3000 -- (-317.343) (-322.931) (-315.087) [-311.618] * (-329.887) (-321.662) [-315.477] (-319.045) -- 0:05:32
       3500 -- (-316.931) (-325.668) [-318.374] (-325.351) * (-315.408) (-317.377) [-317.421] (-319.893) -- 0:04:44
       4000 -- (-314.269) (-323.140) [-316.348] (-324.267) * (-317.601) (-324.359) (-315.237) [-312.411] -- 0:04:09
       4500 -- (-322.282) (-315.424) (-330.947) [-315.047] * (-315.222) (-328.120) [-315.107] (-315.398) -- 0:03:41
       5000 -- (-322.278) [-318.026] (-311.320) (-326.446) * (-317.679) (-320.056) (-318.898) [-319.199] -- 0:03:19

      Average standard deviation of split frequencies: 0.114280

       5500 -- (-319.074) (-313.646) [-318.322] (-321.409) * (-320.046) (-324.619) (-318.622) [-324.540] -- 0:03:00
       6000 -- (-322.607) (-317.847) [-319.143] (-318.420) * [-318.433] (-315.602) (-318.028) (-325.744) -- 0:02:45
       6500 -- (-318.666) [-322.124] (-317.257) (-321.069) * (-319.838) (-319.154) [-316.717] (-317.979) -- 0:02:32
       7000 -- [-312.792] (-312.596) (-323.319) (-317.639) * (-314.783) (-313.816) (-317.445) [-315.810] -- 0:02:21
       7500 -- (-323.028) [-322.448] (-317.901) (-322.344) * [-318.216] (-315.723) (-317.007) (-315.871) -- 0:02:12
       8000 -- (-314.434) [-317.263] (-326.154) (-320.267) * (-317.022) [-312.257] (-317.233) (-329.056) -- 0:02:04
       8500 -- [-315.559] (-326.158) (-326.604) (-313.117) * (-321.857) (-310.561) (-319.469) [-310.555] -- 0:01:56
       9000 -- [-322.925] (-315.418) (-316.101) (-312.507) * [-311.762] (-316.420) (-330.012) (-312.812) -- 0:01:50
       9500 -- (-327.528) (-314.371) (-315.166) [-312.399] * (-317.867) (-313.664) [-314.344] (-316.774) -- 0:01:44
      10000 -- (-317.749) [-317.351] (-312.842) (-318.600) * (-326.224) (-314.813) (-334.716) [-319.899] -- 0:01:39

      Average standard deviation of split frequencies: 0.058150

      10500 -- (-319.495) (-320.563) (-310.501) [-315.585] * (-320.367) (-315.029) (-330.307) [-324.363] -- 0:01:34
      11000 -- (-318.789) (-317.335) (-315.542) [-313.790] * [-318.328] (-320.295) (-322.025) (-318.882) -- 0:01:29
      11500 -- (-327.515) (-318.197) [-312.254] (-313.030) * [-321.840] (-321.071) (-320.631) (-315.688) -- 0:01:25
      12000 -- (-311.809) (-312.846) [-307.802] (-319.671) * (-316.469) (-326.298) [-311.891] (-316.153) -- 0:01:22
      12500 -- (-315.563) (-319.073) [-310.497] (-321.832) * (-316.829) (-314.946) [-307.811] (-321.630) -- 0:01:19
      13000 -- [-321.686] (-315.433) (-309.203) (-316.071) * (-314.459) [-320.662] (-307.551) (-333.966) -- 0:01:15
      13500 -- (-319.188) (-319.205) [-308.100] (-315.547) * [-315.751] (-318.128) (-307.012) (-326.303) -- 0:01:13
      14000 -- (-319.846) (-316.543) (-307.494) [-316.948] * (-325.187) (-318.709) [-306.382] (-328.389) -- 0:01:10
      14500 -- (-312.152) (-322.957) (-307.763) [-314.105] * [-314.389] (-323.169) (-309.559) (-327.641) -- 0:01:07
      15000 -- (-312.206) (-316.680) (-307.568) [-316.053] * (-315.446) [-315.725] (-307.693) (-324.995) -- 0:01:05

      Average standard deviation of split frequencies: 0.052723

      15500 -- [-323.367] (-314.046) (-312.313) (-314.853) * (-324.184) [-315.041] (-310.925) (-326.137) -- 0:01:03
      16000 -- (-318.317) [-325.192] (-308.908) (-315.855) * [-312.982] (-320.207) (-312.604) (-314.498) -- 0:01:01
      16500 -- (-332.527) (-327.700) (-306.609) [-314.760] * (-314.815) [-314.744] (-309.476) (-307.812) -- 0:00:59
      17000 -- [-313.903] (-322.707) (-308.530) (-314.749) * (-317.885) (-320.305) [-308.798] (-307.662) -- 0:00:57
      17500 -- (-324.338) [-322.389] (-313.945) (-317.906) * (-323.362) [-316.724] (-309.601) (-307.214) -- 0:00:56
      18000 -- (-319.378) (-320.523) [-306.914] (-321.232) * (-319.068) (-323.117) [-310.564] (-309.543) -- 0:00:54
      18500 -- [-320.066] (-316.900) (-307.246) (-316.646) * [-316.951] (-321.211) (-311.956) (-307.861) -- 0:00:53
      19000 -- [-320.523] (-320.586) (-307.094) (-325.576) * (-326.036) (-318.575) [-312.142] (-309.471) -- 0:00:51
      19500 -- (-322.554) (-321.639) (-311.265) [-316.608] * [-316.156] (-330.274) (-311.004) (-309.288) -- 0:01:40
      20000 -- [-315.786] (-329.505) (-311.527) (-319.490) * [-321.867] (-322.776) (-307.706) (-310.143) -- 0:01:38

      Average standard deviation of split frequencies: 0.067004

      20500 -- (-330.187) [-308.828] (-307.920) (-315.985) * (-318.182) (-310.236) [-307.608] (-309.288) -- 0:01:35
      21000 -- (-314.574) (-307.675) [-308.640] (-319.929) * (-315.430) [-307.994] (-312.048) (-308.588) -- 0:01:33
      21500 -- (-324.848) (-308.685) [-307.559] (-313.107) * (-323.523) (-311.558) (-310.177) [-308.583] -- 0:01:31
      22000 -- (-316.460) [-309.124] (-309.872) (-321.334) * (-311.160) [-307.079] (-309.562) (-308.055) -- 0:01:28
      22500 -- (-314.122) (-310.040) (-311.563) [-316.938] * (-330.909) [-307.942] (-309.566) (-309.167) -- 0:01:26
      23000 -- [-314.269] (-307.988) (-308.124) (-326.556) * (-324.164) [-311.660] (-308.067) (-307.354) -- 0:01:24
      23500 -- (-322.397) [-308.735] (-308.447) (-318.055) * [-323.226] (-314.659) (-312.212) (-306.471) -- 0:01:23
      24000 -- (-314.276) (-308.768) (-308.339) [-313.995] * (-320.533) [-307.023] (-307.626) (-307.855) -- 0:01:21
      24500 -- [-322.606] (-308.889) (-311.552) (-315.644) * (-316.792) (-307.174) (-307.592) [-307.161] -- 0:01:19
      25000 -- [-316.215] (-306.332) (-310.415) (-329.291) * [-307.137] (-307.418) (-307.717) (-310.176) -- 0:01:18

      Average standard deviation of split frequencies: 0.053569

      25500 -- [-315.429] (-309.464) (-309.730) (-321.431) * (-308.621) (-312.168) [-307.429] (-313.252) -- 0:01:16
      26000 -- (-319.377) (-310.989) [-308.793] (-336.585) * (-306.721) [-308.680] (-308.326) (-309.055) -- 0:01:14
      26500 -- [-316.076] (-309.669) (-309.764) (-327.872) * (-307.173) (-308.638) [-309.631] (-308.615) -- 0:01:13
      27000 -- (-320.029) [-309.348] (-307.998) (-317.447) * (-306.911) [-309.012] (-307.983) (-307.603) -- 0:01:12
      27500 -- (-323.875) (-309.163) [-307.583] (-317.663) * (-307.778) [-309.095] (-310.410) (-308.103) -- 0:01:10
      28000 -- [-322.654] (-307.861) (-307.440) (-319.636) * [-308.388] (-307.528) (-306.717) (-309.785) -- 0:01:09
      28500 -- (-319.448) (-312.101) [-307.416] (-315.856) * (-307.569) (-310.643) [-307.923] (-307.359) -- 0:01:08
      29000 -- [-316.576] (-309.254) (-306.626) (-314.629) * (-307.155) (-311.236) (-307.269) [-308.311] -- 0:01:06
      29500 -- (-321.671) (-307.314) [-308.010] (-315.147) * (-307.782) (-307.273) [-308.972] (-309.218) -- 0:01:05
      30000 -- (-318.419) [-311.529] (-310.595) (-317.427) * (-308.247) (-307.907) [-307.598] (-309.066) -- 0:01:04

      Average standard deviation of split frequencies: 0.046848

      30500 -- (-323.742) [-311.157] (-311.800) (-317.144) * (-312.561) [-307.767] (-308.775) (-308.770) -- 0:01:03
      31000 -- (-322.159) (-308.340) (-310.328) [-311.798] * (-308.219) (-309.907) [-308.479] (-308.230) -- 0:01:02
      31500 -- (-316.976) (-307.057) (-309.354) [-314.072] * (-312.010) (-306.732) (-308.420) [-308.538] -- 0:01:01
      32000 -- [-322.924] (-312.047) (-306.582) (-315.732) * [-309.665] (-311.670) (-309.465) (-308.946) -- 0:01:00
      32500 -- [-331.221] (-309.855) (-307.941) (-322.707) * (-308.047) (-306.822) (-310.972) [-307.978] -- 0:00:59
      33000 -- (-318.638) (-309.605) (-312.540) [-315.685] * [-308.433] (-308.496) (-308.448) (-310.828) -- 0:00:58
      33500 -- (-316.681) [-308.297] (-309.998) (-320.753) * (-309.358) (-312.427) [-307.991] (-307.639) -- 0:00:57
      34000 -- (-328.295) (-309.217) [-310.097] (-328.454) * (-312.090) (-308.823) [-307.959] (-311.462) -- 0:00:56
      34500 -- [-323.128] (-309.273) (-307.553) (-323.128) * (-307.053) (-310.834) (-308.768) [-307.838] -- 0:00:55
      35000 -- (-324.818) (-309.627) [-306.707] (-322.174) * (-309.338) [-308.103] (-314.255) (-312.081) -- 0:00:55

      Average standard deviation of split frequencies: 0.047140

      35500 -- (-312.711) (-308.903) (-309.225) [-316.102] * (-307.524) (-309.240) (-309.094) [-308.860] -- 0:00:54
      36000 -- (-330.520) (-309.051) (-307.012) [-314.952] * (-309.422) [-309.382] (-315.459) (-310.693) -- 0:00:53
      36500 -- (-320.802) (-307.691) [-307.015] (-310.564) * (-307.732) [-309.914] (-309.592) (-307.203) -- 0:01:19
      37000 -- [-314.723] (-310.192) (-307.355) (-308.349) * [-316.969] (-307.885) (-307.357) (-307.041) -- 0:01:18
      37500 -- (-325.815) (-307.409) (-308.803) [-306.857] * (-308.559) (-312.570) (-308.095) [-309.638] -- 0:01:17
      38000 -- (-323.556) [-308.011] (-312.718) (-307.852) * (-309.674) (-310.083) (-308.265) [-307.734] -- 0:01:15
      38500 -- (-321.049) (-310.097) [-308.167] (-308.858) * (-307.983) (-311.720) [-306.716] (-310.131) -- 0:01:14
      39000 -- (-330.647) (-311.373) (-309.682) [-307.137] * (-310.585) [-309.448] (-306.970) (-307.906) -- 0:01:13
      39500 -- (-312.480) [-307.180] (-308.566) (-308.747) * (-308.781) [-310.642] (-306.946) (-310.438) -- 0:01:12
      40000 -- (-315.033) (-308.174) (-308.444) [-306.754] * (-309.216) (-307.126) [-309.628] (-307.100) -- 0:01:12

      Average standard deviation of split frequencies: 0.038253

      40500 -- (-318.188) [-308.941] (-311.376) (-308.402) * (-308.474) (-306.646) [-306.881] (-309.090) -- 0:01:11
      41000 -- (-318.797) (-308.791) [-309.342] (-309.755) * [-307.755] (-307.193) (-308.161) (-306.966) -- 0:01:10
      41500 -- (-320.862) (-312.010) (-308.624) [-306.581] * (-308.477) (-308.168) (-309.507) [-310.855] -- 0:01:09
      42000 -- [-322.413] (-309.484) (-308.657) (-307.137) * (-308.099) [-307.892] (-309.088) (-307.848) -- 0:01:08
      42500 -- (-319.263) (-307.922) [-307.676] (-308.792) * (-314.060) (-312.210) [-308.628] (-311.699) -- 0:01:07
      43000 -- (-315.463) (-308.461) (-307.709) [-311.566] * [-308.426] (-309.119) (-308.272) (-307.234) -- 0:01:06
      43500 -- (-320.206) [-309.224] (-309.487) (-306.387) * (-308.877) (-313.667) [-310.195] (-310.243) -- 0:01:05
      44000 -- (-325.312) (-307.678) [-310.523] (-308.079) * (-310.493) (-319.765) (-311.740) [-308.752] -- 0:01:05
      44500 -- (-321.084) [-313.588] (-309.657) (-310.751) * (-310.261) (-309.026) (-308.926) [-306.835] -- 0:01:04
      45000 -- (-308.176) [-312.417] (-306.838) (-310.192) * (-307.756) [-311.495] (-308.822) (-307.328) -- 0:01:03

      Average standard deviation of split frequencies: 0.031232

      45500 -- (-310.680) [-307.243] (-307.968) (-308.482) * [-308.350] (-311.858) (-308.691) (-308.410) -- 0:01:02
      46000 -- [-308.879] (-308.825) (-308.937) (-306.374) * [-306.982] (-307.941) (-307.130) (-311.012) -- 0:01:02
      46500 -- [-309.621] (-308.597) (-308.021) (-308.235) * (-309.891) [-309.985] (-307.154) (-308.068) -- 0:01:01
      47000 -- [-308.573] (-312.308) (-308.249) (-306.471) * (-308.389) [-308.016] (-308.614) (-308.809) -- 0:01:00
      47500 -- (-308.356) [-307.931] (-307.354) (-308.144) * (-307.751) (-307.629) [-310.799] (-311.024) -- 0:01:00
      48000 -- (-308.204) [-309.557] (-309.568) (-308.722) * (-309.992) (-306.870) [-306.916] (-309.097) -- 0:00:59
      48500 -- (-308.109) (-312.815) [-309.517] (-308.383) * (-309.135) [-307.002] (-308.787) (-310.945) -- 0:00:58
      49000 -- [-309.512] (-307.461) (-309.988) (-308.254) * (-310.884) (-312.546) [-307.078] (-307.831) -- 0:00:58
      49500 -- (-311.290) [-308.398] (-309.450) (-309.358) * (-312.994) (-307.059) [-311.633] (-307.704) -- 0:00:57
      50000 -- [-306.536] (-308.738) (-309.885) (-308.629) * (-310.744) [-311.476] (-308.558) (-310.009) -- 0:00:57

      Average standard deviation of split frequencies: 0.031634

      50500 -- (-309.891) [-308.171] (-309.772) (-310.911) * (-311.139) [-307.733] (-308.393) (-309.243) -- 0:00:56
      51000 -- (-308.520) (-309.923) (-310.285) [-308.838] * [-307.559] (-310.721) (-310.673) (-309.617) -- 0:00:55
      51500 -- [-309.788] (-310.581) (-310.813) (-308.279) * [-308.108] (-308.517) (-307.969) (-312.389) -- 0:00:55
      52000 -- (-306.383) [-307.912] (-310.481) (-308.789) * [-307.825] (-306.971) (-306.373) (-315.195) -- 0:00:54
      52500 -- (-309.271) (-307.997) [-310.657] (-307.530) * (-313.877) [-307.317] (-309.840) (-312.402) -- 0:00:54
      53000 -- (-313.019) (-307.760) (-308.671) [-308.102] * (-316.535) [-307.464] (-307.567) (-309.133) -- 0:00:53
      53500 -- (-309.248) [-307.186] (-310.843) (-308.054) * (-314.436) [-307.298] (-307.699) (-308.835) -- 0:01:10
      54000 -- (-307.130) [-307.548] (-309.210) (-307.167) * (-310.287) (-308.158) (-309.150) [-308.623] -- 0:01:10
      54500 -- (-311.459) (-308.375) [-310.897] (-312.784) * (-309.973) (-308.437) (-311.596) [-308.189] -- 0:01:09
      55000 -- (-311.746) [-308.471] (-309.430) (-307.414) * (-310.839) (-311.264) (-311.345) [-307.732] -- 0:01:08

      Average standard deviation of split frequencies: 0.031267

      55500 -- (-311.317) [-310.355] (-310.350) (-308.873) * (-308.958) (-306.641) [-313.531] (-309.780) -- 0:01:08
      56000 -- (-313.562) (-310.851) (-309.092) [-307.713] * [-307.717] (-308.615) (-308.552) (-308.854) -- 0:01:07
      56500 -- (-309.894) (-310.710) [-309.588] (-306.917) * (-307.265) [-308.109] (-308.221) (-309.521) -- 0:01:06
      57000 -- (-309.845) [-309.135] (-310.684) (-309.411) * [-308.333] (-309.101) (-312.625) (-308.574) -- 0:01:06
      57500 -- (-308.645) (-308.734) (-312.016) [-308.417] * (-310.263) (-310.340) (-310.385) [-309.909] -- 0:01:05
      58000 -- (-309.952) (-308.469) [-307.433] (-307.965) * (-306.994) [-309.319] (-307.531) (-307.785) -- 0:01:04
      58500 -- (-315.573) (-311.989) (-306.845) [-308.549] * (-308.654) (-309.157) [-309.866] (-307.572) -- 0:01:04
      59000 -- [-311.953] (-307.000) (-306.573) (-309.298) * (-308.202) [-310.064] (-306.810) (-308.023) -- 0:01:03
      59500 -- (-307.151) (-307.663) [-308.688] (-308.135) * (-307.112) [-307.652] (-306.466) (-309.664) -- 0:01:03
      60000 -- [-311.263] (-310.217) (-308.612) (-310.913) * (-309.886) [-310.399] (-307.124) (-310.053) -- 0:01:02

      Average standard deviation of split frequencies: 0.034042

      60500 -- [-311.369] (-311.081) (-308.520) (-311.497) * (-308.565) [-307.861] (-308.424) (-308.863) -- 0:01:02
      61000 -- (-307.120) (-310.112) [-309.146] (-307.974) * (-309.113) (-308.211) (-307.076) [-308.604] -- 0:01:01
      61500 -- [-308.074] (-307.698) (-308.037) (-310.355) * [-307.951] (-309.566) (-308.799) (-307.718) -- 0:01:01
      62000 -- (-309.044) [-310.719] (-308.136) (-307.104) * (-309.745) [-308.133] (-308.880) (-308.128) -- 0:01:00
      62500 -- (-314.804) [-306.872] (-308.728) (-307.650) * (-307.538) [-308.362] (-307.546) (-311.722) -- 0:01:00
      63000 -- (-309.164) (-308.852) [-307.392] (-309.258) * (-308.596) (-308.344) (-307.191) [-307.497] -- 0:00:59
      63500 -- [-308.560] (-312.586) (-308.212) (-307.821) * [-310.401] (-306.818) (-309.007) (-308.663) -- 0:00:58
      64000 -- [-309.346] (-308.066) (-307.770) (-314.584) * (-309.304) (-308.113) [-307.834] (-307.965) -- 0:00:58
      64500 -- [-310.248] (-309.914) (-307.151) (-311.175) * (-308.649) (-308.084) (-308.129) [-309.117] -- 0:00:58
      65000 -- (-307.592) (-311.872) (-307.603) [-312.165] * (-309.048) (-308.083) [-311.555] (-310.477) -- 0:00:57

      Average standard deviation of split frequencies: 0.032651

      65500 -- [-308.492] (-307.444) (-310.619) (-308.759) * (-308.596) (-307.540) (-311.150) [-310.058] -- 0:00:57
      66000 -- (-311.861) (-306.763) (-306.661) [-306.631] * (-309.781) (-309.324) (-309.559) [-313.654] -- 0:00:56
      66500 -- (-310.766) (-309.165) (-311.767) [-306.921] * (-310.233) (-307.353) [-307.528] (-309.162) -- 0:00:56
      67000 -- (-309.672) (-309.178) (-311.110) [-306.824] * (-312.208) (-307.313) [-311.064] (-311.622) -- 0:00:55
      67500 -- (-309.984) [-307.365] (-309.346) (-307.243) * (-309.169) (-309.092) [-310.189] (-308.343) -- 0:00:55
      68000 -- (-312.931) (-308.496) (-308.559) [-308.984] * [-307.102] (-310.988) (-309.924) (-309.438) -- 0:00:54
      68500 -- (-309.550) (-306.869) [-309.773] (-308.434) * (-310.013) (-307.390) [-309.273] (-311.448) -- 0:00:54
      69000 -- [-311.500] (-312.188) (-309.269) (-310.261) * [-307.506] (-310.558) (-308.118) (-308.880) -- 0:00:53
      69500 -- (-308.446) (-308.492) (-308.398) [-309.140] * [-308.900] (-307.766) (-310.293) (-311.958) -- 0:00:53
      70000 -- (-309.032) (-309.329) (-309.208) [-309.027] * (-307.990) [-307.466] (-307.859) (-307.222) -- 0:00:53

      Average standard deviation of split frequencies: 0.027954

      70500 -- (-308.814) [-307.311] (-311.708) (-309.737) * [-308.000] (-307.838) (-307.152) (-308.080) -- 0:00:52
      71000 -- [-306.975] (-309.642) (-308.267) (-307.576) * [-307.097] (-306.830) (-311.785) (-308.408) -- 0:01:05
      71500 -- [-306.575] (-310.759) (-306.667) (-309.736) * (-307.692) [-307.523] (-307.463) (-312.864) -- 0:01:04
      72000 -- (-307.244) (-310.469) [-307.489] (-309.038) * (-310.021) (-307.911) [-309.865] (-307.550) -- 0:01:04
      72500 -- (-307.491) (-307.785) [-308.052] (-310.418) * (-308.370) (-307.353) [-310.309] (-308.426) -- 0:01:03
      73000 -- (-308.406) [-307.116] (-310.446) (-307.627) * (-311.588) (-308.608) [-306.774] (-310.670) -- 0:01:03
      73500 -- (-307.720) (-308.967) [-306.957] (-312.226) * [-311.622] (-307.547) (-312.684) (-311.638) -- 0:01:03
      74000 -- (-311.773) (-308.862) (-308.747) [-307.783] * (-309.166) [-307.925] (-310.314) (-308.998) -- 0:01:02
      74500 -- [-306.907] (-308.364) (-307.888) (-309.649) * (-309.396) (-308.801) (-310.609) [-308.855] -- 0:01:02
      75000 -- (-307.448) [-311.247] (-309.509) (-310.111) * [-311.204] (-307.777) (-308.721) (-308.823) -- 0:01:01

      Average standard deviation of split frequencies: 0.029832

      75500 -- (-307.189) (-307.891) [-309.092] (-306.707) * (-309.123) (-307.683) [-309.425] (-306.472) -- 0:01:01
      76000 -- (-309.501) (-307.272) (-308.862) [-306.637] * [-308.317] (-310.644) (-308.240) (-307.762) -- 0:01:00
      76500 -- (-308.820) [-307.752] (-310.974) (-306.842) * (-308.478) (-307.425) [-308.876] (-308.153) -- 0:01:00
      77000 -- (-308.002) [-307.712] (-307.125) (-313.716) * (-309.072) (-307.762) (-309.572) [-308.358] -- 0:00:59
      77500 -- [-307.559] (-310.457) (-307.046) (-309.872) * (-310.372) (-307.772) [-308.281] (-308.498) -- 0:00:59
      78000 -- (-307.427) (-308.622) [-308.493] (-311.614) * (-307.608) (-307.955) (-308.284) [-309.877] -- 0:00:59
      78500 -- [-307.120] (-308.392) (-307.772) (-308.337) * [-308.784] (-308.337) (-308.042) (-309.699) -- 0:00:58
      79000 -- (-310.355) (-310.091) [-307.809] (-311.248) * (-311.316) (-308.027) (-311.449) [-306.684] -- 0:00:58
      79500 -- [-307.797] (-308.254) (-310.127) (-310.638) * (-315.210) [-306.856] (-307.891) (-307.093) -- 0:00:57
      80000 -- (-311.357) (-308.482) [-307.539] (-308.718) * (-312.320) (-308.269) [-307.062] (-307.492) -- 0:00:57

      Average standard deviation of split frequencies: 0.028343

      80500 -- [-313.601] (-307.572) (-307.605) (-308.208) * (-307.537) (-307.033) [-313.363] (-310.481) -- 0:00:57
      81000 -- (-309.043) (-308.119) [-308.113] (-308.745) * (-307.077) (-307.521) [-310.228] (-306.726) -- 0:00:56
      81500 -- [-309.583] (-309.401) (-308.080) (-307.283) * (-308.895) [-308.490] (-309.144) (-308.054) -- 0:00:56
      82000 -- (-310.353) [-309.476] (-308.843) (-306.929) * (-307.867) (-309.008) (-308.851) [-307.608] -- 0:00:55
      82500 -- (-309.436) (-310.570) (-307.282) [-309.259] * (-310.582) (-310.694) [-307.654] (-312.750) -- 0:00:55
      83000 -- [-308.483] (-314.190) (-308.214) (-307.813) * (-309.009) (-306.752) [-308.083] (-307.432) -- 0:00:55
      83500 -- (-313.892) (-310.416) (-307.800) [-309.951] * [-307.395] (-307.601) (-309.303) (-309.406) -- 0:00:54
      84000 -- (-308.968) [-308.630] (-308.303) (-308.340) * (-306.796) (-308.990) [-309.538] (-309.509) -- 0:00:54
      84500 -- [-313.443] (-310.959) (-312.562) (-308.414) * (-307.085) [-307.704] (-306.638) (-309.598) -- 0:00:54
      85000 -- [-308.561] (-312.398) (-308.080) (-309.853) * (-307.451) (-310.319) (-306.991) [-310.119] -- 0:00:53

      Average standard deviation of split frequencies: 0.025841

      85500 -- (-309.732) (-311.670) (-314.176) [-309.036] * [-307.479] (-308.177) (-310.662) (-312.076) -- 0:00:53
      86000 -- [-307.992] (-309.893) (-308.830) (-307.061) * (-309.917) (-310.106) [-310.335] (-307.792) -- 0:00:53
      86500 -- (-307.306) (-307.783) [-309.226] (-308.154) * [-309.270] (-309.916) (-307.967) (-310.171) -- 0:00:52
      87000 -- (-308.255) (-307.990) [-307.430] (-311.319) * (-306.485) (-311.114) (-309.998) [-312.008] -- 0:00:52
      87500 -- (-308.125) [-307.788] (-307.284) (-311.614) * (-308.499) [-307.299] (-312.422) (-309.098) -- 0:00:52
      88000 -- (-312.629) [-311.018] (-307.552) (-311.414) * (-311.407) [-310.144] (-310.916) (-307.691) -- 0:01:02
      88500 -- (-309.772) (-314.066) (-314.187) [-309.139] * (-307.205) [-306.870] (-314.975) (-311.922) -- 0:01:01
      89000 -- (-307.848) (-308.780) [-309.570] (-309.837) * [-312.746] (-309.607) (-310.027) (-307.627) -- 0:01:01
      89500 -- (-309.589) (-308.530) (-307.454) [-308.756] * (-307.311) (-310.089) (-309.661) [-309.911] -- 0:01:01
      90000 -- (-311.424) (-307.689) (-308.670) [-309.955] * (-311.106) [-307.976] (-312.248) (-307.991) -- 0:01:00

      Average standard deviation of split frequencies: 0.027816

      90500 -- (-307.295) (-308.414) [-308.109] (-313.199) * [-308.991] (-314.704) (-308.245) (-307.707) -- 0:01:00
      91000 -- (-308.189) (-306.930) (-308.342) [-307.626] * [-310.087] (-311.903) (-311.295) (-312.000) -- 0:00:59
      91500 -- (-306.785) (-308.793) (-308.429) [-313.447] * [-307.691] (-314.813) (-309.151) (-308.922) -- 0:00:59
      92000 -- (-307.772) (-308.691) [-307.240] (-312.711) * (-308.715) (-309.676) (-310.113) [-307.866] -- 0:00:59
      92500 -- (-307.451) (-309.016) [-310.065] (-309.486) * (-315.848) (-309.411) [-307.600] (-309.247) -- 0:00:58
      93000 -- (-307.298) [-308.632] (-309.266) (-307.502) * [-315.656] (-308.803) (-307.634) (-310.249) -- 0:00:58
      93500 -- (-309.633) (-307.523) [-308.581] (-308.234) * (-307.076) (-306.953) (-308.607) [-315.075] -- 0:00:58
      94000 -- (-309.153) (-308.357) (-309.689) [-308.127] * [-307.738] (-306.891) (-307.628) (-309.606) -- 0:00:57
      94500 -- (-308.460) (-311.856) [-310.881] (-308.762) * [-308.460] (-308.365) (-308.279) (-312.503) -- 0:00:57
      95000 -- [-308.235] (-309.263) (-307.192) (-307.967) * (-309.831) [-309.428] (-308.332) (-312.933) -- 0:00:57

      Average standard deviation of split frequencies: 0.029980

      95500 -- (-308.606) (-313.841) (-309.590) [-310.142] * (-309.309) (-309.181) (-313.798) [-307.027] -- 0:00:56
      96000 -- (-307.633) [-311.583] (-310.110) (-306.943) * [-309.866] (-308.360) (-308.721) (-308.989) -- 0:00:56
      96500 -- (-309.027) (-307.730) (-314.029) [-310.477] * [-306.818] (-308.365) (-307.159) (-307.362) -- 0:00:56
      97000 -- (-309.824) [-308.333] (-311.166) (-310.113) * (-308.001) (-307.375) (-308.497) [-309.246] -- 0:00:55
      97500 -- (-313.160) (-309.471) (-309.133) [-309.855] * (-306.847) (-316.333) (-308.803) [-310.415] -- 0:00:55
      98000 -- (-309.481) [-309.082] (-309.031) (-308.008) * (-308.469) (-306.800) [-310.623] (-308.545) -- 0:00:55
      98500 -- (-307.918) (-308.757) [-309.496] (-310.128) * [-307.463] (-311.564) (-307.994) (-307.550) -- 0:00:54
      99000 -- (-307.503) [-311.091] (-310.764) (-308.201) * (-309.786) (-309.154) (-309.949) [-309.013] -- 0:00:54
      99500 -- [-312.545] (-308.413) (-309.203) (-308.170) * (-309.995) (-307.933) [-308.252] (-311.113) -- 0:00:54
      100000 -- (-310.180) (-308.214) (-311.682) [-310.515] * [-308.432] (-307.647) (-309.470) (-308.076) -- 0:00:54

      Average standard deviation of split frequencies: 0.028590

      100500 -- (-307.096) [-308.101] (-311.140) (-307.944) * [-308.802] (-310.919) (-310.702) (-308.190) -- 0:00:53
      101000 -- (-310.813) [-309.640] (-307.415) (-311.897) * (-309.690) (-314.226) (-312.202) [-308.057] -- 0:00:53
      101500 -- (-308.219) (-309.864) (-307.341) [-308.940] * [-307.269] (-312.192) (-310.500) (-308.198) -- 0:00:53
      102000 -- (-308.846) (-308.768) [-306.603] (-308.031) * [-309.298] (-309.543) (-317.416) (-306.611) -- 0:00:52
      102500 -- (-307.317) (-309.264) (-310.327) [-307.811] * (-306.728) [-309.671] (-306.862) (-307.155) -- 0:00:52
      103000 -- (-311.928) [-306.456] (-319.557) (-311.750) * (-309.616) (-308.605) [-308.357] (-307.413) -- 0:00:52
      103500 -- [-306.682] (-307.904) (-309.799) (-316.939) * (-310.375) [-309.632] (-307.877) (-308.666) -- 0:00:51
      104000 -- (-310.271) [-308.186] (-310.365) (-309.057) * (-311.539) [-309.047] (-306.693) (-308.024) -- 0:00:51
      104500 -- [-308.273] (-307.315) (-309.901) (-307.945) * (-309.403) (-308.803) [-307.347] (-307.635) -- 0:00:51
      105000 -- (-308.398) (-311.532) (-307.322) [-308.519] * (-306.523) (-313.921) (-308.019) [-306.999] -- 0:00:59

      Average standard deviation of split frequencies: 0.026239

      105500 -- (-309.255) (-307.989) [-308.211] (-306.800) * (-307.924) [-307.535] (-308.486) (-308.009) -- 0:00:59
      106000 -- (-307.992) (-308.994) [-309.171] (-310.346) * (-307.930) (-314.981) [-308.603] (-313.122) -- 0:00:59
      106500 -- (-312.125) (-311.305) [-310.588] (-313.881) * (-308.776) (-311.847) (-308.898) [-309.672] -- 0:00:58
      107000 -- (-307.536) (-307.306) [-312.282] (-309.786) * [-309.344] (-307.313) (-310.811) (-306.675) -- 0:00:58
      107500 -- [-308.284] (-308.577) (-310.054) (-308.351) * (-307.018) (-309.532) (-312.983) [-308.023] -- 0:00:58
      108000 -- (-311.126) (-311.729) (-307.773) [-311.313] * (-307.322) (-309.652) [-310.984] (-310.216) -- 0:00:57
      108500 -- (-308.528) (-306.552) [-308.944] (-310.166) * [-307.258] (-309.852) (-308.169) (-308.292) -- 0:00:57
      109000 -- (-310.096) [-308.742] (-307.154) (-314.582) * (-307.334) (-308.001) (-309.074) [-309.953] -- 0:00:57
      109500 -- (-307.724) (-306.450) (-310.715) [-306.995] * (-310.003) [-306.833] (-308.932) (-309.343) -- 0:00:56
      110000 -- (-312.955) [-307.054] (-309.394) (-307.879) * [-312.430] (-308.991) (-307.353) (-307.671) -- 0:00:56

      Average standard deviation of split frequencies: 0.024493

      110500 -- [-309.390] (-310.866) (-308.666) (-308.595) * (-308.824) (-307.620) (-312.825) [-308.736] -- 0:00:56
      111000 -- (-307.696) [-311.662] (-306.786) (-309.489) * (-309.181) [-309.864] (-308.457) (-312.171) -- 0:00:56
      111500 -- (-308.523) (-307.399) (-309.148) [-308.956] * (-313.161) [-307.726] (-307.980) (-306.492) -- 0:00:55
      112000 -- (-306.647) (-313.128) [-308.580] (-309.843) * (-314.022) [-309.038] (-308.754) (-308.927) -- 0:00:55
      112500 -- (-310.256) (-307.368) [-307.742] (-311.541) * (-309.518) (-308.996) (-308.686) [-307.926] -- 0:00:55
      113000 -- (-307.918) (-311.607) [-309.563] (-306.666) * (-307.685) (-308.904) (-313.157) [-308.960] -- 0:00:54
      113500 -- [-308.203] (-307.547) (-313.492) (-309.629) * (-309.949) (-308.297) [-308.580] (-308.851) -- 0:00:54
      114000 -- [-307.335] (-307.470) (-311.927) (-307.368) * (-308.554) (-309.560) (-309.425) [-308.327] -- 0:00:54
      114500 -- (-310.177) (-310.701) [-307.332] (-307.316) * (-308.252) [-308.096] (-309.230) (-307.605) -- 0:00:54
      115000 -- (-307.491) (-310.431) (-309.885) [-308.059] * [-309.033] (-307.340) (-311.868) (-310.469) -- 0:00:53

      Average standard deviation of split frequencies: 0.028875

      115500 -- (-306.330) (-310.036) [-309.153] (-308.204) * [-309.246] (-309.587) (-310.309) (-311.655) -- 0:00:53
      116000 -- [-310.772] (-310.475) (-308.730) (-308.666) * [-310.141] (-310.895) (-307.864) (-312.186) -- 0:00:53
      116500 -- (-310.140) [-307.885] (-307.173) (-308.479) * [-308.726] (-307.880) (-308.750) (-309.246) -- 0:00:53
      117000 -- (-306.877) [-307.639] (-308.982) (-307.168) * (-307.375) (-307.661) (-310.497) [-309.038] -- 0:00:52
      117500 -- (-311.280) (-309.690) [-309.279] (-308.079) * (-310.319) [-308.035] (-312.914) (-311.916) -- 0:00:52
      118000 -- [-307.577] (-311.638) (-308.124) (-308.467) * (-307.449) (-310.596) [-309.227] (-307.658) -- 0:00:52
      118500 -- [-310.224] (-314.437) (-308.338) (-309.878) * (-307.392) (-310.802) [-310.156] (-310.158) -- 0:00:52
      119000 -- (-312.033) (-311.438) (-308.626) [-307.829] * (-309.542) (-309.067) [-307.272] (-309.211) -- 0:00:51
      119500 -- (-309.932) (-309.450) [-310.822] (-308.615) * [-308.177] (-307.696) (-307.812) (-307.570) -- 0:00:51
      120000 -- (-310.567) [-309.197] (-307.819) (-308.452) * [-307.807] (-307.381) (-308.524) (-308.057) -- 0:00:51

      Average standard deviation of split frequencies: 0.025291

      120500 -- (-314.308) (-309.673) [-307.336] (-307.780) * (-309.708) (-308.278) (-310.191) [-310.078] -- 0:00:51
      121000 -- (-309.968) (-309.071) [-308.582] (-307.128) * (-307.216) (-307.707) [-307.689] (-309.708) -- 0:00:50
      121500 -- (-307.264) (-312.323) (-308.502) [-308.586] * (-308.874) [-306.987] (-312.810) (-311.590) -- 0:00:57
      122000 -- [-312.933] (-308.552) (-310.657) (-309.472) * [-308.720] (-310.375) (-309.622) (-309.744) -- 0:00:57
      122500 -- [-308.872] (-307.371) (-309.883) (-309.174) * (-306.545) (-307.905) [-306.512] (-306.709) -- 0:00:57
      123000 -- (-307.104) (-307.288) [-307.395] (-310.696) * (-310.814) (-307.867) [-307.800] (-311.623) -- 0:00:57
      123500 -- (-307.693) (-306.846) (-307.685) [-310.389] * (-310.696) [-307.493] (-306.527) (-311.343) -- 0:00:56
      124000 -- (-307.572) (-307.095) (-309.969) [-307.653] * (-308.521) [-310.135] (-308.597) (-309.186) -- 0:00:56
      124500 -- [-308.049] (-308.750) (-308.911) (-315.124) * (-308.459) (-308.661) (-308.493) [-307.676] -- 0:00:56
      125000 -- [-306.912] (-309.233) (-310.738) (-310.735) * [-307.652] (-312.336) (-307.098) (-312.209) -- 0:00:56

      Average standard deviation of split frequencies: 0.025815

      125500 -- (-311.091) (-313.177) (-306.992) [-308.850] * (-310.260) (-309.999) (-310.368) [-312.322] -- 0:00:55
      126000 -- (-309.360) (-313.459) (-307.093) [-307.913] * (-309.002) [-307.397] (-307.481) (-312.970) -- 0:00:55
      126500 -- (-309.766) (-318.726) (-309.948) [-307.933] * (-310.273) [-307.251] (-307.347) (-308.793) -- 0:00:55
      127000 -- [-307.387] (-310.643) (-308.629) (-307.801) * (-309.421) [-307.634] (-309.489) (-307.832) -- 0:00:54
      127500 -- (-308.509) [-313.371] (-307.791) (-307.347) * (-311.014) [-307.691] (-307.348) (-308.414) -- 0:00:54
      128000 -- (-307.571) (-308.303) (-311.210) [-308.197] * (-310.142) (-310.439) [-311.096] (-308.090) -- 0:00:54
      128500 -- [-307.672] (-308.492) (-311.068) (-313.279) * [-308.811] (-308.714) (-309.340) (-307.833) -- 0:00:54
      129000 -- (-307.679) (-308.630) [-307.584] (-310.602) * (-307.420) [-306.984] (-309.820) (-309.050) -- 0:00:54
      129500 -- (-311.576) (-311.845) (-308.145) [-311.066] * [-308.810] (-309.382) (-308.496) (-307.421) -- 0:00:53
      130000 -- (-308.772) (-312.988) (-310.378) [-306.750] * (-307.086) (-309.376) (-308.220) [-307.721] -- 0:00:53

      Average standard deviation of split frequencies: 0.023545

      130500 -- [-309.566] (-309.765) (-307.111) (-306.621) * [-307.442] (-307.206) (-308.881) (-310.323) -- 0:00:53
      131000 -- (-308.398) (-308.936) (-312.099) [-309.000] * (-307.350) (-310.980) (-308.493) [-308.759] -- 0:00:53
      131500 -- [-310.556] (-310.489) (-312.685) (-311.145) * (-311.319) (-308.178) [-311.822] (-307.893) -- 0:00:52
      132000 -- (-312.945) (-308.097) [-308.725] (-307.438) * [-309.393] (-306.580) (-308.891) (-308.500) -- 0:00:52
      132500 -- (-306.456) (-308.041) [-307.835] (-308.516) * (-306.843) [-307.180] (-310.943) (-311.978) -- 0:00:52
      133000 -- [-308.246] (-307.298) (-307.881) (-307.651) * (-310.913) (-307.133) [-307.886] (-311.457) -- 0:00:52
      133500 -- [-307.562] (-307.805) (-310.182) (-308.576) * (-308.437) [-309.740] (-307.028) (-307.848) -- 0:00:51
      134000 -- (-310.642) (-309.019) (-310.092) [-308.548] * (-309.866) [-311.131] (-306.736) (-308.406) -- 0:00:51
      134500 -- (-317.530) (-310.788) [-308.655] (-310.855) * (-306.440) [-307.721] (-307.864) (-307.442) -- 0:00:51
      135000 -- (-309.833) (-310.245) [-307.022] (-313.708) * [-308.471] (-308.458) (-308.499) (-308.297) -- 0:00:51

      Average standard deviation of split frequencies: 0.022804

      135500 -- (-309.827) [-310.276] (-310.241) (-313.387) * (-307.675) [-308.262] (-308.313) (-310.823) -- 0:00:51
      136000 -- [-309.270] (-307.507) (-308.596) (-313.696) * [-310.444] (-310.161) (-306.629) (-308.065) -- 0:00:50
      136500 -- (-308.042) (-308.834) [-308.034] (-308.228) * (-310.946) (-306.968) (-308.550) [-308.321] -- 0:00:50
      137000 -- (-306.418) [-310.370] (-309.654) (-312.774) * (-306.552) [-311.125] (-310.077) (-306.861) -- 0:00:50
      137500 -- (-307.811) [-309.866] (-307.753) (-308.637) * (-307.128) (-309.326) (-309.187) [-309.028] -- 0:00:50
      138000 -- (-308.235) (-308.406) (-309.090) [-307.196] * (-309.997) (-311.081) [-308.261] (-308.936) -- 0:00:49
      138500 -- [-307.107] (-307.928) (-307.352) (-310.796) * [-308.757] (-309.176) (-308.379) (-311.281) -- 0:00:49
      139000 -- (-308.680) [-307.964] (-310.536) (-307.018) * (-308.436) (-308.979) [-311.908] (-309.304) -- 0:00:55
      139500 -- (-309.840) (-307.983) (-309.036) [-308.723] * (-309.333) [-308.773] (-307.288) (-309.190) -- 0:00:55
      140000 -- (-307.222) [-309.569] (-308.917) (-309.425) * (-308.075) (-314.739) (-310.648) [-309.364] -- 0:00:55

      Average standard deviation of split frequencies: 0.022714

      140500 -- (-306.873) (-308.177) [-307.740] (-308.803) * (-308.165) (-311.987) [-308.135] (-312.976) -- 0:00:55
      141000 -- [-307.651] (-309.554) (-307.168) (-308.123) * (-309.383) [-306.979] (-307.620) (-308.869) -- 0:00:54
      141500 -- (-309.423) (-309.052) [-309.569] (-309.132) * (-307.621) (-308.150) [-306.903] (-308.671) -- 0:00:54
      142000 -- (-308.230) (-309.390) [-308.065] (-308.611) * (-309.017) [-308.510] (-313.225) (-307.571) -- 0:00:54
      142500 -- (-309.049) [-310.826] (-311.667) (-310.343) * (-310.542) [-309.436] (-308.710) (-308.378) -- 0:00:54
      143000 -- [-307.474] (-308.631) (-310.769) (-318.183) * (-309.973) (-308.271) [-310.065] (-308.250) -- 0:00:53
      143500 -- [-308.320] (-308.280) (-308.769) (-312.006) * (-308.056) (-307.737) [-307.501] (-308.000) -- 0:00:53
      144000 -- [-310.725] (-310.681) (-309.583) (-313.144) * (-308.361) (-308.011) [-308.250] (-307.229) -- 0:00:53
      144500 -- (-311.484) (-312.763) [-306.604] (-310.299) * (-308.223) (-309.144) [-307.782] (-306.538) -- 0:00:53
      145000 -- [-307.499] (-307.581) (-308.056) (-307.281) * (-307.613) (-311.867) [-312.166] (-306.974) -- 0:00:53

      Average standard deviation of split frequencies: 0.019373

      145500 -- [-308.652] (-307.074) (-310.536) (-310.221) * [-307.185] (-311.226) (-307.372) (-307.080) -- 0:00:52
      146000 -- (-308.720) (-309.074) [-307.023] (-311.750) * (-307.956) (-314.615) (-309.442) [-310.252] -- 0:00:52
      146500 -- [-306.713] (-310.839) (-307.470) (-311.658) * (-306.980) (-308.430) (-307.863) [-308.233] -- 0:00:52
      147000 -- [-307.799] (-309.433) (-307.102) (-311.494) * (-311.892) [-307.764] (-309.806) (-308.548) -- 0:00:52
      147500 -- [-308.211] (-309.049) (-310.156) (-307.099) * (-310.040) [-308.804] (-309.859) (-308.780) -- 0:00:52
      148000 -- [-308.864] (-306.881) (-312.557) (-307.942) * [-308.555] (-306.509) (-307.380) (-308.233) -- 0:00:51
      148500 -- (-308.758) (-306.677) (-308.188) [-309.354] * (-308.696) (-310.177) (-309.033) [-309.791] -- 0:00:51
      149000 -- (-308.127) (-309.882) [-310.746] (-307.575) * [-307.902] (-310.202) (-307.781) (-308.287) -- 0:00:51
      149500 -- (-309.373) (-308.796) (-309.362) [-309.971] * [-308.351] (-307.457) (-309.258) (-309.331) -- 0:00:51
      150000 -- (-307.943) (-310.454) [-307.530] (-307.390) * (-309.016) (-307.810) [-309.141] (-309.450) -- 0:00:51

      Average standard deviation of split frequencies: 0.017785

      150500 -- (-308.384) [-308.130] (-310.054) (-308.611) * (-307.975) (-308.765) [-309.368] (-307.379) -- 0:00:50
      151000 -- (-308.167) (-306.325) (-307.670) [-307.500] * (-307.214) (-308.185) [-307.353] (-307.331) -- 0:00:50
      151500 -- (-307.905) (-307.130) (-309.319) [-307.557] * (-308.307) (-309.068) [-307.129] (-313.156) -- 0:00:50
      152000 -- (-307.726) (-306.836) [-307.953] (-311.552) * [-308.161] (-307.371) (-306.585) (-309.933) -- 0:00:50
      152500 -- [-310.989] (-308.828) (-309.088) (-314.461) * (-307.604) [-309.623] (-308.566) (-310.674) -- 0:00:50
      153000 -- [-308.393] (-310.223) (-309.658) (-312.891) * [-309.521] (-307.234) (-309.122) (-306.536) -- 0:00:49
      153500 -- (-307.802) [-308.859] (-310.137) (-311.414) * (-309.324) [-307.354] (-309.534) (-309.240) -- 0:00:49
      154000 -- (-310.706) (-308.191) [-307.730] (-310.803) * (-310.745) (-309.244) [-307.338] (-307.991) -- 0:00:49
      154500 -- (-309.613) (-309.696) (-309.198) [-307.118] * (-311.707) (-308.120) (-309.536) [-307.975] -- 0:00:49
      155000 -- (-307.688) [-306.578] (-308.490) (-307.266) * (-315.813) (-308.167) [-307.266] (-307.906) -- 0:00:49

      Average standard deviation of split frequencies: 0.016859

      155500 -- (-308.240) (-307.106) [-308.833] (-306.870) * (-308.569) [-311.540] (-307.360) (-307.480) -- 0:00:48
      156000 -- (-310.328) (-309.601) (-311.733) [-308.236] * (-308.338) (-308.502) (-308.748) [-312.980] -- 0:00:54
      156500 -- (-311.024) (-309.636) (-310.404) [-306.503] * (-311.198) (-308.093) (-309.426) [-309.829] -- 0:00:53
      157000 -- (-307.500) [-306.868] (-308.291) (-306.874) * (-308.956) (-309.114) [-308.900] (-308.799) -- 0:00:53
      157500 -- (-307.938) (-308.043) (-308.096) [-307.208] * (-306.708) (-308.585) [-309.332] (-307.489) -- 0:00:53
      158000 -- (-308.241) (-308.366) (-306.791) [-307.602] * (-307.270) (-308.054) (-314.893) [-307.681] -- 0:00:53
      158500 -- (-307.315) (-308.880) [-308.265] (-308.320) * [-309.279] (-312.393) (-308.142) (-307.864) -- 0:00:53
      159000 -- (-308.566) (-309.683) [-307.051] (-308.903) * (-308.304) (-306.676) [-308.518] (-310.485) -- 0:00:52
      159500 -- [-309.567] (-308.625) (-310.034) (-308.669) * (-310.156) [-309.109] (-309.571) (-311.354) -- 0:00:52
      160000 -- (-307.188) (-307.763) (-307.562) [-310.538] * (-306.681) (-308.285) [-308.994] (-312.843) -- 0:00:52

      Average standard deviation of split frequencies: 0.016369

      160500 -- (-308.900) [-309.966] (-310.024) (-309.102) * (-306.469) (-308.966) [-306.641] (-310.329) -- 0:00:52
      161000 -- [-309.753] (-309.741) (-309.006) (-311.938) * [-307.641] (-311.217) (-307.686) (-306.915) -- 0:00:52
      161500 -- (-308.286) (-318.287) (-308.660) [-310.178] * (-307.743) (-308.271) [-311.643] (-308.544) -- 0:00:51
      162000 -- [-307.903] (-312.396) (-309.198) (-308.959) * (-311.041) [-309.932] (-309.688) (-309.112) -- 0:00:51
      162500 -- (-308.049) (-312.593) [-308.887] (-311.203) * (-309.377) [-308.793] (-309.414) (-309.298) -- 0:00:51
      163000 -- (-309.565) [-307.975] (-307.828) (-315.291) * (-306.979) (-314.786) [-311.448] (-308.610) -- 0:00:51
      163500 -- (-309.443) (-310.223) (-309.198) [-311.801] * (-311.500) (-309.140) (-307.585) [-308.955] -- 0:00:51
      164000 -- (-310.359) (-307.536) [-311.046] (-308.248) * (-307.703) (-310.728) [-307.169] (-309.797) -- 0:00:50
      164500 -- [-310.182] (-306.825) (-312.043) (-310.139) * (-309.082) (-311.576) [-307.011] (-310.767) -- 0:00:50
      165000 -- (-313.287) [-308.722] (-310.927) (-310.311) * [-309.259] (-307.209) (-306.801) (-308.608) -- 0:00:50

      Average standard deviation of split frequencies: 0.017749

      165500 -- (-309.680) (-310.193) [-309.473] (-308.574) * [-307.938] (-306.908) (-307.196) (-308.031) -- 0:00:50
      166000 -- (-308.255) [-310.918] (-307.538) (-309.939) * (-307.938) (-307.577) (-308.424) [-308.083] -- 0:00:50
      166500 -- [-310.838] (-313.552) (-309.591) (-311.374) * (-312.764) (-308.878) (-307.298) [-306.707] -- 0:00:50
      167000 -- (-313.047) [-309.762] (-307.829) (-314.024) * (-311.281) (-316.384) (-314.311) [-307.124] -- 0:00:49
      167500 -- (-310.541) (-310.604) (-309.476) [-309.413] * (-307.006) (-310.286) (-307.122) [-307.683] -- 0:00:49
      168000 -- (-309.265) [-309.869] (-310.879) (-309.400) * (-308.092) (-308.702) (-309.787) [-306.838] -- 0:00:49
      168500 -- (-307.828) [-308.285] (-312.777) (-307.728) * (-309.474) [-308.021] (-312.044) (-309.679) -- 0:00:49
      169000 -- [-311.918] (-312.223) (-310.298) (-308.636) * (-307.931) (-313.949) [-312.863] (-308.305) -- 0:00:49
      169500 -- (-308.537) (-310.480) [-306.770] (-308.942) * (-307.644) (-309.354) [-306.869] (-310.808) -- 0:00:48
      170000 -- (-307.755) (-308.811) (-308.197) [-306.845] * (-309.211) [-308.202] (-310.750) (-306.931) -- 0:00:48

      Average standard deviation of split frequencies: 0.018753

      170500 -- [-310.351] (-307.619) (-311.302) (-308.425) * (-309.357) [-306.563] (-316.437) (-309.268) -- 0:00:48
      171000 -- (-306.409) [-308.529] (-307.902) (-309.544) * (-308.705) (-306.789) (-307.491) [-307.837] -- 0:00:48
      171500 -- (-306.434) [-307.036] (-308.602) (-306.808) * [-306.380] (-307.801) (-311.510) (-308.429) -- 0:00:48
      172000 -- (-307.637) (-309.051) (-307.479) [-308.528] * (-307.412) (-307.479) (-308.967) [-308.434] -- 0:00:48
      172500 -- [-310.648] (-309.142) (-312.330) (-315.737) * [-307.955] (-310.227) (-310.151) (-310.547) -- 0:00:47
      173000 -- [-307.045] (-308.988) (-308.264) (-316.129) * [-308.305] (-314.868) (-309.006) (-308.712) -- 0:00:52
      173500 -- [-307.996] (-310.065) (-309.012) (-314.658) * (-309.387) (-307.343) (-307.632) [-307.714] -- 0:00:52
      174000 -- (-309.273) (-308.133) [-307.751] (-320.796) * (-306.366) (-308.889) [-307.786] (-311.207) -- 0:00:52
      174500 -- (-307.164) [-307.474] (-307.268) (-310.977) * [-309.151] (-310.225) (-311.168) (-307.751) -- 0:00:52
      175000 -- [-307.040] (-309.176) (-307.645) (-309.413) * [-310.005] (-308.921) (-309.164) (-306.564) -- 0:00:51

      Average standard deviation of split frequencies: 0.017008

      175500 -- [-309.321] (-308.863) (-309.154) (-310.214) * (-312.986) (-308.806) [-310.277] (-307.567) -- 0:00:51
      176000 -- (-309.717) (-310.961) [-308.896] (-311.220) * (-316.515) (-313.173) (-307.437) [-307.721] -- 0:00:51
      176500 -- (-307.192) [-308.756] (-308.335) (-308.565) * (-317.214) [-308.867] (-307.885) (-310.800) -- 0:00:51
      177000 -- (-309.371) (-309.866) (-308.472) [-309.809] * [-312.674] (-307.617) (-307.931) (-309.172) -- 0:00:51
      177500 -- (-313.341) [-309.162] (-307.771) (-311.148) * (-309.776) (-310.090) (-309.387) [-307.375] -- 0:00:50
      178000 -- (-309.302) [-308.824] (-310.136) (-308.954) * (-310.940) (-307.754) [-309.262] (-308.511) -- 0:00:50
      178500 -- (-307.676) (-308.890) (-307.141) [-308.380] * (-308.123) (-309.558) [-307.916] (-307.870) -- 0:00:50
      179000 -- (-310.753) (-307.487) (-308.111) [-309.247] * (-311.179) (-306.498) (-309.521) [-308.337] -- 0:00:50
      179500 -- (-309.544) (-311.025) (-307.101) [-309.799] * (-309.182) [-310.131] (-307.832) (-312.408) -- 0:00:50
      180000 -- (-309.939) [-307.193] (-307.750) (-313.044) * [-306.715] (-308.861) (-310.927) (-308.976) -- 0:00:50

      Average standard deviation of split frequencies: 0.018787

      180500 -- (-310.887) (-307.761) (-308.119) [-310.413] * (-309.810) (-308.525) (-308.158) [-307.628] -- 0:00:49
      181000 -- [-307.289] (-307.077) (-307.924) (-308.520) * [-308.268] (-307.736) (-310.481) (-308.877) -- 0:00:49
      181500 -- [-312.598] (-307.086) (-306.926) (-310.063) * (-308.690) [-307.103] (-308.132) (-308.562) -- 0:00:49
      182000 -- [-307.481] (-314.031) (-308.888) (-307.598) * [-307.845] (-307.821) (-309.131) (-315.812) -- 0:00:49
      182500 -- (-307.538) (-311.505) (-307.201) [-311.439] * (-311.706) (-311.292) (-313.911) [-308.255] -- 0:00:49
      183000 -- [-307.551] (-308.234) (-308.334) (-309.620) * (-308.757) (-314.867) [-307.708] (-307.718) -- 0:00:49
      183500 -- (-311.715) (-308.796) (-309.103) [-308.538] * (-308.163) [-309.042] (-314.759) (-308.928) -- 0:00:48
      184000 -- [-310.332] (-308.616) (-308.341) (-308.116) * (-306.866) [-308.067] (-308.077) (-308.362) -- 0:00:48
      184500 -- [-307.339] (-311.963) (-309.341) (-310.193) * (-307.955) [-310.640] (-308.791) (-307.401) -- 0:00:48
      185000 -- (-307.510) [-311.368] (-310.961) (-310.042) * (-309.920) (-309.302) (-310.176) [-309.424] -- 0:00:48

      Average standard deviation of split frequencies: 0.017874

      185500 -- (-312.697) [-309.812] (-311.495) (-310.806) * (-307.104) (-311.686) (-309.950) [-307.524] -- 0:00:48
      186000 -- (-310.019) (-309.857) (-306.945) [-308.049] * (-309.930) (-308.229) (-307.902) [-307.300] -- 0:00:48
      186500 -- [-306.474] (-308.923) (-308.549) (-308.392) * (-308.220) (-307.646) [-311.795] (-314.142) -- 0:00:47
      187000 -- [-307.448] (-308.326) (-307.414) (-307.661) * (-307.655) (-308.998) (-309.749) [-308.554] -- 0:00:47
      187500 -- (-306.703) (-307.915) [-308.607] (-307.803) * [-308.826] (-309.515) (-308.814) (-309.587) -- 0:00:47
      188000 -- (-316.664) (-308.938) (-307.581) [-307.901] * (-311.690) [-307.312] (-307.130) (-310.575) -- 0:00:47
      188500 -- (-309.094) [-306.599] (-310.870) (-309.776) * [-312.385] (-310.648) (-309.288) (-310.874) -- 0:00:47
      189000 -- (-309.437) [-307.494] (-313.022) (-309.840) * (-313.711) [-307.949] (-307.726) (-308.603) -- 0:00:47
      189500 -- (-308.966) (-308.460) (-314.236) [-308.755] * (-310.181) [-308.683] (-312.084) (-311.330) -- 0:00:47
      190000 -- (-308.129) [-307.371] (-309.485) (-309.029) * (-310.303) (-312.194) [-309.863] (-309.057) -- 0:00:51

      Average standard deviation of split frequencies: 0.017060

      190500 -- [-307.558] (-306.922) (-309.651) (-306.432) * [-307.017] (-310.729) (-308.844) (-308.580) -- 0:00:50
      191000 -- (-310.861) (-308.969) [-309.301] (-312.262) * [-307.572] (-307.581) (-312.517) (-307.839) -- 0:00:50
      191500 -- (-308.263) (-306.727) [-307.590] (-310.436) * [-308.829] (-307.028) (-310.754) (-308.404) -- 0:00:50
      192000 -- (-309.543) (-307.138) (-311.613) [-309.505] * (-308.642) (-306.844) [-309.204] (-307.204) -- 0:00:50
      192500 -- (-308.849) (-308.152) (-309.942) [-307.608] * [-310.279] (-308.712) (-311.244) (-308.697) -- 0:00:50
      193000 -- (-310.077) (-307.481) (-307.405) [-308.245] * (-309.276) (-309.609) (-309.901) [-307.613] -- 0:00:50
      193500 -- (-310.766) (-310.914) [-311.316] (-309.108) * [-306.923] (-307.772) (-307.377) (-307.816) -- 0:00:50
      194000 -- (-312.119) [-308.879] (-313.009) (-308.888) * (-307.229) (-308.238) (-316.575) [-308.579] -- 0:00:49
      194500 -- (-308.461) (-307.157) [-322.079] (-308.791) * (-310.442) (-309.294) (-309.460) [-306.840] -- 0:00:49
      195000 -- (-308.056) (-310.491) [-313.652] (-307.378) * (-308.150) [-310.675] (-309.765) (-307.104) -- 0:00:49

      Average standard deviation of split frequencies: 0.015754

      195500 -- (-309.322) (-307.505) [-308.010] (-310.072) * [-306.734] (-308.231) (-309.330) (-309.762) -- 0:00:49
      196000 -- (-310.372) (-311.124) [-306.466] (-310.767) * (-306.531) (-312.807) (-308.248) [-307.286] -- 0:00:49
      196500 -- (-312.652) (-312.688) [-310.198] (-309.216) * (-307.530) [-309.505] (-307.337) (-308.676) -- 0:00:49
      197000 -- [-308.866] (-314.155) (-310.267) (-310.418) * (-307.106) [-308.154] (-309.357) (-308.198) -- 0:00:48
      197500 -- (-310.502) (-307.528) [-308.704] (-307.277) * (-309.630) (-310.129) (-307.486) [-313.405] -- 0:00:48
      198000 -- (-308.614) (-307.655) [-311.943] (-308.557) * (-307.664) (-308.145) (-309.229) [-314.166] -- 0:00:48
      198500 -- (-310.626) [-312.302] (-308.516) (-309.091) * (-307.860) [-309.998] (-309.316) (-309.900) -- 0:00:48
      199000 -- [-306.615] (-308.372) (-312.369) (-308.005) * (-310.159) (-307.685) [-307.304] (-309.418) -- 0:00:48
      199500 -- (-311.318) [-308.780] (-309.926) (-309.381) * (-309.761) (-308.764) (-312.179) [-312.677] -- 0:00:48
      200000 -- [-308.308] (-308.115) (-308.374) (-309.750) * [-309.985] (-308.217) (-310.095) (-311.402) -- 0:00:48

      Average standard deviation of split frequencies: 0.015975

      200500 -- (-310.785) (-308.811) (-313.384) [-307.636] * (-306.911) (-309.835) [-309.138] (-309.100) -- 0:00:47
      201000 -- (-307.196) (-308.301) [-307.253] (-309.198) * [-307.435] (-309.424) (-313.570) (-307.721) -- 0:00:47
      201500 -- (-312.027) (-308.668) (-309.410) [-307.425] * (-310.998) (-309.110) (-310.813) [-308.498] -- 0:00:47
      202000 -- (-310.448) [-309.970] (-309.182) (-308.580) * (-307.884) (-311.956) [-307.797] (-310.728) -- 0:00:47
      202500 -- (-309.917) (-308.322) (-307.041) [-310.579] * [-308.116] (-307.914) (-307.664) (-310.418) -- 0:00:47
      203000 -- [-308.182] (-307.265) (-308.162) (-307.134) * (-308.461) (-308.145) [-307.551] (-309.601) -- 0:00:47
      203500 -- (-308.686) [-309.179] (-307.062) (-308.392) * [-306.894] (-309.867) (-309.872) (-311.871) -- 0:00:46
      204000 -- (-306.970) (-310.237) (-307.253) [-309.109] * (-308.418) [-307.003] (-315.305) (-316.967) -- 0:00:46
      204500 -- (-307.416) (-310.442) (-307.249) [-306.548] * (-314.739) (-309.374) [-308.251] (-310.675) -- 0:00:46
      205000 -- (-309.558) (-307.361) (-308.285) [-308.859] * (-307.684) (-310.570) [-309.193] (-311.711) -- 0:00:46

      Average standard deviation of split frequencies: 0.015790

      205500 -- (-309.659) (-307.490) [-308.344] (-309.870) * (-307.305) (-307.408) (-315.674) [-310.796] -- 0:00:46
      206000 -- [-308.803] (-310.319) (-307.822) (-310.557) * (-307.091) (-308.939) (-310.109) [-310.040] -- 0:00:46
      206500 -- (-308.857) (-312.572) (-308.207) [-315.257] * [-307.193] (-310.029) (-307.590) (-307.273) -- 0:00:46
      207000 -- (-307.637) (-307.439) (-307.121) [-307.594] * [-306.848] (-308.539) (-307.413) (-309.360) -- 0:00:49
      207500 -- (-310.302) (-310.827) (-307.161) [-308.580] * (-307.649) (-309.086) (-309.382) [-307.573] -- 0:00:49
      208000 -- (-307.564) [-308.852] (-309.789) (-308.321) * [-307.327] (-308.639) (-308.484) (-308.872) -- 0:00:49
      208500 -- (-306.672) (-312.297) [-307.755] (-311.423) * (-307.580) (-311.501) (-308.167) [-307.682] -- 0:00:49
      209000 -- (-307.025) (-308.524) [-307.322] (-310.330) * (-309.377) (-310.387) [-309.664] (-310.279) -- 0:00:49
      209500 -- (-307.602) (-308.380) [-307.360] (-308.014) * (-308.223) [-307.041] (-307.493) (-309.349) -- 0:00:49
      210000 -- (-308.193) (-306.693) (-307.639) [-307.424] * (-310.568) [-307.965] (-307.998) (-306.797) -- 0:00:48

      Average standard deviation of split frequencies: 0.015440

      210500 -- (-310.566) (-309.732) [-309.212] (-307.791) * (-308.246) (-308.010) (-308.159) [-309.164] -- 0:00:48
      211000 -- (-307.922) (-313.995) [-310.574] (-307.966) * (-314.256) [-309.004] (-310.605) (-309.187) -- 0:00:48
      211500 -- [-306.659] (-307.628) (-307.589) (-307.366) * (-313.092) (-309.528) [-310.715] (-313.249) -- 0:00:48
      212000 -- (-307.395) [-309.555] (-307.362) (-312.771) * (-313.835) (-308.118) [-310.511] (-311.063) -- 0:00:48
      212500 -- (-308.812) (-308.325) [-308.318] (-306.978) * [-307.577] (-307.937) (-309.807) (-306.966) -- 0:00:48
      213000 -- (-307.817) (-307.158) (-307.836) [-306.805] * [-309.177] (-308.614) (-308.827) (-309.041) -- 0:00:48
      213500 -- (-310.147) (-310.331) [-307.026] (-308.159) * [-309.040] (-307.567) (-310.134) (-307.886) -- 0:00:47
      214000 -- (-307.162) (-311.550) [-306.581] (-306.668) * (-306.757) [-309.222] (-308.312) (-309.344) -- 0:00:47
      214500 -- [-309.701] (-309.816) (-306.847) (-311.119) * (-307.118) (-308.115) [-306.928] (-307.223) -- 0:00:47
      215000 -- (-311.838) (-308.414) (-306.777) [-309.298] * [-307.382] (-307.069) (-307.615) (-309.943) -- 0:00:47

      Average standard deviation of split frequencies: 0.015277

      215500 -- [-308.400] (-311.626) (-308.699) (-311.537) * (-309.742) (-308.872) (-307.350) [-308.037] -- 0:00:47
      216000 -- (-306.832) (-308.444) (-314.081) [-311.075] * (-309.540) (-309.594) [-311.579] (-307.681) -- 0:00:47
      216500 -- [-307.753] (-309.476) (-307.369) (-312.180) * (-312.498) (-308.932) (-310.777) [-308.332] -- 0:00:47
      217000 -- (-307.681) (-312.581) [-310.284] (-317.481) * [-307.484] (-308.765) (-308.563) (-310.068) -- 0:00:46
      217500 -- (-307.189) (-308.941) (-307.821) [-307.752] * [-307.837] (-308.263) (-308.516) (-308.479) -- 0:00:46
      218000 -- (-309.496) (-307.061) [-310.796] (-308.287) * (-307.270) (-307.122) (-308.327) [-311.556] -- 0:00:46
      218500 -- (-308.218) (-308.008) (-307.911) [-307.587] * (-308.986) (-307.424) (-313.140) [-309.425] -- 0:00:46
      219000 -- (-307.892) (-309.730) (-311.881) [-306.624] * [-310.123] (-310.508) (-310.113) (-309.787) -- 0:00:46
      219500 -- (-308.761) [-309.556] (-306.720) (-311.594) * [-310.246] (-309.778) (-308.525) (-312.393) -- 0:00:46
      220000 -- (-307.493) [-308.200] (-310.884) (-307.152) * (-310.726) (-309.081) [-307.671] (-310.084) -- 0:00:46

      Average standard deviation of split frequencies: 0.014954

      220500 -- (-313.072) [-306.637] (-314.845) (-308.153) * (-307.785) (-308.101) [-308.326] (-310.541) -- 0:00:45
      221000 -- (-311.862) (-311.261) (-311.761) [-306.514] * [-308.063] (-307.885) (-310.274) (-311.308) -- 0:00:45
      221500 -- (-308.863) (-307.418) [-306.763] (-308.018) * (-306.845) (-314.239) [-309.063] (-308.259) -- 0:00:45
      222000 -- [-309.761] (-308.450) (-307.995) (-308.408) * (-307.365) [-307.823] (-309.412) (-306.605) -- 0:00:45
      222500 -- [-309.138] (-310.842) (-307.957) (-307.973) * (-308.066) (-309.101) [-309.397] (-307.715) -- 0:00:45
      223000 -- (-312.040) [-307.142] (-307.637) (-307.606) * (-308.706) (-307.525) (-307.802) [-307.387] -- 0:00:45
      223500 -- (-308.154) [-307.177] (-309.190) (-307.582) * (-308.844) (-308.062) (-309.536) [-306.576] -- 0:00:45
      224000 -- (-308.120) (-307.126) (-306.853) [-308.662] * (-313.291) (-311.819) [-309.035] (-308.972) -- 0:00:48
      224500 -- (-310.676) [-308.231] (-310.192) (-306.897) * (-307.754) (-312.089) [-309.476] (-309.530) -- 0:00:48
      225000 -- [-307.017] (-309.716) (-307.971) (-308.001) * (-308.844) [-313.520] (-307.569) (-309.518) -- 0:00:48

      Average standard deviation of split frequencies: 0.014381

      225500 -- (-308.029) [-306.841] (-310.929) (-308.578) * [-307.316] (-317.094) (-310.086) (-308.136) -- 0:00:48
      226000 -- [-310.229] (-306.850) (-307.947) (-308.103) * (-306.814) [-308.841] (-310.647) (-308.229) -- 0:00:47
      226500 -- [-309.179] (-306.597) (-308.681) (-309.070) * (-307.443) [-308.273] (-309.996) (-308.050) -- 0:00:47
      227000 -- (-308.409) (-307.316) (-307.285) [-308.874] * [-308.136] (-313.217) (-309.697) (-312.320) -- 0:00:47
      227500 -- (-306.891) [-308.830] (-307.627) (-307.011) * [-308.481] (-310.426) (-309.083) (-312.131) -- 0:00:47
      228000 -- (-308.936) (-307.476) (-308.171) [-307.567] * [-307.605] (-307.537) (-308.673) (-309.413) -- 0:00:47
      228500 -- (-308.832) [-308.277] (-311.378) (-311.897) * [-309.005] (-307.970) (-308.154) (-309.618) -- 0:00:47
      229000 -- (-313.805) (-309.419) [-310.341] (-311.748) * (-308.935) [-306.865] (-309.654) (-311.178) -- 0:00:47
      229500 -- (-310.525) (-307.277) [-307.085] (-307.134) * [-309.672] (-307.975) (-308.366) (-309.708) -- 0:00:47
      230000 -- (-309.617) (-309.936) [-310.191] (-308.477) * (-308.765) [-308.690] (-307.930) (-310.365) -- 0:00:46

      Average standard deviation of split frequencies: 0.014306

      230500 -- [-309.288] (-313.241) (-307.948) (-313.058) * [-306.921] (-311.634) (-314.644) (-308.328) -- 0:00:46
      231000 -- (-308.207) (-306.764) (-311.191) [-311.098] * (-311.738) (-309.857) (-310.147) [-310.599] -- 0:00:46
      231500 -- (-306.812) [-309.744] (-309.910) (-308.280) * (-312.480) (-310.041) (-310.235) [-310.206] -- 0:00:46
      232000 -- (-307.498) (-310.856) (-307.920) [-306.967] * (-306.836) (-307.450) [-307.278] (-308.850) -- 0:00:46
      232500 -- (-311.952) (-308.468) (-309.991) [-309.365] * (-306.967) [-308.149] (-310.348) (-307.007) -- 0:00:46
      233000 -- (-308.100) [-307.431] (-308.720) (-308.353) * (-308.068) (-314.000) (-312.292) [-310.595] -- 0:00:46
      233500 -- (-308.539) [-307.805] (-308.314) (-308.107) * (-308.203) (-314.528) (-307.127) [-306.628] -- 0:00:45
      234000 -- [-313.816] (-310.113) (-308.760) (-308.083) * [-307.656] (-309.671) (-306.967) (-306.851) -- 0:00:45
      234500 -- [-312.455] (-310.793) (-308.142) (-309.822) * (-310.122) [-309.517] (-310.287) (-310.975) -- 0:00:45
      235000 -- (-310.124) [-307.893] (-310.170) (-309.491) * [-310.333] (-307.719) (-307.099) (-306.740) -- 0:00:45

      Average standard deviation of split frequencies: 0.014613

      235500 -- (-310.580) (-309.222) (-311.977) [-309.581] * (-307.291) (-309.195) (-309.564) [-308.326] -- 0:00:45
      236000 -- (-307.349) (-307.474) [-308.728] (-310.313) * [-308.689] (-309.023) (-311.645) (-311.881) -- 0:00:45
      236500 -- (-308.114) [-306.644] (-307.715) (-308.215) * (-307.499) (-309.956) [-308.426] (-310.815) -- 0:00:45
      237000 -- (-308.867) (-309.389) (-309.544) [-307.170] * (-307.635) [-308.151] (-307.369) (-306.961) -- 0:00:45
      237500 -- (-307.525) [-310.150] (-306.813) (-314.535) * [-308.232] (-310.782) (-307.926) (-308.308) -- 0:00:44
      238000 -- (-308.786) (-307.998) (-308.869) [-309.263] * (-307.319) [-308.923] (-306.803) (-306.946) -- 0:00:44
      238500 -- (-309.958) (-310.077) (-310.940) [-309.906] * [-312.207] (-308.361) (-306.599) (-307.946) -- 0:00:44
      239000 -- (-306.352) [-307.926] (-309.185) (-307.168) * (-309.997) (-310.173) [-309.514] (-309.196) -- 0:00:44
      239500 -- (-309.100) [-307.532] (-309.295) (-313.869) * (-309.939) [-308.330] (-306.567) (-312.416) -- 0:00:44
      240000 -- (-312.355) (-306.981) (-309.644) [-311.063] * (-310.595) (-306.397) [-307.586] (-311.304) -- 0:00:44

      Average standard deviation of split frequencies: 0.015464

      240500 -- (-309.826) [-306.813] (-309.340) (-308.795) * [-306.829] (-308.792) (-308.018) (-310.877) -- 0:00:44
      241000 -- [-311.245] (-306.497) (-307.311) (-310.545) * (-307.547) (-307.573) (-310.399) [-307.740] -- 0:00:47
      241500 -- [-306.665] (-311.918) (-310.501) (-307.682) * (-311.471) [-306.584] (-312.435) (-308.454) -- 0:00:47
      242000 -- [-307.881] (-307.988) (-314.173) (-307.258) * (-312.565) (-307.944) (-306.941) [-310.286] -- 0:00:46
      242500 -- (-307.991) [-309.581] (-314.580) (-309.288) * (-313.724) (-309.608) [-307.352] (-308.807) -- 0:00:46
      243000 -- [-306.802] (-309.390) (-306.657) (-307.450) * (-315.323) (-310.829) (-310.691) [-307.063] -- 0:00:46
      243500 -- (-308.831) (-307.766) (-307.188) [-308.328] * (-309.946) (-311.095) (-308.338) [-307.738] -- 0:00:46
      244000 -- (-310.578) (-308.025) (-307.068) [-307.423] * (-308.759) [-308.781] (-309.790) (-310.905) -- 0:00:46
      244500 -- [-311.213] (-310.788) (-311.676) (-307.612) * [-309.701] (-309.676) (-307.219) (-310.475) -- 0:00:46
      245000 -- [-308.831] (-307.981) (-314.087) (-308.811) * [-310.024] (-309.481) (-307.243) (-311.933) -- 0:00:46

      Average standard deviation of split frequencies: 0.015835

      245500 -- (-308.245) (-312.891) (-316.581) [-308.000] * [-307.150] (-307.584) (-312.594) (-310.990) -- 0:00:46
      246000 -- (-307.975) (-313.430) [-306.695] (-309.183) * [-307.378] (-309.581) (-307.002) (-308.699) -- 0:00:45
      246500 -- (-312.818) (-308.594) [-308.875] (-308.739) * [-307.126] (-314.208) (-309.752) (-312.440) -- 0:00:45
      247000 -- [-307.128] (-309.099) (-309.233) (-309.593) * (-310.021) (-311.887) (-308.705) [-306.736] -- 0:00:45
      247500 -- [-309.443] (-307.900) (-307.462) (-311.773) * [-308.483] (-309.364) (-310.735) (-308.703) -- 0:00:45
      248000 -- (-309.735) (-307.428) [-310.778] (-311.011) * [-307.572] (-308.929) (-310.091) (-309.178) -- 0:00:45
      248500 -- [-308.315] (-307.884) (-308.432) (-307.581) * (-307.188) [-309.517] (-311.629) (-308.430) -- 0:00:45
      249000 -- [-308.585] (-307.369) (-308.161) (-308.544) * (-307.862) [-307.183] (-308.752) (-307.296) -- 0:00:45
      249500 -- (-309.662) (-307.161) [-309.258] (-309.133) * [-310.530] (-306.781) (-310.049) (-308.444) -- 0:00:45
      250000 -- (-309.091) (-311.336) [-312.184] (-309.320) * [-310.133] (-308.893) (-307.558) (-309.579) -- 0:00:45

      Average standard deviation of split frequencies: 0.014649

      250500 -- (-309.771) (-310.249) (-307.751) [-309.399] * (-310.784) [-308.920] (-308.568) (-310.771) -- 0:00:44
      251000 -- (-310.716) [-309.427] (-307.718) (-309.521) * [-307.408] (-311.432) (-308.111) (-310.299) -- 0:00:44
      251500 -- (-308.106) (-313.664) [-306.785] (-308.607) * (-308.503) (-311.763) [-306.979] (-307.385) -- 0:00:44
      252000 -- (-309.240) (-312.176) [-310.301] (-314.205) * (-308.904) [-309.079] (-309.078) (-307.426) -- 0:00:44
      252500 -- [-309.374] (-308.248) (-313.768) (-309.779) * (-306.742) [-312.207] (-307.080) (-308.068) -- 0:00:44
      253000 -- [-307.776] (-307.538) (-307.692) (-307.813) * [-308.510] (-310.048) (-310.222) (-307.357) -- 0:00:44
      253500 -- (-309.343) (-308.164) (-307.033) [-307.844] * [-306.793] (-310.659) (-308.517) (-311.871) -- 0:00:44
      254000 -- [-308.440] (-308.130) (-309.013) (-308.091) * (-306.822) (-311.812) (-310.166) [-307.648] -- 0:00:44
      254500 -- (-308.586) (-311.933) [-307.729] (-310.558) * (-307.858) (-310.064) [-309.396] (-309.732) -- 0:00:43
      255000 -- (-307.373) (-310.263) [-307.165] (-307.677) * (-308.911) (-310.654) [-308.470] (-314.144) -- 0:00:43

      Average standard deviation of split frequencies: 0.013504

      255500 -- (-308.284) (-306.965) (-307.919) [-308.822] * [-308.744] (-307.878) (-308.271) (-315.062) -- 0:00:43
      256000 -- (-308.238) (-307.384) (-309.982) [-309.098] * (-306.742) (-306.829) (-308.389) [-308.803] -- 0:00:43
      256500 -- (-310.135) (-307.922) [-307.755] (-307.422) * (-307.895) (-309.848) (-308.832) [-308.283] -- 0:00:43
      257000 -- (-309.455) [-310.163] (-311.525) (-306.976) * (-311.842) (-311.700) (-311.819) [-308.438] -- 0:00:43
      257500 -- [-307.781] (-307.186) (-314.203) (-307.665) * (-309.128) (-308.653) [-307.442] (-309.706) -- 0:00:43
      258000 -- (-307.456) [-310.431] (-314.205) (-309.762) * (-308.254) (-313.176) (-306.790) [-308.024] -- 0:00:46
      258500 -- (-307.378) (-313.546) [-311.322] (-310.850) * (-309.130) (-309.907) [-306.548] (-308.544) -- 0:00:45
      259000 -- (-310.290) (-309.205) [-308.390] (-309.309) * (-309.529) [-309.453] (-308.424) (-308.797) -- 0:00:45
      259500 -- (-310.658) (-311.496) (-312.991) [-310.682] * (-310.407) (-307.232) [-308.567] (-308.066) -- 0:00:45
      260000 -- (-308.313) (-311.026) [-311.053] (-310.742) * (-309.805) (-309.879) [-307.637] (-309.289) -- 0:00:45

      Average standard deviation of split frequencies: 0.013463

      260500 -- (-308.743) [-309.427] (-314.644) (-309.797) * (-308.591) (-308.816) (-311.103) [-308.997] -- 0:00:45
      261000 -- (-310.138) (-306.566) [-310.448] (-309.332) * [-308.602] (-307.531) (-307.469) (-308.512) -- 0:00:45
      261500 -- [-309.502] (-307.947) (-308.876) (-309.746) * (-307.587) (-311.483) (-308.245) [-311.605] -- 0:00:45
      262000 -- (-307.333) [-306.974] (-308.441) (-307.410) * [-307.565] (-312.617) (-308.652) (-310.834) -- 0:00:45
      262500 -- (-313.135) (-307.454) (-312.434) [-309.621] * [-308.273] (-308.745) (-310.897) (-310.480) -- 0:00:44
      263000 -- [-311.988] (-308.856) (-310.906) (-307.795) * (-307.703) (-310.127) (-313.962) [-309.617] -- 0:00:44
      263500 -- (-306.744) [-308.045] (-306.844) (-308.262) * (-309.963) (-308.348) (-317.048) [-307.417] -- 0:00:44
      264000 -- (-309.555) (-307.085) (-307.226) [-310.106] * (-310.539) (-309.563) (-317.415) [-312.329] -- 0:00:44
      264500 -- (-311.364) (-307.155) (-307.322) [-308.663] * [-308.559] (-310.087) (-309.467) (-317.113) -- 0:00:44
      265000 -- (-306.841) [-308.260] (-309.730) (-310.496) * (-308.928) (-306.961) [-307.942] (-308.289) -- 0:00:44

      Average standard deviation of split frequencies: 0.014798

      265500 -- (-306.642) (-307.687) (-307.088) [-315.780] * (-310.240) [-309.465] (-312.977) (-311.496) -- 0:00:44
      266000 -- (-307.970) (-308.598) (-309.988) [-307.548] * (-313.119) [-307.284] (-307.904) (-307.920) -- 0:00:44
      266500 -- (-309.001) (-309.941) (-309.112) [-307.450] * (-307.506) (-308.169) (-307.514) [-308.364] -- 0:00:44
      267000 -- [-308.108] (-310.612) (-307.008) (-308.219) * (-313.074) [-308.692] (-310.725) (-306.708) -- 0:00:43
      267500 -- (-308.998) [-309.526] (-308.286) (-307.826) * (-310.244) (-307.560) [-307.542] (-307.826) -- 0:00:43
      268000 -- [-308.972] (-308.203) (-308.293) (-308.610) * (-311.609) (-309.769) [-311.710] (-315.008) -- 0:00:43
      268500 -- (-311.653) (-307.944) (-308.491) [-309.095] * [-310.348] (-307.014) (-309.008) (-317.299) -- 0:00:43
      269000 -- (-307.794) (-308.167) [-307.971] (-307.482) * (-308.652) (-312.496) [-308.326] (-309.606) -- 0:00:43
      269500 -- (-308.693) [-308.866] (-310.877) (-313.213) * (-308.642) (-312.612) [-307.829] (-309.898) -- 0:00:43
      270000 -- (-307.496) (-308.693) (-307.474) [-309.533] * [-308.163] (-308.132) (-308.885) (-307.186) -- 0:00:43

      Average standard deviation of split frequencies: 0.014025

      270500 -- (-306.839) [-308.122] (-312.626) (-313.971) * (-308.042) (-307.617) [-307.841] (-307.831) -- 0:00:43
      271000 -- (-306.554) (-309.344) [-311.673] (-313.963) * (-308.606) [-309.083] (-308.285) (-307.974) -- 0:00:43
      271500 -- (-307.758) (-308.753) [-310.318] (-307.978) * (-307.881) (-306.739) (-309.542) [-309.379] -- 0:00:42
      272000 -- (-309.701) (-309.404) (-309.985) [-307.481] * (-308.944) (-307.844) [-307.767] (-307.288) -- 0:00:42
      272500 -- (-309.150) [-308.884] (-310.959) (-308.198) * (-309.188) (-307.922) (-310.335) [-307.681] -- 0:00:42
      273000 -- [-307.831] (-309.093) (-309.425) (-308.096) * (-311.892) (-311.120) [-308.947] (-310.047) -- 0:00:42
      273500 -- [-308.961] (-307.653) (-310.279) (-309.501) * (-308.534) (-306.844) [-311.323] (-307.970) -- 0:00:42
      274000 -- (-307.935) (-310.468) (-308.569) [-309.464] * (-310.062) [-308.235] (-307.731) (-307.538) -- 0:00:42
      274500 -- (-310.327) (-308.271) (-307.862) [-309.538] * (-308.945) [-308.511] (-307.509) (-309.487) -- 0:00:42
      275000 -- (-315.115) (-307.339) [-308.210] (-307.783) * (-310.425) (-306.822) (-307.172) [-308.175] -- 0:00:44

      Average standard deviation of split frequencies: 0.012765

      275500 -- (-311.543) (-308.099) [-307.476] (-308.137) * (-308.307) (-309.831) [-308.815] (-307.012) -- 0:00:44
      276000 -- (-307.804) (-311.414) (-307.856) [-307.288] * (-308.563) (-308.298) [-306.472] (-307.776) -- 0:00:44
      276500 -- (-307.634) [-308.305] (-306.719) (-307.147) * (-311.172) (-309.614) (-306.355) [-307.871] -- 0:00:44
      277000 -- (-310.366) [-307.999] (-306.984) (-310.405) * (-311.957) (-311.232) (-307.940) [-314.849] -- 0:00:44
      277500 -- (-308.509) [-311.687] (-308.017) (-310.364) * (-307.678) [-309.420] (-306.609) (-313.423) -- 0:00:44
      278000 -- (-308.659) [-311.538] (-307.820) (-308.963) * (-310.361) [-308.997] (-308.808) (-311.565) -- 0:00:44
      278500 -- (-309.326) (-306.922) [-306.496] (-310.638) * [-311.246] (-307.324) (-310.297) (-312.162) -- 0:00:44
      279000 -- [-310.724] (-306.830) (-309.366) (-308.295) * [-308.075] (-309.265) (-310.298) (-307.571) -- 0:00:43
      279500 -- (-307.932) (-310.811) [-308.306] (-307.083) * [-308.970] (-309.605) (-309.657) (-308.302) -- 0:00:43
      280000 -- [-312.045] (-309.496) (-312.985) (-307.176) * (-307.466) (-306.808) [-306.547] (-306.908) -- 0:00:43

      Average standard deviation of split frequencies: 0.014056

      280500 -- (-310.837) (-310.170) (-307.381) [-308.580] * (-308.708) (-307.462) (-306.715) [-307.268] -- 0:00:43
      281000 -- (-311.387) [-307.682] (-309.495) (-308.966) * [-309.915] (-309.320) (-306.622) (-308.926) -- 0:00:43
      281500 -- (-308.949) (-309.840) (-312.411) [-309.531] * (-307.505) (-309.529) [-309.212] (-308.009) -- 0:00:43
      282000 -- (-307.112) (-308.342) (-311.111) [-308.607] * (-308.717) (-309.402) (-308.709) [-307.903] -- 0:00:43
      282500 -- (-306.865) (-309.885) (-310.821) [-308.052] * (-307.584) (-309.669) [-307.151] (-309.463) -- 0:00:43
      283000 -- (-308.350) (-308.254) [-308.128] (-309.050) * (-307.073) (-307.037) (-308.007) [-307.573] -- 0:00:43
      283500 -- [-307.338] (-313.871) (-307.483) (-307.323) * [-307.739] (-306.772) (-311.469) (-308.578) -- 0:00:42
      284000 -- [-309.956] (-308.632) (-307.958) (-307.911) * [-307.943] (-311.191) (-310.569) (-309.094) -- 0:00:42
      284500 -- [-312.281] (-313.652) (-309.361) (-310.719) * [-307.140] (-311.497) (-308.074) (-309.516) -- 0:00:42
      285000 -- (-308.955) [-310.099] (-308.702) (-307.214) * (-309.167) (-308.171) [-311.161] (-311.160) -- 0:00:42

      Average standard deviation of split frequencies: 0.013269

      285500 -- (-307.912) [-313.640] (-307.057) (-307.104) * (-307.742) (-308.051) [-308.785] (-310.925) -- 0:00:42
      286000 -- [-307.810] (-307.448) (-309.174) (-308.138) * (-306.990) [-308.295] (-311.672) (-307.070) -- 0:00:42
      286500 -- (-307.871) (-307.749) [-307.493] (-309.749) * (-308.573) (-306.886) [-310.209] (-310.245) -- 0:00:42
      287000 -- [-312.514] (-307.842) (-308.592) (-308.631) * (-309.969) (-309.032) [-307.092] (-311.764) -- 0:00:42
      287500 -- (-309.704) (-307.381) [-309.885] (-307.885) * (-307.801) (-307.467) (-307.161) [-307.320] -- 0:00:42
      288000 -- (-307.212) [-308.124] (-308.537) (-310.413) * [-306.822] (-311.899) (-309.636) (-307.285) -- 0:00:42
      288500 -- (-309.144) (-306.902) [-311.242] (-307.678) * (-306.783) (-311.762) [-310.380] (-310.007) -- 0:00:41
      289000 -- (-306.915) (-306.701) [-308.248] (-309.572) * [-306.526] (-308.020) (-307.224) (-311.225) -- 0:00:41
      289500 -- (-308.656) [-307.755] (-308.164) (-310.071) * (-308.009) (-309.044) [-306.879] (-311.744) -- 0:00:41
      290000 -- (-308.216) [-308.712] (-308.919) (-308.546) * (-308.277) (-307.693) [-307.510] (-313.311) -- 0:00:41

      Average standard deviation of split frequencies: 0.012377

      290500 -- [-311.469] (-312.216) (-308.928) (-306.677) * (-309.051) [-307.314] (-311.499) (-307.936) -- 0:00:41
      291000 -- (-308.846) (-309.761) (-310.288) [-307.799] * [-306.727] (-310.312) (-311.777) (-307.924) -- 0:00:41
      291500 -- (-307.200) (-308.223) (-311.681) [-309.144] * (-307.952) [-309.310] (-308.063) (-310.425) -- 0:00:43
      292000 -- (-307.433) (-307.827) (-307.534) [-308.571] * (-308.246) (-309.913) (-308.181) [-309.740] -- 0:00:43
      292500 -- (-308.235) [-309.467] (-308.078) (-309.407) * (-309.053) [-310.909] (-311.799) (-308.465) -- 0:00:43
      293000 -- (-310.596) [-307.811] (-307.171) (-309.760) * (-308.784) (-306.669) (-313.787) [-307.022] -- 0:00:43
      293500 -- [-311.865] (-310.168) (-307.141) (-307.071) * (-308.529) (-307.825) (-309.491) [-308.027] -- 0:00:43
      294000 -- [-310.336] (-308.678) (-309.101) (-307.789) * [-307.511] (-310.905) (-309.031) (-309.814) -- 0:00:43
      294500 -- (-308.494) (-308.498) (-307.964) [-309.713] * (-310.473) [-311.979] (-309.450) (-308.028) -- 0:00:43
      295000 -- (-311.115) (-307.457) [-307.944] (-309.153) * (-308.018) (-309.774) [-308.139] (-308.584) -- 0:00:43

      Average standard deviation of split frequencies: 0.011735

      295500 -- (-308.700) (-308.016) (-309.150) [-309.254] * (-308.153) (-308.024) [-307.812] (-308.386) -- 0:00:42
      296000 -- (-311.116) [-307.523] (-309.854) (-309.549) * (-312.022) (-310.128) (-309.874) [-307.916] -- 0:00:42
      296500 -- [-307.849] (-307.191) (-311.384) (-308.423) * [-308.138] (-307.502) (-309.098) (-307.141) -- 0:00:42
      297000 -- [-306.879] (-308.620) (-312.938) (-308.840) * (-308.781) (-308.358) (-308.668) [-307.179] -- 0:00:42
      297500 -- [-307.582] (-307.154) (-317.257) (-308.841) * [-307.490] (-312.368) (-308.226) (-308.463) -- 0:00:42
      298000 -- (-306.974) [-307.755] (-309.059) (-309.080) * (-306.981) (-312.023) [-310.490] (-308.947) -- 0:00:42
      298500 -- (-308.326) (-310.856) [-308.555] (-310.565) * [-309.411] (-307.347) (-309.923) (-307.020) -- 0:00:42
      299000 -- (-307.711) (-306.748) (-309.080) [-307.417] * [-312.206] (-311.520) (-308.289) (-308.861) -- 0:00:42
      299500 -- (-309.366) (-310.362) [-309.884] (-309.827) * (-307.534) (-314.602) (-311.083) [-306.898] -- 0:00:42
      300000 -- (-310.165) (-307.671) (-309.658) [-310.148] * (-311.220) (-310.053) (-307.929) [-308.089] -- 0:00:42

      Average standard deviation of split frequencies: 0.012630

      300500 -- (-307.443) (-314.709) [-309.410] (-308.148) * (-310.206) (-307.118) [-309.099] (-308.399) -- 0:00:41
      301000 -- (-308.330) (-307.270) [-308.789] (-315.351) * (-308.132) [-308.613] (-308.938) (-310.468) -- 0:00:41
      301500 -- [-309.319] (-312.602) (-311.513) (-310.085) * (-309.058) (-311.878) [-306.416] (-315.284) -- 0:00:41
      302000 -- (-308.379) [-307.014] (-314.106) (-308.093) * (-306.401) (-311.287) (-310.219) [-309.470] -- 0:00:41
      302500 -- (-310.452) [-307.736] (-310.704) (-307.864) * [-307.752] (-307.051) (-308.652) (-309.695) -- 0:00:41
      303000 -- (-309.788) (-308.347) [-308.605] (-307.113) * (-307.608) (-310.286) (-307.779) [-306.586] -- 0:00:41
      303500 -- (-310.051) (-308.194) [-310.621] (-306.386) * (-307.786) (-307.803) (-308.280) [-307.369] -- 0:00:41
      304000 -- (-311.029) (-308.232) [-310.099] (-306.348) * [-308.746] (-309.890) (-307.001) (-309.537) -- 0:00:41
      304500 -- (-310.222) (-310.827) (-309.496) [-307.904] * [-307.352] (-307.231) (-306.774) (-311.849) -- 0:00:41
      305000 -- (-310.319) (-312.502) [-307.043] (-307.646) * [-308.874] (-309.515) (-310.821) (-309.039) -- 0:00:41

      Average standard deviation of split frequencies: 0.011432

      305500 -- (-309.174) (-309.340) (-307.737) [-308.392] * (-309.813) [-307.993] (-309.326) (-309.335) -- 0:00:40
      306000 -- (-312.917) (-308.984) (-311.162) [-306.724] * (-308.882) [-308.234] (-309.182) (-309.369) -- 0:00:40
      306500 -- (-310.900) (-307.979) [-310.050] (-306.957) * (-311.624) (-308.405) (-309.342) [-306.941] -- 0:00:40
      307000 -- (-309.045) (-308.871) [-307.719] (-311.594) * [-307.957] (-307.851) (-308.686) (-308.256) -- 0:00:40
      307500 -- (-307.805) [-311.813] (-310.577) (-308.014) * (-313.135) [-308.265] (-307.456) (-308.693) -- 0:00:40
      308000 -- (-309.530) (-307.467) [-308.466] (-310.681) * [-307.504] (-310.190) (-308.832) (-306.789) -- 0:00:40
      308500 -- (-314.086) [-308.735] (-310.281) (-310.409) * (-308.810) (-316.074) (-308.108) [-309.370] -- 0:00:42
      309000 -- (-307.211) (-307.626) [-309.078] (-309.210) * (-310.116) [-307.955] (-308.491) (-306.577) -- 0:00:42
      309500 -- (-309.191) (-307.346) [-310.084] (-310.115) * (-309.968) [-307.109] (-311.794) (-307.200) -- 0:00:42
      310000 -- (-311.071) [-310.842] (-308.192) (-308.644) * [-312.766] (-309.979) (-311.814) (-307.331) -- 0:00:42

      Average standard deviation of split frequencies: 0.011500

      310500 -- [-309.598] (-307.173) (-310.353) (-314.621) * (-314.668) (-318.895) (-307.522) [-307.367] -- 0:00:42
      311000 -- (-311.015) (-311.584) [-307.330] (-308.693) * (-313.083) (-314.043) (-307.620) [-307.670] -- 0:00:42
      311500 -- (-306.779) (-309.408) (-307.613) [-307.101] * (-309.082) (-310.458) (-307.624) [-307.513] -- 0:00:41
      312000 -- (-309.356) (-307.143) [-309.581] (-308.861) * (-309.966) [-311.388] (-307.713) (-315.141) -- 0:00:41
      312500 -- (-307.963) (-313.139) (-307.313) [-309.101] * (-306.591) [-312.156] (-310.705) (-310.551) -- 0:00:41
      313000 -- [-308.801] (-313.310) (-308.703) (-308.682) * (-311.666) (-306.851) [-307.231] (-309.091) -- 0:00:41
      313500 -- [-308.619] (-310.957) (-309.607) (-306.713) * (-309.773) (-306.912) [-307.884] (-309.425) -- 0:00:41
      314000 -- (-307.351) [-307.754] (-310.612) (-312.429) * (-307.726) [-308.982] (-310.591) (-308.122) -- 0:00:41
      314500 -- (-306.867) (-307.894) (-309.315) [-309.302] * (-310.113) (-309.673) [-309.703] (-306.624) -- 0:00:41
      315000 -- [-308.920] (-307.498) (-307.184) (-309.933) * (-308.485) (-308.096) [-312.117] (-306.947) -- 0:00:41

      Average standard deviation of split frequencies: 0.010608

      315500 -- [-308.870] (-309.148) (-307.459) (-310.779) * (-306.799) (-307.152) (-309.996) [-307.167] -- 0:00:41
      316000 -- (-310.684) (-307.313) (-309.683) [-310.119] * [-307.648] (-308.662) (-309.905) (-310.491) -- 0:00:41
      316500 -- (-311.324) (-306.923) [-308.041] (-310.886) * [-310.353] (-309.357) (-307.091) (-309.881) -- 0:00:41
      317000 -- (-308.215) (-307.650) (-308.289) [-311.299] * (-309.673) (-308.952) (-311.310) [-306.718] -- 0:00:40
      317500 -- (-308.524) (-316.166) [-310.608] (-307.760) * (-307.046) [-308.436] (-308.655) (-307.900) -- 0:00:40
      318000 -- [-309.241] (-308.874) (-307.954) (-311.668) * (-308.449) (-306.670) (-308.855) [-308.211] -- 0:00:40
      318500 -- [-309.429] (-308.186) (-307.901) (-311.365) * (-310.451) [-310.283] (-307.890) (-307.030) -- 0:00:40
      319000 -- (-309.234) (-309.214) (-307.954) [-307.141] * [-312.878] (-308.074) (-312.398) (-306.462) -- 0:00:40
      319500 -- (-315.233) (-306.643) (-308.865) [-308.786] * [-309.931] (-314.782) (-307.680) (-308.621) -- 0:00:40
      320000 -- (-310.952) (-307.785) [-309.966] (-307.106) * [-308.203] (-307.268) (-309.051) (-308.716) -- 0:00:40

      Average standard deviation of split frequencies: 0.010204

      320500 -- (-308.503) [-309.360] (-308.139) (-307.963) * (-306.713) [-307.824] (-311.777) (-309.769) -- 0:00:40
      321000 -- (-312.446) (-307.832) [-311.104] (-310.647) * (-309.789) [-307.572] (-311.681) (-310.812) -- 0:00:40
      321500 -- (-306.747) [-308.708] (-309.901) (-308.282) * (-307.200) (-308.865) [-307.935] (-308.863) -- 0:00:40
      322000 -- (-311.596) [-310.563] (-310.387) (-307.292) * (-308.121) [-309.207] (-306.961) (-307.990) -- 0:00:40
      322500 -- (-311.733) [-308.563] (-309.191) (-309.382) * (-311.592) (-308.158) (-308.455) [-306.652] -- 0:00:39
      323000 -- (-309.543) (-310.445) (-316.534) [-308.782] * (-313.113) (-310.219) (-308.480) [-306.841] -- 0:00:39
      323500 -- [-311.191] (-311.297) (-307.355) (-311.557) * (-314.060) (-307.570) (-310.180) [-309.288] -- 0:00:39
      324000 -- (-310.183) (-308.904) (-310.060) [-308.823] * (-308.072) (-307.072) (-309.027) [-309.141] -- 0:00:39
      324500 -- [-308.228] (-310.907) (-309.109) (-309.400) * (-306.797) [-312.118] (-309.561) (-308.432) -- 0:00:39
      325000 -- [-307.704] (-311.403) (-309.904) (-308.135) * [-310.097] (-309.790) (-310.060) (-306.699) -- 0:00:39

      Average standard deviation of split frequencies: 0.009560

      325500 -- (-314.934) (-313.111) [-308.407] (-306.804) * (-312.476) (-309.578) (-307.023) [-308.476] -- 0:00:41
      326000 -- [-311.403] (-311.517) (-307.449) (-307.504) * [-311.366] (-308.228) (-310.107) (-311.703) -- 0:00:41
      326500 -- (-310.959) (-308.238) [-310.417] (-308.075) * (-309.255) [-307.755] (-307.428) (-310.994) -- 0:00:41
      327000 -- (-308.618) (-310.272) (-308.563) [-308.569] * (-307.395) (-308.839) [-308.932] (-306.908) -- 0:00:41
      327500 -- (-307.937) (-309.244) (-309.299) [-307.835] * [-306.827] (-309.282) (-310.950) (-308.020) -- 0:00:41
      328000 -- (-306.515) (-307.403) (-308.448) [-309.917] * (-308.138) (-307.261) [-307.925] (-307.919) -- 0:00:40
      328500 -- [-309.630] (-308.599) (-313.077) (-306.830) * (-313.063) (-309.295) [-309.765] (-309.240) -- 0:00:40
      329000 -- (-309.619) (-307.498) [-310.511] (-307.182) * (-308.444) [-306.828] (-310.006) (-308.048) -- 0:00:40
      329500 -- (-308.021) (-308.068) (-307.467) [-308.000] * (-307.626) (-309.100) [-312.357] (-309.724) -- 0:00:40
      330000 -- (-309.724) (-310.717) (-310.770) [-308.479] * (-311.330) (-307.733) (-309.753) [-308.313] -- 0:00:40

      Average standard deviation of split frequencies: 0.010566

      330500 -- (-310.631) (-307.133) (-309.211) [-308.731] * (-313.857) (-309.526) (-309.906) [-307.987] -- 0:00:40
      331000 -- (-309.099) (-307.798) [-307.446] (-312.488) * (-310.914) (-310.543) (-308.724) [-310.485] -- 0:00:40
      331500 -- (-308.298) [-307.173] (-309.508) (-307.952) * (-310.876) (-308.195) [-307.814] (-309.278) -- 0:00:40
      332000 -- [-308.605] (-308.017) (-313.188) (-307.980) * (-312.108) (-308.761) [-309.619] (-306.790) -- 0:00:40
      332500 -- (-307.722) [-307.826] (-307.408) (-313.997) * [-309.012] (-307.511) (-308.107) (-307.186) -- 0:00:40
      333000 -- [-306.807] (-312.789) (-308.466) (-314.793) * (-308.364) (-307.319) (-310.076) [-309.072] -- 0:00:40
      333500 -- [-308.376] (-307.316) (-308.928) (-315.286) * [-312.180] (-307.431) (-308.131) (-309.556) -- 0:00:39
      334000 -- (-310.500) (-307.006) [-309.326] (-311.060) * (-313.010) [-306.461] (-309.083) (-310.008) -- 0:00:39
      334500 -- (-315.477) (-307.575) (-308.954) [-308.578] * (-308.137) [-307.433] (-307.479) (-308.954) -- 0:00:39
      335000 -- (-308.317) [-307.945] (-308.115) (-311.750) * (-308.127) (-307.257) (-306.927) [-307.924] -- 0:00:39

      Average standard deviation of split frequencies: 0.009656

      335500 -- (-311.039) (-306.473) (-309.522) [-308.441] * (-309.797) (-308.872) (-306.848) [-308.999] -- 0:00:39
      336000 -- [-309.781] (-307.617) (-314.137) (-309.670) * [-310.796] (-309.334) (-306.695) (-308.408) -- 0:00:39
      336500 -- [-311.070] (-309.234) (-311.689) (-313.375) * (-311.568) (-307.161) (-308.426) [-306.791] -- 0:00:39
      337000 -- (-309.958) (-308.265) [-307.494] (-310.285) * (-309.701) (-308.840) [-306.512] (-308.615) -- 0:00:39
      337500 -- (-308.013) (-312.199) [-308.815] (-309.550) * [-308.514] (-309.987) (-312.165) (-309.914) -- 0:00:39
      338000 -- (-307.432) (-310.852) (-307.890) [-310.270] * (-307.598) [-315.013] (-310.373) (-309.350) -- 0:00:39
      338500 -- (-309.335) [-307.556] (-307.335) (-312.925) * (-308.559) (-310.577) (-306.900) [-308.348] -- 0:00:39
      339000 -- [-310.474] (-307.484) (-312.994) (-315.463) * (-308.487) (-308.893) [-308.187] (-307.928) -- 0:00:38
      339500 -- [-307.288] (-308.996) (-308.248) (-314.822) * (-311.846) (-307.609) [-308.430] (-307.786) -- 0:00:38
      340000 -- (-309.118) (-307.699) (-307.858) [-309.741] * (-310.615) (-308.319) [-309.413] (-306.710) -- 0:00:38

      Average standard deviation of split frequencies: 0.009456

      340500 -- [-313.884] (-307.087) (-308.473) (-308.774) * (-309.812) [-306.609] (-306.583) (-309.873) -- 0:00:38
      341000 -- (-310.854) [-307.756] (-308.706) (-309.922) * (-309.877) (-310.096) [-307.181] (-310.222) -- 0:00:38
      341500 -- (-308.113) (-310.732) [-310.361] (-307.997) * (-309.514) (-312.831) [-307.015] (-308.144) -- 0:00:38
      342000 -- [-307.398] (-308.779) (-308.625) (-307.112) * (-308.073) (-312.381) [-307.399] (-310.597) -- 0:00:38
      342500 -- (-307.673) (-307.842) [-307.262] (-307.144) * (-307.129) (-313.527) (-307.405) [-312.241] -- 0:00:40
      343000 -- [-311.896] (-312.021) (-307.389) (-308.837) * [-311.512] (-309.716) (-307.292) (-310.071) -- 0:00:40
      343500 -- (-308.571) (-306.704) (-308.314) [-308.682] * (-309.764) (-312.792) [-307.190] (-307.890) -- 0:00:40
      344000 -- (-308.772) (-306.642) (-308.440) [-312.794] * (-307.806) [-308.797] (-309.627) (-307.611) -- 0:00:40
      344500 -- (-312.632) [-307.366] (-307.494) (-306.886) * (-308.353) (-311.785) [-315.686] (-306.793) -- 0:00:39
      345000 -- (-310.247) (-307.838) [-306.978] (-308.058) * (-308.362) (-311.271) (-321.659) [-307.561] -- 0:00:39

      Average standard deviation of split frequencies: 0.008856

      345500 -- [-307.953] (-313.599) (-311.335) (-308.014) * [-308.241] (-309.761) (-308.839) (-308.011) -- 0:00:39
      346000 -- [-310.808] (-308.336) (-311.913) (-308.235) * [-308.986] (-308.295) (-310.144) (-310.152) -- 0:00:39
      346500 -- (-310.763) (-311.119) [-309.075] (-312.639) * (-307.273) [-307.070] (-306.934) (-307.872) -- 0:00:39
      347000 -- (-312.807) (-307.745) [-307.813] (-308.287) * [-307.562] (-306.627) (-309.060) (-310.270) -- 0:00:39
      347500 -- (-310.277) [-307.785] (-308.653) (-310.829) * (-308.354) (-311.839) [-306.708] (-307.476) -- 0:00:39
      348000 -- [-310.462] (-310.480) (-308.272) (-309.293) * (-307.398) (-308.050) (-307.062) [-307.500] -- 0:00:39
      348500 -- (-307.330) [-308.422] (-311.135) (-307.349) * (-306.548) (-313.999) (-310.322) [-308.105] -- 0:00:39
      349000 -- [-307.944] (-306.852) (-310.048) (-307.345) * (-308.739) [-308.493] (-309.560) (-308.302) -- 0:00:39
      349500 -- (-308.836) (-307.910) [-310.412] (-307.483) * (-309.502) [-307.154] (-308.088) (-310.705) -- 0:00:39
      350000 -- [-309.409] (-307.626) (-310.287) (-308.638) * (-315.716) [-307.423] (-308.376) (-308.164) -- 0:00:39

      Average standard deviation of split frequencies: 0.008290

      350500 -- [-308.028] (-308.502) (-310.184) (-311.040) * [-312.955] (-308.510) (-306.860) (-307.982) -- 0:00:38
      351000 -- [-307.316] (-307.313) (-310.517) (-308.667) * [-308.565] (-309.112) (-307.921) (-308.250) -- 0:00:38
      351500 -- [-309.154] (-311.319) (-308.839) (-307.843) * (-310.602) (-307.364) (-311.261) [-308.415] -- 0:00:38
      352000 -- (-310.391) (-307.604) (-309.542) [-308.234] * [-310.828] (-308.803) (-308.137) (-308.886) -- 0:00:38
      352500 -- (-311.875) (-308.174) (-308.644) [-306.610] * (-308.827) [-307.319] (-308.647) (-307.424) -- 0:00:38
      353000 -- (-311.022) (-307.902) (-309.360) [-307.325] * (-307.920) [-308.833] (-306.592) (-314.435) -- 0:00:38
      353500 -- (-312.894) (-310.087) (-307.677) [-307.259] * (-308.394) (-309.022) [-308.749] (-309.553) -- 0:00:38
      354000 -- (-312.776) (-309.244) (-306.714) [-307.636] * (-307.165) [-308.372] (-308.532) (-309.851) -- 0:00:38
      354500 -- (-310.014) (-308.148) [-308.192] (-308.234) * (-311.173) (-309.399) [-309.031] (-311.347) -- 0:00:38
      355000 -- (-311.232) [-308.281] (-306.894) (-307.167) * (-311.651) [-307.885] (-311.970) (-307.580) -- 0:00:38

      Average standard deviation of split frequencies: 0.008334

      355500 -- (-310.213) [-307.972] (-307.165) (-307.953) * (-314.007) (-312.046) (-311.137) [-307.635] -- 0:00:38
      356000 -- (-307.956) (-311.408) (-307.148) [-309.060] * [-307.339] (-306.739) (-308.614) (-308.455) -- 0:00:39
      356500 -- (-309.730) (-310.531) (-307.466) [-307.576] * (-310.677) (-307.356) [-307.848] (-308.452) -- 0:00:39
      357000 -- (-307.465) (-308.880) (-311.146) [-309.550] * (-310.224) (-308.414) [-307.420] (-308.734) -- 0:00:39
      357500 -- [-309.892] (-306.896) (-311.309) (-309.514) * (-307.766) (-310.578) [-310.143] (-307.570) -- 0:00:39
      358000 -- (-308.110) (-307.066) [-309.279] (-306.597) * (-307.207) (-307.141) (-308.548) [-307.010] -- 0:00:39
      358500 -- (-307.802) (-309.345) (-310.059) [-308.363] * [-306.930] (-308.444) (-308.295) (-308.166) -- 0:00:39
      359000 -- (-308.418) [-307.185] (-307.660) (-308.126) * (-306.971) (-314.349) [-307.844] (-312.400) -- 0:00:39
      359500 -- (-307.468) [-307.451] (-308.500) (-307.680) * (-308.912) (-308.910) (-308.165) [-308.517] -- 0:00:39
      360000 -- [-308.233] (-307.618) (-306.909) (-308.386) * (-313.171) (-309.919) [-311.484] (-308.581) -- 0:00:39

      Average standard deviation of split frequencies: 0.008457

      360500 -- (-307.268) (-310.401) (-309.361) [-308.429] * [-308.101] (-309.834) (-308.278) (-308.485) -- 0:00:39
      361000 -- (-308.141) (-308.032) (-311.476) [-306.796] * (-312.068) [-307.404] (-311.119) (-307.640) -- 0:00:38
      361500 -- (-308.524) (-310.262) [-306.966] (-308.390) * [-309.583] (-307.346) (-310.298) (-307.262) -- 0:00:38
      362000 -- (-313.331) [-309.621] (-308.016) (-311.091) * (-308.071) [-309.740] (-309.370) (-308.968) -- 0:00:38
      362500 -- [-311.056] (-314.115) (-309.727) (-311.006) * (-309.884) (-310.009) (-313.455) [-310.938] -- 0:00:38
      363000 -- [-307.614] (-307.787) (-310.885) (-315.189) * (-310.879) (-308.003) (-307.261) [-308.794] -- 0:00:38
      363500 -- (-309.859) (-315.212) (-310.477) [-311.680] * (-307.388) [-306.921] (-306.632) (-314.406) -- 0:00:38
      364000 -- [-312.370] (-311.395) (-311.103) (-310.292) * [-306.924] (-308.906) (-310.567) (-307.430) -- 0:00:38
      364500 -- (-314.208) [-311.163] (-311.071) (-306.456) * (-310.376) [-306.849] (-307.945) (-307.065) -- 0:00:38
      365000 -- (-311.350) [-308.334] (-308.988) (-308.563) * [-309.883] (-308.026) (-309.157) (-311.110) -- 0:00:38

      Average standard deviation of split frequencies: 0.009319

      365500 -- [-306.835] (-306.879) (-308.643) (-312.643) * [-308.177] (-308.115) (-310.684) (-309.862) -- 0:00:38
      366000 -- [-309.065] (-309.192) (-308.000) (-312.725) * (-309.670) [-309.503] (-309.129) (-308.688) -- 0:00:38
      366500 -- (-309.308) [-308.432] (-309.324) (-307.992) * (-307.566) (-307.568) (-315.868) [-308.309] -- 0:00:38
      367000 -- (-308.103) (-309.164) (-308.369) [-307.557] * (-311.125) (-309.318) [-308.907] (-313.541) -- 0:00:37
      367500 -- [-307.438] (-308.681) (-307.431) (-307.039) * (-307.323) [-312.223] (-309.703) (-308.636) -- 0:00:37
      368000 -- (-311.946) (-308.905) [-308.333] (-308.363) * (-309.736) [-308.015] (-309.495) (-308.171) -- 0:00:37
      368500 -- (-311.940) [-307.093] (-312.116) (-308.077) * (-307.448) [-308.022] (-307.549) (-308.132) -- 0:00:37
      369000 -- [-307.815] (-307.003) (-312.966) (-307.470) * (-307.142) (-309.718) [-307.908] (-307.008) -- 0:00:37
      369500 -- (-308.731) (-306.869) (-313.653) [-307.017] * (-308.212) (-307.168) [-309.466] (-313.145) -- 0:00:37
      370000 -- (-308.544) (-312.347) (-308.158) [-307.684] * (-310.715) (-308.000) (-311.139) [-313.633] -- 0:00:37

      Average standard deviation of split frequencies: 0.009276

      370500 -- (-309.502) (-308.616) [-309.226] (-310.650) * (-307.394) (-307.736) [-309.425] (-307.166) -- 0:00:37
      371000 -- (-308.330) (-309.006) (-310.542) [-310.428] * [-307.921] (-308.334) (-309.913) (-307.732) -- 0:00:37
      371500 -- (-309.117) [-308.030] (-308.994) (-309.932) * [-307.333] (-307.243) (-309.438) (-309.176) -- 0:00:37
      372000 -- (-310.098) (-311.348) [-312.810] (-309.228) * [-306.331] (-311.279) (-313.054) (-307.168) -- 0:00:37
      372500 -- (-307.541) (-307.216) (-312.806) [-307.670] * (-308.509) (-313.384) (-312.134) [-307.378] -- 0:00:37
      373000 -- [-308.038] (-308.781) (-307.958) (-307.688) * [-307.753] (-312.159) (-309.214) (-308.863) -- 0:00:38
      373500 -- (-309.991) (-307.574) (-307.481) [-310.198] * (-308.805) (-309.980) [-308.934] (-308.478) -- 0:00:38
      374000 -- (-309.869) (-308.473) [-306.896] (-311.423) * [-308.447] (-307.496) (-307.598) (-308.758) -- 0:00:38
      374500 -- (-307.730) (-311.635) [-311.066] (-308.507) * (-307.049) (-309.143) [-308.919] (-307.961) -- 0:00:38
      375000 -- (-309.683) [-310.460] (-306.948) (-309.065) * (-309.927) [-310.934] (-308.465) (-308.429) -- 0:00:38

      Average standard deviation of split frequencies: 0.009956

      375500 -- (-308.177) [-307.834] (-310.143) (-310.673) * (-308.595) (-307.444) (-309.025) [-308.772] -- 0:00:38
      376000 -- (-310.014) (-306.968) [-307.397] (-306.963) * [-308.276] (-309.883) (-309.260) (-307.619) -- 0:00:38
      376500 -- (-308.119) [-306.777] (-308.810) (-307.930) * (-309.695) [-308.934] (-309.167) (-308.242) -- 0:00:38
      377000 -- (-308.156) [-310.050] (-308.968) (-309.816) * (-308.025) (-309.185) [-312.256] (-308.786) -- 0:00:38
      377500 -- (-309.704) (-308.544) [-307.600] (-309.480) * [-309.788] (-306.974) (-310.712) (-309.047) -- 0:00:37
      378000 -- (-311.209) (-308.833) [-306.818] (-307.304) * (-307.415) (-309.575) [-309.245] (-310.718) -- 0:00:37
      378500 -- [-310.961] (-311.603) (-309.224) (-308.053) * (-306.680) (-307.562) (-309.017) [-311.603] -- 0:00:37
      379000 -- (-309.582) (-308.928) (-311.029) [-309.082] * (-309.833) (-306.792) (-307.429) [-306.734] -- 0:00:37
      379500 -- (-319.062) (-312.074) (-308.449) [-310.865] * (-309.068) [-310.585] (-307.996) (-311.879) -- 0:00:37
      380000 -- (-308.667) (-308.485) (-307.718) [-308.724] * (-310.832) (-306.739) (-307.923) [-308.539] -- 0:00:37

      Average standard deviation of split frequencies: 0.010271

      380500 -- (-311.545) (-308.967) (-307.215) [-308.089] * (-309.846) (-310.474) (-308.056) [-308.361] -- 0:00:37
      381000 -- (-311.183) (-307.579) (-307.946) [-307.940] * (-312.595) (-308.564) (-307.195) [-307.339] -- 0:00:37
      381500 -- [-307.958] (-310.282) (-312.143) (-310.175) * (-307.279) (-308.036) (-307.139) [-308.011] -- 0:00:37
      382000 -- [-307.596] (-313.412) (-311.067) (-308.354) * (-309.715) (-308.654) (-319.274) [-309.169] -- 0:00:37
      382500 -- (-308.195) (-308.063) [-306.991] (-308.209) * [-307.794] (-311.721) (-308.848) (-307.775) -- 0:00:37
      383000 -- (-307.968) [-307.761] (-309.078) (-310.046) * (-311.223) (-309.694) [-308.413] (-312.375) -- 0:00:37
      383500 -- (-310.155) (-309.630) [-308.927] (-309.916) * (-310.453) [-310.599] (-308.177) (-307.623) -- 0:00:36
      384000 -- (-312.656) [-309.685] (-308.087) (-307.989) * [-309.829] (-308.040) (-311.535) (-307.807) -- 0:00:36
      384500 -- (-309.409) [-308.131] (-309.121) (-307.490) * (-307.463) [-307.391] (-308.324) (-308.917) -- 0:00:36
      385000 -- (-309.831) (-309.968) [-308.595] (-307.924) * (-308.428) [-307.654] (-306.691) (-308.268) -- 0:00:36

      Average standard deviation of split frequencies: 0.009842

      385500 -- (-308.094) (-308.623) (-308.768) [-309.003] * (-308.900) [-308.504] (-309.202) (-307.840) -- 0:00:36
      386000 -- (-308.679) (-310.331) [-309.075] (-313.221) * (-309.173) [-309.429] (-310.731) (-310.233) -- 0:00:36
      386500 -- (-311.400) [-306.689] (-311.066) (-307.756) * (-307.937) (-314.890) [-307.778] (-309.270) -- 0:00:36
      387000 -- (-309.443) (-307.601) [-307.499] (-307.395) * (-307.383) (-311.724) (-308.387) [-307.505] -- 0:00:36
      387500 -- (-307.251) [-307.698] (-307.730) (-308.604) * (-308.925) (-319.127) (-309.758) [-315.399] -- 0:00:36
      388000 -- [-313.034] (-306.660) (-309.374) (-308.310) * (-306.595) [-311.080] (-310.234) (-308.725) -- 0:00:36
      388500 -- (-310.097) (-310.853) [-307.389] (-308.070) * [-307.909] (-310.786) (-307.926) (-311.686) -- 0:00:36
      389000 -- (-310.509) [-309.651] (-310.312) (-307.446) * (-310.607) [-314.516] (-306.844) (-311.993) -- 0:00:36
      389500 -- [-308.984] (-309.506) (-307.710) (-307.882) * (-312.193) (-307.758) (-306.663) [-308.443] -- 0:00:36
      390000 -- (-309.505) (-309.400) (-308.492) [-308.707] * (-309.290) [-309.211] (-308.098) (-307.699) -- 0:00:37

      Average standard deviation of split frequencies: 0.009085

      390500 -- [-311.475] (-312.738) (-310.374) (-311.701) * (-307.649) (-309.775) (-309.162) [-308.304] -- 0:00:37
      391000 -- (-313.744) (-310.396) [-308.169] (-309.906) * [-315.673] (-310.374) (-311.197) (-308.403) -- 0:00:37
      391500 -- (-312.511) (-309.583) (-308.701) [-309.358] * (-312.182) [-307.180] (-311.380) (-310.216) -- 0:00:37
      392000 -- [-310.259] (-311.366) (-308.016) (-308.137) * (-311.365) [-309.181] (-308.746) (-311.563) -- 0:00:37
      392500 -- (-308.253) (-307.912) [-307.068] (-308.468) * [-307.818] (-308.812) (-308.534) (-312.398) -- 0:00:37
      393000 -- (-307.546) [-306.673] (-307.779) (-310.262) * [-308.883] (-308.979) (-308.158) (-311.513) -- 0:00:37
      393500 -- [-308.127] (-308.548) (-308.577) (-307.962) * (-310.257) (-310.994) (-308.840) [-306.980] -- 0:00:36
      394000 -- (-307.851) (-309.227) (-309.707) [-307.974] * (-307.954) [-311.118] (-307.942) (-307.101) -- 0:00:36
      394500 -- [-307.965] (-308.810) (-309.103) (-309.173) * (-310.183) [-309.244] (-308.403) (-306.688) -- 0:00:36
      395000 -- (-313.589) [-311.511] (-310.902) (-310.293) * (-309.550) [-308.500] (-307.729) (-307.828) -- 0:00:36

      Average standard deviation of split frequencies: 0.009663

      395500 -- (-313.013) [-309.179] (-310.442) (-310.316) * (-308.319) (-307.499) (-310.400) [-309.007] -- 0:00:36
      396000 -- (-310.711) [-317.197] (-310.619) (-308.166) * (-308.329) [-308.008] (-307.766) (-319.437) -- 0:00:36
      396500 -- (-310.361) (-310.963) [-308.501] (-309.219) * (-309.255) (-311.695) (-307.180) [-308.321] -- 0:00:36
      397000 -- [-308.833] (-309.167) (-310.739) (-309.006) * (-309.205) [-309.663] (-306.572) (-311.918) -- 0:00:36
      397500 -- (-312.249) [-306.944] (-307.073) (-308.618) * (-309.047) (-309.876) [-309.392] (-309.242) -- 0:00:36
      398000 -- (-308.702) (-307.220) (-306.816) [-308.319] * (-307.929) [-307.293] (-308.033) (-308.713) -- 0:00:36
      398500 -- [-308.325] (-309.104) (-306.515) (-310.194) * (-308.917) (-308.156) [-309.273] (-307.984) -- 0:00:36
      399000 -- [-307.285] (-309.085) (-309.313) (-308.074) * (-307.668) [-307.438] (-307.948) (-307.985) -- 0:00:36
      399500 -- (-308.794) (-308.800) [-307.320] (-310.632) * (-307.807) [-307.362] (-312.943) (-307.709) -- 0:00:36
      400000 -- (-314.846) [-312.712] (-312.573) (-308.242) * (-310.762) (-307.298) [-312.224] (-307.345) -- 0:00:36

      Average standard deviation of split frequencies: 0.009689

      400500 -- (-309.420) (-310.517) (-309.980) [-308.368] * (-306.929) [-307.281] (-312.412) (-310.321) -- 0:00:35
      401000 -- (-306.941) (-308.486) (-308.329) [-309.617] * (-306.658) (-310.959) (-312.977) [-306.893] -- 0:00:35
      401500 -- [-308.697] (-309.605) (-309.242) (-308.270) * (-306.879) [-311.095] (-310.720) (-309.030) -- 0:00:35
      402000 -- (-307.106) (-308.929) (-307.585) [-309.072] * (-308.134) (-309.082) [-310.819] (-308.691) -- 0:00:35
      402500 -- (-309.772) [-309.471] (-307.475) (-308.288) * (-308.005) (-307.637) (-309.232) [-308.098] -- 0:00:35
      403000 -- (-310.573) [-307.774] (-307.215) (-317.693) * [-306.393] (-312.397) (-307.276) (-307.466) -- 0:00:35
      403500 -- [-308.020] (-306.849) (-308.758) (-316.765) * (-308.277) (-311.446) (-308.149) [-307.851] -- 0:00:35
      404000 -- (-308.390) (-306.982) [-308.371] (-312.840) * (-313.401) (-307.847) (-311.065) [-308.098] -- 0:00:35
      404500 -- [-308.732] (-310.644) (-306.956) (-307.076) * (-309.454) (-311.516) (-307.798) [-307.420] -- 0:00:35
      405000 -- (-310.922) [-313.945] (-309.164) (-306.426) * (-309.064) (-310.643) (-310.586) [-307.277] -- 0:00:35

      Average standard deviation of split frequencies: 0.010040

      405500 -- (-307.620) (-310.602) [-308.582] (-309.530) * (-310.061) [-310.469] (-309.660) (-310.859) -- 0:00:35
      406000 -- (-309.080) (-309.553) [-308.120] (-309.775) * (-311.575) (-308.311) [-307.371] (-308.144) -- 0:00:35
      406500 -- (-308.457) (-307.034) (-307.462) [-310.503] * (-309.875) (-310.880) [-308.244] (-308.083) -- 0:00:35
      407000 -- (-307.326) (-311.060) (-309.188) [-307.681] * (-311.343) [-309.117] (-308.102) (-308.475) -- 0:00:36
      407500 -- (-308.472) [-311.504] (-311.623) (-307.664) * (-307.459) (-308.711) (-307.867) [-307.079] -- 0:00:36
      408000 -- (-307.006) (-307.885) [-310.867] (-308.800) * [-307.692] (-308.992) (-308.624) (-310.168) -- 0:00:36
      408500 -- (-314.707) (-307.937) (-309.051) [-307.289] * (-308.603) (-308.294) [-309.852] (-308.731) -- 0:00:36
      409000 -- (-311.263) (-307.441) (-308.262) [-308.064] * [-306.472] (-309.540) (-308.519) (-311.136) -- 0:00:36
      409500 -- (-309.595) (-311.720) (-308.885) [-308.373] * (-308.591) (-307.788) [-310.043] (-307.922) -- 0:00:36
      410000 -- [-309.478] (-309.183) (-309.021) (-307.734) * (-307.819) [-308.518] (-306.937) (-306.617) -- 0:00:35

      Average standard deviation of split frequencies: 0.009993

      410500 -- (-308.896) (-308.778) [-306.839] (-308.510) * (-309.759) [-310.580] (-308.464) (-312.082) -- 0:00:35
      411000 -- (-311.706) (-309.947) [-311.495] (-309.976) * (-307.898) (-309.718) (-313.274) [-309.017] -- 0:00:35
      411500 -- (-307.737) (-313.608) [-310.458] (-306.485) * (-310.160) (-312.452) (-307.900) [-307.265] -- 0:00:35
      412000 -- [-307.832] (-314.318) (-307.812) (-310.565) * (-311.308) (-308.373) (-307.371) [-307.073] -- 0:00:35
      412500 -- [-308.291] (-310.134) (-308.676) (-309.137) * (-310.606) (-315.524) (-308.191) [-308.876] -- 0:00:35
      413000 -- (-310.588) (-307.049) [-307.267] (-310.326) * [-307.765] (-308.927) (-309.635) (-307.047) -- 0:00:35
      413500 -- [-307.414] (-307.320) (-309.615) (-310.331) * (-307.813) (-307.450) (-307.437) [-307.858] -- 0:00:35
      414000 -- (-309.562) (-310.514) [-308.258] (-307.814) * (-308.276) (-310.955) (-311.140) [-309.801] -- 0:00:35
      414500 -- (-307.045) (-312.331) (-307.424) [-308.721] * (-307.828) (-306.550) [-308.144] (-309.842) -- 0:00:35
      415000 -- (-310.595) (-307.839) [-307.069] (-313.424) * (-311.454) (-308.431) [-307.117] (-307.702) -- 0:00:35

      Average standard deviation of split frequencies: 0.009999

      415500 -- (-312.799) (-306.561) (-309.579) [-309.397] * (-309.111) (-307.600) (-307.618) [-307.166] -- 0:00:35
      416000 -- [-308.874] (-309.611) (-309.197) (-311.959) * (-308.641) (-311.221) (-308.171) [-306.601] -- 0:00:35
      416500 -- (-309.153) (-310.344) (-308.287) [-310.255] * [-311.351] (-308.454) (-308.787) (-307.851) -- 0:00:35
      417000 -- (-308.714) (-309.472) (-307.860) [-308.161] * [-308.155] (-308.365) (-307.930) (-307.394) -- 0:00:34
      417500 -- (-311.086) (-306.486) (-311.047) [-308.916] * [-306.536] (-310.625) (-306.843) (-310.963) -- 0:00:34
      418000 -- (-310.115) (-309.914) (-310.471) [-307.472] * (-308.298) [-310.333] (-308.230) (-308.102) -- 0:00:34
      418500 -- (-308.426) (-311.537) (-317.427) [-306.665] * (-310.286) (-307.595) (-307.178) [-310.350] -- 0:00:34
      419000 -- (-306.916) [-311.779] (-311.922) (-308.177) * (-308.789) [-306.806] (-307.426) (-308.476) -- 0:00:34
      419500 -- (-310.053) [-307.604] (-308.503) (-307.439) * (-307.267) [-308.315] (-309.097) (-308.462) -- 0:00:34
      420000 -- (-310.600) [-306.944] (-309.384) (-308.216) * (-310.458) [-311.519] (-307.987) (-309.099) -- 0:00:34

      Average standard deviation of split frequencies: 0.009954

      420500 -- (-310.038) (-306.625) (-310.912) [-307.644] * [-310.091] (-308.177) (-306.953) (-308.666) -- 0:00:34
      421000 -- (-309.524) (-307.091) (-306.867) [-308.604] * (-308.330) (-310.937) [-307.368] (-307.451) -- 0:00:34
      421500 -- (-308.635) (-310.471) [-308.200] (-307.504) * (-308.402) [-310.285] (-310.102) (-307.079) -- 0:00:34
      422000 -- (-309.105) (-309.468) [-310.267] (-306.875) * (-308.859) [-309.970] (-309.136) (-306.922) -- 0:00:34
      422500 -- (-306.668) (-309.618) (-310.959) [-307.165] * (-308.970) (-307.062) [-307.898] (-308.711) -- 0:00:34
      423000 -- [-310.924] (-307.952) (-306.857) (-309.103) * (-310.249) (-306.814) [-307.887] (-308.086) -- 0:00:34
      423500 -- (-309.389) [-308.327] (-310.584) (-306.909) * (-309.165) [-309.057] (-310.536) (-307.886) -- 0:00:34
      424000 -- (-310.119) [-308.014] (-310.185) (-310.180) * (-307.693) (-308.462) [-310.718] (-310.214) -- 0:00:35
      424500 -- [-308.619] (-308.504) (-307.164) (-309.180) * (-308.685) [-308.014] (-309.339) (-307.038) -- 0:00:35
      425000 -- (-306.921) [-308.881] (-310.835) (-310.532) * (-311.000) (-309.923) [-310.349] (-308.176) -- 0:00:35

      Average standard deviation of split frequencies: 0.010089

      425500 -- (-308.783) (-309.834) [-309.342] (-309.118) * (-308.269) (-308.152) [-309.861] (-309.051) -- 0:00:35
      426000 -- (-312.641) (-308.865) (-312.760) [-308.665] * (-308.376) (-307.534) (-308.383) [-307.380] -- 0:00:35
      426500 -- (-314.186) [-308.470] (-307.143) (-310.272) * (-307.930) (-307.555) (-308.602) [-307.996] -- 0:00:34
      427000 -- (-309.830) (-307.668) [-307.609] (-309.310) * (-308.392) (-307.902) (-309.187) [-307.999] -- 0:00:34
      427500 -- (-309.420) [-306.807] (-308.358) (-309.149) * [-308.274] (-308.242) (-309.346) (-309.122) -- 0:00:34
      428000 -- (-308.003) (-306.321) [-312.469] (-307.280) * (-307.052) [-309.064] (-316.748) (-308.757) -- 0:00:34
      428500 -- (-311.524) (-307.961) [-307.140] (-307.684) * (-309.734) (-309.406) [-307.985] (-308.341) -- 0:00:34
      429000 -- (-309.012) (-306.695) (-306.809) [-308.490] * [-307.398] (-309.944) (-307.604) (-307.798) -- 0:00:34
      429500 -- (-307.959) [-310.321] (-307.756) (-307.339) * (-309.299) (-308.789) (-308.192) [-307.149] -- 0:00:34
      430000 -- [-307.626] (-307.625) (-309.599) (-308.463) * (-310.014) (-308.145) [-308.000] (-307.643) -- 0:00:34

      Average standard deviation of split frequencies: 0.010109

      430500 -- (-311.705) [-307.461] (-308.621) (-314.274) * (-308.013) [-309.697] (-307.290) (-308.427) -- 0:00:34
      431000 -- (-310.234) [-310.640] (-309.153) (-310.107) * (-307.134) (-311.741) [-308.476] (-310.340) -- 0:00:34
      431500 -- [-309.122] (-309.036) (-306.571) (-310.233) * (-308.249) [-310.004] (-307.355) (-306.812) -- 0:00:34
      432000 -- (-307.752) (-307.602) [-309.224] (-308.667) * (-306.461) (-310.919) [-307.661] (-307.698) -- 0:00:34
      432500 -- (-306.810) [-308.807] (-308.518) (-309.986) * (-308.067) (-308.287) [-306.847] (-309.693) -- 0:00:34
      433000 -- (-312.150) (-309.569) (-307.371) [-309.532] * [-310.967] (-307.477) (-307.250) (-307.837) -- 0:00:34
      433500 -- (-308.797) (-310.427) (-307.177) [-308.681] * [-311.680] (-310.691) (-307.981) (-308.729) -- 0:00:33
      434000 -- (-308.461) (-312.303) [-308.431] (-309.708) * (-309.976) (-309.305) [-308.968] (-310.611) -- 0:00:33
      434500 -- [-307.416] (-308.710) (-307.227) (-309.646) * (-308.095) (-308.486) (-307.946) [-307.977] -- 0:00:33
      435000 -- (-307.430) (-310.092) (-307.669) [-308.610] * (-309.362) (-308.392) (-309.362) [-307.061] -- 0:00:33

      Average standard deviation of split frequencies: 0.010367

      435500 -- (-307.532) (-310.862) [-307.701] (-311.644) * (-309.198) (-307.901) (-308.479) [-309.725] -- 0:00:33
      436000 -- [-306.857] (-307.633) (-308.982) (-308.435) * [-307.458] (-311.584) (-311.267) (-307.902) -- 0:00:33
      436500 -- (-307.000) (-310.384) [-306.708] (-311.480) * (-306.668) (-308.806) (-307.988) [-306.677] -- 0:00:33
      437000 -- [-308.280] (-310.317) (-307.313) (-307.352) * (-308.073) [-309.217] (-307.263) (-307.508) -- 0:00:33
      437500 -- [-308.564] (-309.943) (-307.973) (-307.305) * [-308.724] (-308.744) (-314.399) (-307.616) -- 0:00:33
      438000 -- (-309.337) (-308.322) [-313.190] (-311.509) * (-307.919) [-310.590] (-308.457) (-307.361) -- 0:00:33
      438500 -- (-309.157) (-310.618) [-309.745] (-311.164) * [-313.235] (-307.738) (-308.822) (-308.300) -- 0:00:33
      439000 -- (-309.347) (-310.622) [-308.598] (-313.809) * (-310.218) (-311.189) [-307.173] (-311.021) -- 0:00:33
      439500 -- (-307.113) (-306.748) [-308.040] (-308.461) * (-309.107) (-307.882) [-306.502] (-308.503) -- 0:00:33
      440000 -- (-307.618) [-308.262] (-307.354) (-308.064) * (-309.929) (-308.376) (-306.867) [-308.793] -- 0:00:33

      Average standard deviation of split frequencies: 0.009942

      440500 -- (-311.365) [-308.619] (-310.420) (-307.881) * [-309.060] (-308.924) (-310.079) (-309.205) -- 0:00:33
      441000 -- [-307.242] (-310.367) (-309.533) (-310.088) * (-308.680) (-311.343) [-310.333] (-310.041) -- 0:00:34
      441500 -- (-307.524) [-308.060] (-309.843) (-307.489) * (-308.420) (-306.951) (-308.220) [-309.857] -- 0:00:34
      442000 -- (-307.032) [-310.583] (-308.704) (-308.763) * (-308.192) (-306.631) (-307.309) [-311.390] -- 0:00:34
      442500 -- (-308.140) [-308.602] (-310.814) (-307.992) * (-309.461) (-306.836) [-308.518] (-307.744) -- 0:00:34
      443000 -- (-308.404) (-307.265) [-307.111] (-308.728) * (-306.984) (-306.602) (-307.249) [-309.226] -- 0:00:33
      443500 -- (-308.641) [-310.680] (-309.818) (-308.038) * (-308.857) [-307.015] (-306.887) (-312.159) -- 0:00:33
      444000 -- [-310.593] (-307.623) (-309.286) (-306.648) * (-309.642) (-307.174) [-309.143] (-308.223) -- 0:00:33
      444500 -- (-309.964) (-306.761) (-307.906) [-310.626] * (-310.902) (-307.070) [-311.997] (-308.992) -- 0:00:33
      445000 -- (-308.650) (-307.728) (-308.682) [-309.002] * (-309.773) [-308.511] (-310.262) (-307.073) -- 0:00:33

      Average standard deviation of split frequencies: 0.010197

      445500 -- (-307.829) [-309.615] (-308.732) (-307.850) * [-308.722] (-307.412) (-309.338) (-308.743) -- 0:00:33
      446000 -- (-310.176) (-311.941) [-310.853] (-308.277) * (-311.766) (-311.325) [-307.482] (-307.934) -- 0:00:33
      446500 -- [-309.028] (-308.345) (-310.120) (-308.343) * (-309.447) (-309.558) (-306.971) [-307.702] -- 0:00:33
      447000 -- (-310.616) (-311.167) (-310.944) [-310.384] * [-307.101] (-311.443) (-308.019) (-309.040) -- 0:00:33
      447500 -- [-307.730] (-311.404) (-308.186) (-307.343) * (-308.392) (-313.338) [-311.790] (-307.316) -- 0:00:33
      448000 -- (-310.064) [-309.710] (-308.198) (-308.392) * [-309.120] (-310.094) (-308.113) (-308.590) -- 0:00:33
      448500 -- (-313.007) [-307.137] (-311.312) (-306.748) * (-311.268) [-309.046] (-313.196) (-308.412) -- 0:00:33
      449000 -- (-307.981) (-308.573) [-312.157] (-307.726) * (-308.067) [-307.917] (-309.573) (-311.573) -- 0:00:33
      449500 -- (-308.517) [-306.975] (-309.187) (-308.943) * (-309.842) (-311.279) [-307.638] (-308.758) -- 0:00:33
      450000 -- (-309.884) (-310.948) [-309.512] (-307.364) * (-309.021) (-309.045) (-307.020) [-307.816] -- 0:00:33

      Average standard deviation of split frequencies: 0.009783

      450500 -- (-311.453) (-308.679) (-308.200) [-309.339] * [-309.676] (-309.980) (-306.788) (-310.556) -- 0:00:32
      451000 -- (-306.893) (-306.833) [-311.671] (-311.576) * (-307.200) (-307.666) [-308.294] (-311.010) -- 0:00:32
      451500 -- (-307.848) (-307.871) (-313.299) [-309.552] * (-308.590) [-310.515] (-308.615) (-307.854) -- 0:00:32
      452000 -- (-311.949) (-310.292) [-308.219] (-309.807) * (-312.782) (-307.145) [-308.509] (-310.335) -- 0:00:32
      452500 -- (-308.217) (-308.606) [-310.402] (-309.005) * [-309.075] (-308.528) (-310.596) (-314.876) -- 0:00:32
      453000 -- (-309.139) (-307.840) (-309.273) [-307.627] * (-307.545) (-309.433) [-307.157] (-312.024) -- 0:00:32
      453500 -- (-307.836) [-307.711] (-310.863) (-307.078) * [-307.438] (-308.266) (-309.111) (-307.849) -- 0:00:32
      454000 -- [-308.192] (-308.070) (-308.591) (-308.396) * (-308.153) (-307.884) (-309.583) [-307.721] -- 0:00:32
      454500 -- (-313.616) (-307.260) (-308.845) [-307.774] * (-307.724) (-307.027) [-307.747] (-307.745) -- 0:00:32
      455000 -- (-309.841) [-308.621] (-307.838) (-308.883) * [-306.906] (-308.672) (-309.798) (-311.230) -- 0:00:32

      Average standard deviation of split frequencies: 0.009669

      455500 -- (-308.762) [-308.002] (-309.063) (-306.662) * (-308.328) (-309.031) [-311.283] (-307.986) -- 0:00:32
      456000 -- (-307.397) [-306.789] (-307.999) (-307.905) * (-306.927) (-306.494) (-314.919) [-309.873] -- 0:00:32
      456500 -- (-309.163) (-307.486) (-307.132) [-309.476] * [-306.934] (-306.408) (-314.046) (-308.769) -- 0:00:32
      457000 -- [-308.879] (-309.991) (-307.844) (-309.780) * (-308.231) (-306.897) (-306.396) [-308.008] -- 0:00:32
      457500 -- (-308.337) [-308.669] (-308.713) (-310.577) * [-307.358] (-306.608) (-310.554) (-307.408) -- 0:00:32
      458000 -- (-307.731) (-308.058) [-311.303] (-313.122) * (-319.196) (-308.332) [-311.466] (-307.234) -- 0:00:33
      458500 -- (-306.485) (-307.943) (-307.871) [-309.319] * (-313.705) (-307.229) (-313.409) [-306.804] -- 0:00:33
      459000 -- (-309.449) (-311.878) (-307.628) [-308.668] * (-307.550) (-310.738) (-307.533) [-307.064] -- 0:00:33
      459500 -- (-311.534) (-311.467) [-310.516] (-307.037) * [-307.249] (-307.542) (-306.606) (-310.564) -- 0:00:32
      460000 -- (-310.053) (-308.585) (-306.912) [-308.756] * (-307.414) (-307.473) (-307.622) [-309.516] -- 0:00:32

      Average standard deviation of split frequencies: 0.009330

      460500 -- (-307.884) (-307.871) (-307.326) [-307.174] * (-309.170) [-308.204] (-307.891) (-306.620) -- 0:00:32
      461000 -- (-308.809) (-309.304) [-309.768] (-307.652) * (-308.501) [-308.253] (-306.905) (-309.212) -- 0:00:32
      461500 -- (-307.731) (-307.552) (-308.159) [-308.391] * (-308.293) (-307.165) (-307.469) [-312.278] -- 0:00:32
      462000 -- [-308.979] (-309.588) (-307.732) (-308.925) * (-311.847) (-310.725) (-306.965) [-309.705] -- 0:00:32
      462500 -- (-311.856) [-307.993] (-308.919) (-307.178) * [-308.159] (-308.773) (-308.700) (-306.977) -- 0:00:32
      463000 -- (-308.107) (-308.470) [-309.040] (-311.457) * (-307.316) [-309.011] (-310.782) (-308.514) -- 0:00:32
      463500 -- (-306.879) (-308.730) (-313.315) [-307.232] * (-308.589) (-310.000) [-309.827] (-309.320) -- 0:00:32
      464000 -- (-309.362) (-308.263) [-307.629] (-307.406) * (-308.834) (-308.958) [-308.897] (-309.192) -- 0:00:32
      464500 -- (-307.007) (-309.353) [-309.270] (-306.922) * (-307.316) (-309.430) [-309.883] (-309.057) -- 0:00:32
      465000 -- (-309.071) (-309.209) (-306.891) [-306.945] * (-308.627) [-308.252] (-316.183) (-310.251) -- 0:00:32

      Average standard deviation of split frequencies: 0.009342

      465500 -- [-309.008] (-306.972) (-306.908) (-308.632) * (-308.214) (-309.073) [-307.831] (-309.467) -- 0:00:32
      466000 -- (-310.269) [-309.843] (-310.644) (-308.777) * (-312.205) [-306.731] (-309.097) (-308.727) -- 0:00:32
      466500 -- (-309.101) (-309.143) (-310.367) [-306.582] * (-308.631) (-307.828) [-308.469] (-311.045) -- 0:00:32
      467000 -- [-308.154] (-307.378) (-310.490) (-306.566) * (-309.078) [-308.985] (-309.432) (-310.203) -- 0:00:31
      467500 -- (-308.059) (-308.090) (-307.390) [-307.190] * (-311.215) [-308.398] (-309.476) (-309.197) -- 0:00:31
      468000 -- (-308.362) (-310.668) (-308.988) [-307.964] * (-309.389) (-309.832) (-307.236) [-306.964] -- 0:00:31
      468500 -- [-308.063] (-310.719) (-308.608) (-311.021) * (-314.902) (-310.344) (-309.428) [-308.753] -- 0:00:31
      469000 -- (-306.803) (-313.156) (-310.914) [-308.976] * [-309.329] (-310.182) (-307.366) (-306.888) -- 0:00:31
      469500 -- (-308.519) (-309.898) [-307.635] (-308.658) * (-309.104) (-310.661) (-308.235) [-306.963] -- 0:00:31
      470000 -- [-306.905] (-306.604) (-310.689) (-308.990) * (-308.583) (-311.896) [-306.684] (-309.870) -- 0:00:31

      Average standard deviation of split frequencies: 0.009452

      470500 -- (-307.547) (-308.797) [-309.603] (-308.755) * (-313.968) (-307.708) (-307.434) [-307.560] -- 0:00:31
      471000 -- (-308.036) (-308.601) [-310.960] (-307.538) * [-310.553] (-308.451) (-312.570) (-307.385) -- 0:00:31
      471500 -- (-309.746) (-306.702) [-310.752] (-309.080) * (-313.901) (-307.415) (-314.207) [-307.719] -- 0:00:31
      472000 -- (-308.982) (-309.050) (-309.479) [-309.314] * (-309.629) [-309.678] (-307.703) (-308.704) -- 0:00:31
      472500 -- (-311.186) (-306.676) (-312.447) [-307.841] * (-311.041) [-307.150] (-309.941) (-308.522) -- 0:00:31
      473000 -- (-307.784) [-307.465] (-310.495) (-307.186) * (-311.875) (-308.955) (-308.246) [-310.871] -- 0:00:31
      473500 -- (-306.785) [-309.210] (-309.852) (-311.462) * (-309.497) [-308.572] (-309.289) (-309.186) -- 0:00:31
      474000 -- [-311.278] (-309.636) (-308.119) (-307.286) * (-306.525) (-307.458) [-308.613] (-308.585) -- 0:00:31
      474500 -- [-306.997] (-307.116) (-307.306) (-307.191) * [-309.532] (-308.044) (-310.751) (-308.114) -- 0:00:31
      475000 -- (-308.779) (-308.786) [-306.278] (-307.184) * (-311.795) (-308.490) [-308.464] (-311.673) -- 0:00:32

      Average standard deviation of split frequencies: 0.008851

      475500 -- (-308.328) [-308.017] (-307.614) (-308.967) * (-316.469) (-309.819) (-306.821) [-308.492] -- 0:00:31
      476000 -- (-306.809) [-307.841] (-307.915) (-308.528) * (-308.972) (-310.850) [-307.858] (-308.923) -- 0:00:31
      476500 -- (-309.044) [-307.884] (-309.487) (-307.643) * [-307.784] (-312.515) (-307.737) (-310.922) -- 0:00:31
      477000 -- (-308.342) (-307.459) (-309.924) [-308.288] * (-307.022) [-311.041] (-310.715) (-311.441) -- 0:00:31
      477500 -- (-312.210) (-308.215) [-307.905] (-307.494) * [-307.179] (-308.732) (-311.620) (-308.400) -- 0:00:31
      478000 -- (-308.345) (-308.990) (-309.943) [-309.382] * [-309.244] (-308.206) (-309.439) (-307.392) -- 0:00:31
      478500 -- (-307.582) (-307.441) (-311.578) [-306.977] * (-309.683) (-307.195) [-308.320] (-310.934) -- 0:00:31
      479000 -- [-309.769] (-311.867) (-310.406) (-310.550) * (-309.540) (-307.209) [-307.185] (-311.650) -- 0:00:31
      479500 -- [-310.580] (-310.430) (-309.719) (-308.531) * (-308.590) (-307.579) [-310.112] (-308.072) -- 0:00:31
      480000 -- (-310.083) [-309.770] (-307.801) (-308.590) * [-306.524] (-308.138) (-307.726) (-309.919) -- 0:00:31

      Average standard deviation of split frequencies: 0.008336

      480500 -- [-308.724] (-313.595) (-308.858) (-308.236) * [-308.898] (-308.273) (-309.999) (-309.009) -- 0:00:31
      481000 -- (-309.627) (-306.631) (-306.434) [-307.208] * (-309.859) (-308.384) [-309.231] (-311.037) -- 0:00:31
      481500 -- (-307.771) (-309.134) [-307.692] (-309.482) * (-307.359) [-308.180] (-311.408) (-309.269) -- 0:00:31
      482000 -- [-307.177] (-307.691) (-309.318) (-311.503) * (-308.086) [-311.504] (-309.164) (-311.653) -- 0:00:31
      482500 -- [-308.763] (-307.083) (-307.839) (-309.651) * [-309.912] (-310.086) (-310.169) (-309.427) -- 0:00:31
      483000 -- (-314.029) (-307.023) (-309.820) [-308.350] * (-308.791) (-306.792) (-310.171) [-311.703] -- 0:00:31
      483500 -- (-307.651) [-308.715] (-308.223) (-311.546) * (-312.380) [-307.496] (-312.190) (-308.352) -- 0:00:30
      484000 -- (-307.151) (-308.034) [-306.610] (-308.413) * (-308.284) [-310.176] (-310.258) (-309.379) -- 0:00:30
      484500 -- (-310.269) (-306.703) [-306.706] (-310.515) * [-307.405] (-312.537) (-307.150) (-310.887) -- 0:00:30
      485000 -- (-307.319) [-309.205] (-310.965) (-307.808) * (-307.313) [-307.825] (-308.001) (-312.910) -- 0:00:30

      Average standard deviation of split frequencies: 0.008305

      485500 -- (-307.979) [-310.026] (-308.186) (-308.197) * (-307.442) (-309.010) [-312.121] (-308.802) -- 0:00:30
      486000 -- [-308.476] (-306.593) (-309.783) (-307.882) * [-309.713] (-309.072) (-307.552) (-309.973) -- 0:00:30
      486500 -- [-306.558] (-307.651) (-309.693) (-308.953) * [-308.824] (-308.776) (-309.627) (-307.940) -- 0:00:30
      487000 -- (-308.801) [-307.562] (-308.134) (-307.810) * (-307.634) (-310.085) (-312.209) [-307.151] -- 0:00:30
      487500 -- [-308.652] (-312.406) (-311.492) (-308.741) * (-310.865) [-310.584] (-308.267) (-308.149) -- 0:00:30
      488000 -- (-308.007) (-311.493) [-309.691] (-310.788) * (-308.280) [-308.531] (-309.097) (-307.003) -- 0:00:30
      488500 -- (-310.793) (-310.970) (-309.051) [-310.414] * (-307.236) [-309.002] (-307.611) (-310.038) -- 0:00:30
      489000 -- (-307.107) (-310.083) [-307.130] (-307.736) * (-314.492) (-309.867) (-307.040) [-308.506] -- 0:00:30
      489500 -- (-307.987) (-308.605) [-308.985] (-306.789) * (-309.922) (-308.947) (-306.659) [-309.920] -- 0:00:30
      490000 -- (-307.077) [-309.661] (-311.950) (-308.002) * (-310.308) [-312.623] (-308.259) (-310.370) -- 0:00:30

      Average standard deviation of split frequencies: 0.008226

      490500 -- [-307.518] (-309.846) (-309.024) (-309.379) * (-309.031) (-309.276) (-307.381) [-313.179] -- 0:00:30
      491000 -- [-309.416] (-310.261) (-308.603) (-308.344) * (-314.605) [-307.661] (-308.036) (-310.548) -- 0:00:30
      491500 -- (-307.328) (-308.457) (-307.629) [-308.275] * [-307.401] (-308.372) (-307.755) (-306.824) -- 0:00:30
      492000 -- (-311.750) (-310.208) [-309.111] (-308.681) * (-306.633) [-309.018] (-307.493) (-306.911) -- 0:00:30
      492500 -- (-310.158) (-306.770) (-311.165) [-306.903] * (-307.691) (-311.976) (-307.863) [-307.437] -- 0:00:30
      493000 -- [-308.038] (-308.922) (-308.548) (-309.719) * (-310.406) (-309.257) (-309.387) [-308.854] -- 0:00:30
      493500 -- (-312.156) (-308.549) [-308.544] (-308.285) * (-308.052) (-307.570) [-306.445] (-312.038) -- 0:00:30
      494000 -- (-309.913) (-308.996) [-312.835] (-308.072) * (-306.960) (-308.331) (-307.075) [-307.602] -- 0:00:30
      494500 -- [-306.735] (-308.024) (-307.728) (-306.660) * [-311.104] (-308.493) (-309.537) (-307.860) -- 0:00:30
      495000 -- (-307.331) (-308.718) [-307.055] (-308.347) * (-312.999) (-308.878) (-308.459) [-307.516] -- 0:00:30

      Average standard deviation of split frequencies: 0.007544

      495500 -- (-307.444) (-311.235) [-307.254] (-311.045) * (-308.512) (-308.768) (-310.355) [-310.491] -- 0:00:30
      496000 -- (-307.658) (-307.623) (-308.848) [-310.627] * (-307.996) (-306.928) (-310.498) [-309.205] -- 0:00:30
      496500 -- [-309.048] (-308.508) (-308.431) (-307.930) * (-311.239) [-307.631] (-307.840) (-307.926) -- 0:00:30
      497000 -- (-310.114) [-306.784] (-309.591) (-309.209) * (-316.014) (-309.416) (-307.891) [-312.336] -- 0:00:30
      497500 -- (-310.389) (-311.001) [-310.684] (-307.899) * (-319.007) [-307.808] (-308.534) (-309.584) -- 0:00:30
      498000 -- [-307.647] (-306.986) (-306.925) (-309.650) * (-311.761) (-308.080) (-306.631) [-308.137] -- 0:00:30
      498500 -- (-307.631) (-307.915) (-309.271) [-307.710] * (-309.015) (-308.374) [-308.513] (-308.039) -- 0:00:30
      499000 -- (-309.017) (-310.026) (-308.824) [-309.041] * [-308.489] (-309.436) (-310.768) (-308.717) -- 0:00:30
      499500 -- [-307.494] (-313.039) (-307.009) (-309.251) * (-308.771) (-307.209) [-312.104] (-308.289) -- 0:00:30
      500000 -- (-307.845) (-312.851) [-311.787] (-307.043) * (-308.250) [-310.141] (-309.970) (-309.061) -- 0:00:30

      Average standard deviation of split frequencies: 0.007591

      500500 -- (-308.078) (-309.487) (-308.598) [-312.806] * (-307.866) (-309.371) (-308.776) [-308.580] -- 0:00:29
      501000 -- (-310.062) (-310.424) [-307.385] (-313.739) * [-309.805] (-308.378) (-308.438) (-307.313) -- 0:00:29
      501500 -- (-308.901) (-308.069) (-308.589) [-311.905] * [-308.011] (-308.397) (-309.586) (-312.078) -- 0:00:29
      502000 -- [-309.314] (-313.094) (-315.746) (-310.840) * (-307.131) [-307.760] (-312.208) (-307.608) -- 0:00:29
      502500 -- (-313.173) (-307.957) [-307.754] (-311.565) * [-307.778] (-308.359) (-316.861) (-308.193) -- 0:00:29
      503000 -- [-310.057] (-306.814) (-309.461) (-306.974) * (-310.535) (-309.257) [-309.925] (-311.764) -- 0:00:29
      503500 -- (-309.332) (-313.629) (-310.406) [-308.030] * [-310.448] (-308.367) (-308.708) (-309.571) -- 0:00:29
      504000 -- (-308.016) (-309.048) (-311.763) [-310.598] * (-311.279) [-308.388] (-306.876) (-310.594) -- 0:00:29
      504500 -- (-308.932) (-308.124) [-308.213] (-309.224) * (-313.166) [-308.996] (-307.151) (-308.436) -- 0:00:29
      505000 -- (-307.184) (-309.794) [-314.751] (-307.574) * (-308.854) [-310.928] (-307.114) (-307.446) -- 0:00:29

      Average standard deviation of split frequencies: 0.007337

      505500 -- (-309.458) (-308.428) [-308.528] (-309.231) * [-308.104] (-307.605) (-309.822) (-307.950) -- 0:00:29
      506000 -- [-311.918] (-309.755) (-309.252) (-307.452) * (-307.085) (-307.612) [-307.679] (-311.136) -- 0:00:29
      506500 -- (-308.092) (-308.017) [-307.040] (-308.519) * (-309.193) (-308.821) [-306.826] (-316.250) -- 0:00:29
      507000 -- (-309.726) [-310.405] (-307.453) (-308.268) * (-311.157) [-308.158] (-308.222) (-309.811) -- 0:00:29
      507500 -- [-307.539] (-310.798) (-312.952) (-309.012) * [-307.168] (-309.664) (-311.248) (-310.749) -- 0:00:29
      508000 -- [-307.487] (-308.932) (-312.350) (-308.042) * (-308.644) (-307.647) (-309.024) [-307.387] -- 0:00:29
      508500 -- [-311.424] (-312.647) (-307.597) (-308.098) * (-309.710) (-312.109) (-308.889) [-307.050] -- 0:00:29
      509000 -- (-312.692) (-309.026) (-310.399) [-308.197] * (-312.071) [-306.891] (-308.111) (-308.498) -- 0:00:29
      509500 -- [-309.505] (-309.722) (-308.764) (-309.810) * (-309.093) [-306.861] (-306.963) (-309.091) -- 0:00:29
      510000 -- (-307.654) (-307.712) (-311.501) [-308.096] * [-308.670] (-306.654) (-307.213) (-309.835) -- 0:00:29

      Average standard deviation of split frequencies: 0.007731

      510500 -- [-308.478] (-306.948) (-306.460) (-307.868) * (-309.120) [-307.803] (-310.265) (-308.391) -- 0:00:29
      511000 -- (-308.773) (-313.103) (-310.532) [-308.312] * (-311.831) [-308.720] (-307.631) (-307.808) -- 0:00:29
      511500 -- (-313.378) [-306.783] (-307.128) (-306.976) * [-309.851] (-309.084) (-310.551) (-308.462) -- 0:00:29
      512000 -- (-311.360) (-308.607) (-308.951) [-307.019] * [-306.923] (-310.611) (-307.577) (-311.027) -- 0:00:29
      512500 -- (-308.757) (-307.597) [-310.843] (-308.367) * (-308.509) (-313.054) [-309.451] (-311.104) -- 0:00:29
      513000 -- (-309.752) (-307.535) (-307.304) [-307.177] * [-309.860] (-311.645) (-309.877) (-313.127) -- 0:00:29
      513500 -- (-311.826) [-308.882] (-308.423) (-307.427) * (-307.841) (-312.421) [-306.901] (-313.382) -- 0:00:29
      514000 -- (-308.097) (-307.605) (-309.781) [-308.184] * (-308.118) (-310.765) [-307.388] (-307.448) -- 0:00:29
      514500 -- (-308.155) [-308.218] (-308.928) (-311.917) * (-310.404) (-314.908) (-308.878) [-308.689] -- 0:00:29
      515000 -- (-310.631) [-308.245] (-306.490) (-307.924) * (-308.198) (-314.575) [-308.147] (-307.242) -- 0:00:29

      Average standard deviation of split frequencies: 0.007994

      515500 -- (-310.578) [-308.476] (-310.281) (-310.476) * (-308.561) [-311.134] (-310.185) (-314.761) -- 0:00:29
      516000 -- (-308.985) [-310.144] (-308.691) (-307.719) * (-308.749) (-307.548) [-308.982] (-307.977) -- 0:00:29
      516500 -- (-310.165) [-306.527] (-308.982) (-309.692) * (-307.300) (-307.984) (-309.589) [-307.923] -- 0:00:29
      517000 -- (-314.343) (-308.899) (-309.248) [-310.795] * [-310.689] (-308.532) (-306.575) (-309.289) -- 0:00:28
      517500 -- (-311.344) (-308.496) [-307.887] (-307.271) * (-310.948) [-308.605] (-312.960) (-307.812) -- 0:00:28
      518000 -- (-311.871) (-308.228) [-307.525] (-309.397) * (-308.997) (-307.361) (-316.422) [-307.724] -- 0:00:28
      518500 -- (-310.763) (-313.096) (-309.039) [-307.555] * (-310.628) [-310.122] (-309.173) (-307.849) -- 0:00:28
      519000 -- [-310.251] (-311.965) (-309.859) (-309.939) * (-309.229) (-307.691) [-308.968] (-310.207) -- 0:00:28
      519500 -- (-308.427) [-312.161] (-309.813) (-310.822) * [-307.509] (-310.514) (-307.584) (-307.578) -- 0:00:28
      520000 -- (-307.033) (-308.095) (-308.231) [-308.251] * (-312.907) [-307.586] (-308.385) (-310.699) -- 0:00:28

      Average standard deviation of split frequencies: 0.008488

      520500 -- (-307.928) (-309.531) [-307.955] (-311.013) * (-309.706) (-307.848) (-306.787) [-306.628] -- 0:00:28
      521000 -- (-308.265) [-307.076] (-311.329) (-319.122) * (-312.991) (-307.395) [-309.716] (-309.698) -- 0:00:28
      521500 -- (-307.796) [-308.364] (-311.343) (-308.355) * [-311.500] (-307.424) (-307.626) (-307.782) -- 0:00:28
      522000 -- [-309.914] (-307.659) (-307.905) (-309.323) * (-309.509) (-309.092) (-307.338) [-307.908] -- 0:00:28
      522500 -- (-308.898) [-311.723] (-308.809) (-309.987) * (-308.754) (-310.140) (-318.322) [-310.141] -- 0:00:28
      523000 -- (-308.671) [-307.948] (-308.402) (-308.372) * (-307.760) [-309.307] (-307.574) (-307.661) -- 0:00:28
      523500 -- (-310.464) [-308.195] (-309.342) (-309.230) * (-307.559) (-308.704) [-307.670] (-308.019) -- 0:00:28
      524000 -- [-309.060] (-314.151) (-307.006) (-308.430) * (-311.420) [-309.502] (-306.693) (-309.451) -- 0:00:28
      524500 -- [-308.141] (-312.614) (-307.644) (-307.633) * (-307.208) (-309.790) [-307.518] (-306.745) -- 0:00:28
      525000 -- [-307.714] (-308.233) (-308.266) (-309.005) * [-310.388] (-308.715) (-312.284) (-308.386) -- 0:00:28

      Average standard deviation of split frequencies: 0.009298

      525500 -- [-310.272] (-310.643) (-307.614) (-307.595) * (-306.793) (-311.036) [-308.272] (-309.282) -- 0:00:28
      526000 -- [-307.691] (-310.001) (-312.279) (-308.350) * [-309.381] (-308.968) (-311.459) (-306.800) -- 0:00:28
      526500 -- (-309.580) [-316.342] (-309.741) (-308.014) * (-307.855) (-309.647) (-308.785) [-306.932] -- 0:00:28
      527000 -- (-308.916) [-311.127] (-309.057) (-308.395) * [-308.252] (-308.817) (-311.357) (-309.210) -- 0:00:28
      527500 -- (-309.012) (-308.468) [-309.725] (-311.972) * (-308.639) (-308.801) [-309.425] (-308.430) -- 0:00:28
      528000 -- (-309.957) [-308.016] (-311.950) (-307.703) * [-310.234] (-309.903) (-312.292) (-308.927) -- 0:00:28
      528500 -- (-311.664) [-308.268] (-307.331) (-308.009) * (-307.057) (-309.671) [-308.997] (-313.112) -- 0:00:28
      529000 -- (-307.811) [-308.306] (-308.468) (-307.145) * [-306.897] (-308.264) (-306.768) (-311.432) -- 0:00:28
      529500 -- [-308.024] (-315.672) (-307.049) (-306.526) * (-307.336) [-308.843] (-310.528) (-308.494) -- 0:00:28
      530000 -- (-308.687) (-309.768) (-307.575) [-312.367] * (-309.049) [-306.417] (-311.638) (-309.045) -- 0:00:28

      Average standard deviation of split frequencies: 0.009661

      530500 -- (-307.229) [-307.335] (-307.595) (-308.297) * (-308.161) [-308.708] (-310.965) (-311.009) -- 0:00:28
      531000 -- (-306.578) (-309.794) (-310.799) [-309.561] * (-308.425) (-308.072) [-308.695] (-309.972) -- 0:00:28
      531500 -- (-308.353) [-306.846] (-311.101) (-310.300) * (-309.213) (-307.551) [-307.389] (-308.204) -- 0:00:28
      532000 -- (-306.582) (-308.887) [-308.574] (-307.139) * (-307.979) [-308.666] (-306.959) (-307.666) -- 0:00:28
      532500 -- (-310.951) (-307.306) [-309.521] (-311.027) * (-311.211) [-306.740] (-309.447) (-310.093) -- 0:00:28
      533000 -- (-309.743) (-307.931) (-307.085) [-308.583] * (-308.126) (-308.112) [-308.658] (-307.795) -- 0:00:28
      533500 -- (-309.438) (-307.901) (-310.735) [-310.003] * [-310.719] (-306.837) (-308.420) (-307.520) -- 0:00:27
      534000 -- [-308.269] (-309.311) (-306.936) (-309.142) * [-307.471] (-306.927) (-309.344) (-308.013) -- 0:00:27
      534500 -- (-308.275) (-307.742) [-308.394] (-308.972) * (-307.998) (-308.958) (-307.979) [-313.171] -- 0:00:27
      535000 -- [-307.284] (-308.159) (-307.732) (-312.158) * [-308.752] (-310.838) (-311.330) (-310.238) -- 0:00:27

      Average standard deviation of split frequencies: 0.009364

      535500 -- [-307.533] (-309.686) (-309.884) (-309.061) * (-308.009) (-311.550) (-310.600) [-307.317] -- 0:00:27
      536000 -- (-313.616) (-310.629) [-306.414] (-309.746) * (-313.147) (-309.147) (-311.824) [-306.856] -- 0:00:27
      536500 -- (-308.397) (-309.181) (-306.921) [-310.996] * (-308.284) (-308.834) (-307.697) [-308.355] -- 0:00:27
      537000 -- (-309.346) [-307.150] (-314.156) (-308.652) * (-308.867) (-309.222) [-309.201] (-310.242) -- 0:00:27
      537500 -- [-307.478] (-308.025) (-310.471) (-310.397) * (-309.991) (-309.138) (-309.199) [-307.937] -- 0:00:27
      538000 -- (-311.578) (-310.988) (-308.232) [-310.171] * (-308.326) (-311.910) (-310.457) [-308.068] -- 0:00:27
      538500 -- (-309.700) (-308.475) (-312.018) [-313.675] * [-308.811] (-310.680) (-308.906) (-307.921) -- 0:00:27
      539000 -- (-308.222) (-307.586) [-308.962] (-307.267) * (-312.715) (-307.746) [-308.276] (-306.945) -- 0:00:27
      539500 -- [-307.103] (-312.705) (-311.938) (-307.541) * (-309.517) (-311.977) [-309.480] (-309.440) -- 0:00:27
      540000 -- [-308.602] (-309.061) (-313.750) (-309.325) * [-312.290] (-310.113) (-309.230) (-310.276) -- 0:00:27

      Average standard deviation of split frequencies: 0.009482

      540500 -- (-308.305) [-306.419] (-310.292) (-308.458) * (-310.622) (-308.690) [-307.612] (-309.098) -- 0:00:27
      541000 -- (-309.073) (-308.459) [-309.493] (-311.194) * (-312.721) (-307.429) (-307.028) [-307.894] -- 0:00:27
      541500 -- (-307.051) [-307.081] (-307.537) (-307.721) * (-310.222) (-308.276) [-309.995] (-310.751) -- 0:00:27
      542000 -- (-307.142) [-307.615] (-306.400) (-307.789) * (-309.885) (-309.927) (-310.144) [-307.287] -- 0:00:27
      542500 -- (-306.765) (-308.689) (-309.057) [-309.722] * (-310.760) (-309.834) [-306.929] (-307.234) -- 0:00:26
      543000 -- [-309.345] (-310.000) (-306.947) (-309.371) * (-310.247) [-309.051] (-307.554) (-308.105) -- 0:00:27
      543500 -- (-310.101) (-312.931) [-307.463] (-310.505) * [-309.563] (-309.998) (-308.029) (-307.199) -- 0:00:27
      544000 -- (-309.011) [-308.608] (-311.247) (-307.470) * [-307.898] (-311.949) (-307.962) (-310.895) -- 0:00:27
      544500 -- [-313.934] (-307.424) (-308.872) (-306.832) * (-310.023) (-310.733) [-307.127] (-308.920) -- 0:00:27
      545000 -- [-313.102] (-310.459) (-307.976) (-307.174) * (-308.939) (-310.145) [-310.573] (-310.302) -- 0:00:27

      Average standard deviation of split frequencies: 0.009650

      545500 -- [-307.499] (-306.718) (-308.532) (-310.254) * (-310.035) (-306.723) [-308.665] (-308.585) -- 0:00:27
      546000 -- (-308.253) (-306.695) (-307.897) [-308.414] * [-310.769] (-308.267) (-311.532) (-309.714) -- 0:00:27
      546500 -- (-308.270) (-307.812) (-314.575) [-306.654] * [-309.586] (-306.900) (-313.502) (-308.623) -- 0:00:27
      547000 -- (-308.248) [-308.700] (-307.290) (-307.818) * (-314.333) [-307.291] (-311.129) (-309.159) -- 0:00:27
      547500 -- (-311.633) [-307.798] (-308.022) (-308.159) * (-313.120) (-309.403) [-307.694] (-308.592) -- 0:00:27
      548000 -- (-313.693) [-308.318] (-312.747) (-308.689) * [-308.738] (-309.701) (-308.190) (-307.686) -- 0:00:27
      548500 -- (-311.946) (-307.360) [-315.041] (-307.437) * (-308.790) (-310.089) [-306.792] (-306.901) -- 0:00:27
      549000 -- (-308.257) (-308.532) (-309.441) [-310.581] * (-309.087) (-309.409) (-309.987) [-306.829] -- 0:00:27
      549500 -- (-309.457) (-309.299) (-307.930) [-309.418] * (-311.825) (-309.746) (-310.975) [-310.588] -- 0:00:27
      550000 -- [-307.317] (-309.562) (-309.341) (-308.061) * (-310.340) (-308.132) [-307.818] (-311.666) -- 0:00:27

      Average standard deviation of split frequencies: 0.009618

      550500 -- (-307.377) [-309.050] (-307.399) (-306.707) * (-309.032) [-309.138] (-306.546) (-306.824) -- 0:00:26
      551000 -- (-312.882) (-313.079) [-307.520] (-309.094) * (-308.343) (-308.451) [-306.867] (-311.900) -- 0:00:26
      551500 -- [-309.775] (-310.288) (-307.788) (-310.146) * (-309.403) (-308.447) [-307.224] (-308.998) -- 0:00:26
      552000 -- [-310.242] (-312.417) (-307.273) (-312.870) * (-309.056) (-307.212) (-308.339) [-311.588] -- 0:00:26
      552500 -- [-308.408] (-312.075) (-307.699) (-309.421) * (-309.844) [-308.746] (-307.379) (-308.788) -- 0:00:26
      553000 -- (-312.947) (-312.839) [-308.897] (-308.077) * (-310.290) (-310.955) (-308.419) [-307.062] -- 0:00:26
      553500 -- (-308.608) [-314.271] (-307.574) (-307.627) * (-306.672) (-307.484) [-307.540] (-309.335) -- 0:00:26
      554000 -- (-307.763) (-310.779) [-307.055] (-307.905) * [-310.354] (-306.944) (-311.324) (-309.016) -- 0:00:26
      554500 -- (-307.522) [-309.918] (-310.507) (-307.146) * (-308.434) [-307.593] (-312.608) (-308.912) -- 0:00:26
      555000 -- (-308.620) [-306.974] (-307.233) (-310.279) * (-311.564) [-309.538] (-310.897) (-312.552) -- 0:00:26

      Average standard deviation of split frequencies: 0.010124

      555500 -- (-308.806) [-310.585] (-307.741) (-310.664) * [-308.082] (-306.759) (-308.466) (-307.254) -- 0:00:26
      556000 -- (-307.859) [-310.570] (-311.338) (-310.402) * (-306.969) (-309.054) [-311.435] (-308.362) -- 0:00:26
      556500 -- [-308.763] (-312.412) (-309.809) (-306.713) * [-310.085] (-310.735) (-311.718) (-308.879) -- 0:00:26
      557000 -- (-310.364) [-307.374] (-308.477) (-311.991) * [-307.924] (-308.218) (-308.680) (-312.212) -- 0:00:26
      557500 -- (-309.818) [-308.336] (-312.845) (-307.650) * (-310.373) [-307.769] (-311.103) (-306.970) -- 0:00:26
      558000 -- (-308.239) (-310.948) [-311.271] (-308.851) * (-307.966) (-307.364) (-309.035) [-307.035] -- 0:00:26
      558500 -- [-309.863] (-309.327) (-307.827) (-312.982) * (-308.426) (-310.059) (-310.500) [-308.541] -- 0:00:26
      559000 -- (-310.718) (-314.098) [-309.321] (-309.251) * (-306.947) (-312.053) (-309.204) [-311.945] -- 0:00:26
      559500 -- (-310.664) (-310.519) [-307.259] (-312.418) * (-308.942) (-309.309) [-311.291] (-313.577) -- 0:00:25
      560000 -- [-306.751] (-307.707) (-308.592) (-307.833) * [-310.268] (-310.235) (-308.796) (-313.948) -- 0:00:26

      Average standard deviation of split frequencies: 0.010878

      560500 -- (-306.739) (-309.584) (-308.115) [-308.654] * (-310.474) (-307.552) [-309.099] (-308.392) -- 0:00:26
      561000 -- (-307.156) [-313.685] (-309.169) (-310.945) * [-309.443] (-308.710) (-307.377) (-309.515) -- 0:00:26
      561500 -- (-308.912) [-312.156] (-308.777) (-307.873) * (-308.132) [-310.326] (-307.242) (-307.122) -- 0:00:26
      562000 -- (-315.829) (-308.428) (-310.632) [-308.311] * [-307.628] (-309.456) (-306.641) (-309.316) -- 0:00:26
      562500 -- (-308.933) [-308.157] (-313.623) (-309.409) * (-307.556) (-308.388) (-306.974) [-307.660] -- 0:00:26
      563000 -- (-311.537) (-308.917) (-309.812) [-308.310] * [-308.991] (-308.386) (-307.528) (-310.776) -- 0:00:26
      563500 -- (-308.474) (-309.475) [-310.359] (-306.902) * [-309.884] (-307.471) (-307.687) (-308.221) -- 0:00:26
      564000 -- (-307.946) (-313.253) (-310.191) [-307.994] * (-310.141) [-307.330] (-307.956) (-308.341) -- 0:00:26
      564500 -- (-308.995) (-312.117) [-307.718] (-308.288) * (-309.587) (-310.400) [-309.868] (-307.317) -- 0:00:26
      565000 -- [-310.514] (-312.082) (-310.640) (-311.822) * [-309.519] (-307.432) (-311.639) (-307.880) -- 0:00:26

      Average standard deviation of split frequencies: 0.010307

      565500 -- (-310.292) [-309.630] (-308.907) (-307.577) * (-309.531) [-308.440] (-312.783) (-310.271) -- 0:00:26
      566000 -- [-309.875] (-308.382) (-308.951) (-309.561) * [-307.876] (-309.289) (-308.422) (-309.125) -- 0:00:26
      566500 -- (-307.178) (-310.844) (-310.272) [-309.724] * [-307.148] (-309.367) (-308.324) (-307.723) -- 0:00:26
      567000 -- [-307.247] (-308.860) (-307.641) (-307.789) * [-308.558] (-311.605) (-308.733) (-307.884) -- 0:00:25
      567500 -- (-307.417) [-307.940] (-307.372) (-310.239) * (-309.196) [-307.087] (-306.923) (-311.607) -- 0:00:25
      568000 -- (-314.943) (-308.243) (-307.638) [-307.208] * (-310.312) [-307.018] (-308.642) (-307.619) -- 0:00:25
      568500 -- (-308.490) [-307.950] (-309.511) (-308.066) * [-309.102] (-312.098) (-310.680) (-308.807) -- 0:00:25
      569000 -- (-309.491) (-306.329) (-310.256) [-311.425] * (-309.876) (-309.163) [-312.177] (-310.518) -- 0:00:25
      569500 -- (-309.510) (-307.382) [-306.683] (-309.541) * (-307.638) [-310.419] (-311.059) (-307.755) -- 0:00:25
      570000 -- [-307.857] (-308.081) (-307.000) (-311.096) * (-307.026) [-312.779] (-311.562) (-309.490) -- 0:00:25

      Average standard deviation of split frequencies: 0.010739

      570500 -- (-307.960) [-308.183] (-309.223) (-310.286) * [-307.177] (-310.858) (-311.680) (-308.574) -- 0:00:25
      571000 -- [-307.134] (-309.167) (-309.238) (-307.587) * (-308.832) (-308.445) [-312.941] (-307.558) -- 0:00:25
      571500 -- [-308.979] (-310.980) (-306.866) (-310.534) * [-306.429] (-307.683) (-314.424) (-308.273) -- 0:00:25
      572000 -- (-306.868) [-309.245] (-308.755) (-308.479) * [-308.680] (-310.061) (-311.691) (-309.554) -- 0:00:25
      572500 -- (-306.844) (-309.048) [-311.674] (-306.853) * (-308.509) (-312.146) [-306.703] (-308.989) -- 0:00:25
      573000 -- (-307.884) (-307.014) [-311.202] (-306.856) * [-309.993] (-307.022) (-310.533) (-306.993) -- 0:00:25
      573500 -- (-315.100) (-306.959) (-307.601) [-307.955] * (-306.957) (-307.109) [-308.999] (-313.342) -- 0:00:25
      574000 -- (-307.163) [-308.043] (-309.327) (-315.922) * [-308.078] (-307.488) (-310.760) (-313.669) -- 0:00:25
      574500 -- (-311.835) (-309.240) (-306.749) [-311.338] * (-309.096) [-306.959] (-311.947) (-311.525) -- 0:00:25
      575000 -- (-308.848) [-309.797] (-307.176) (-311.122) * (-308.344) [-306.660] (-313.126) (-309.857) -- 0:00:25

      Average standard deviation of split frequencies: 0.011100

      575500 -- (-307.944) [-310.189] (-307.629) (-309.336) * (-310.045) (-313.986) (-307.535) [-306.787] -- 0:00:25
      576000 -- (-311.957) [-308.562] (-309.829) (-308.248) * (-307.911) [-313.052] (-311.791) (-306.901) -- 0:00:25
      576500 -- [-311.560] (-310.238) (-311.435) (-308.104) * (-309.010) (-308.594) (-308.915) [-307.342] -- 0:00:24
      577000 -- (-310.646) (-307.936) [-308.163] (-312.263) * [-308.539] (-312.526) (-309.850) (-307.285) -- 0:00:25
      577500 -- (-308.867) (-309.476) (-310.254) [-307.929] * (-311.008) [-308.313] (-310.640) (-307.326) -- 0:00:25
      578000 -- (-308.941) (-310.378) [-311.124] (-310.134) * (-311.977) [-307.568] (-311.521) (-308.456) -- 0:00:25
      578500 -- (-311.036) [-309.195] (-308.353) (-307.660) * (-310.225) [-308.331] (-307.687) (-309.118) -- 0:00:25
      579000 -- (-309.362) (-309.485) (-316.807) [-307.354] * (-307.689) [-316.309] (-307.927) (-309.343) -- 0:00:25
      579500 -- (-309.582) (-310.377) [-309.661] (-309.776) * (-312.085) (-309.038) (-309.566) [-308.290] -- 0:00:25
      580000 -- (-308.086) [-307.041] (-310.287) (-308.498) * (-306.939) (-309.948) [-307.423] (-310.018) -- 0:00:25

      Average standard deviation of split frequencies: 0.010808

      580500 -- [-310.962] (-310.044) (-310.084) (-307.595) * [-308.379] (-308.518) (-309.532) (-310.631) -- 0:00:25
      581000 -- (-312.893) (-310.459) (-308.025) [-306.867] * (-310.237) (-311.281) (-308.121) [-307.765] -- 0:00:25
      581500 -- [-307.399] (-307.341) (-307.534) (-311.096) * (-307.430) [-309.794] (-307.660) (-308.485) -- 0:00:25
      582000 -- [-307.835] (-308.362) (-309.621) (-308.439) * (-310.510) (-307.641) (-308.266) [-309.160] -- 0:00:25
      582500 -- (-310.340) [-308.243] (-308.730) (-311.012) * (-308.046) (-306.840) [-312.561] (-308.732) -- 0:00:25
      583000 -- (-308.014) [-307.677] (-309.077) (-309.612) * [-308.729] (-306.608) (-306.841) (-307.911) -- 0:00:25
      583500 -- (-307.905) [-307.959] (-310.898) (-308.474) * (-312.095) [-307.984] (-308.297) (-309.133) -- 0:00:24
      584000 -- [-307.635] (-306.983) (-310.059) (-310.542) * [-310.581] (-308.321) (-308.105) (-307.305) -- 0:00:24
      584500 -- (-308.164) (-310.885) [-309.133] (-306.652) * (-307.588) [-306.651] (-309.241) (-306.740) -- 0:00:24
      585000 -- (-309.272) (-308.748) (-309.642) [-314.727] * (-310.349) (-306.655) (-309.638) [-307.122] -- 0:00:24

      Average standard deviation of split frequencies: 0.010810

      585500 -- [-309.524] (-308.633) (-306.945) (-315.706) * [-307.732] (-307.348) (-309.791) (-308.793) -- 0:00:24
      586000 -- [-307.745] (-308.234) (-306.791) (-307.636) * (-312.340) (-310.340) (-307.126) [-307.141] -- 0:00:24
      586500 -- [-309.383] (-310.667) (-308.373) (-310.978) * (-312.576) (-309.935) (-309.981) [-308.879] -- 0:00:24
      587000 -- (-309.047) [-307.972] (-309.039) (-311.721) * (-308.358) (-310.571) (-309.232) [-315.851] -- 0:00:24
      587500 -- (-310.220) (-308.608) [-308.992] (-312.817) * [-311.272] (-309.150) (-307.912) (-308.129) -- 0:00:24
      588000 -- (-308.252) (-308.277) (-307.193) [-310.675] * (-307.852) (-307.727) [-310.849] (-306.844) -- 0:00:24
      588500 -- [-306.792] (-308.959) (-308.360) (-308.582) * (-308.578) (-308.482) (-308.593) [-307.581] -- 0:00:24
      589000 -- (-306.886) (-307.682) [-310.842] (-308.449) * (-308.127) [-307.792] (-309.938) (-309.323) -- 0:00:24
      589500 -- (-307.897) (-310.557) [-308.852] (-309.670) * (-308.075) (-309.640) (-312.272) [-307.327] -- 0:00:24
      590000 -- [-306.637] (-308.239) (-307.138) (-307.577) * (-308.980) (-310.182) (-308.509) [-308.736] -- 0:00:24

      Average standard deviation of split frequencies: 0.010625

      590500 -- [-308.852] (-309.190) (-307.336) (-311.951) * (-308.852) (-309.789) [-306.801] (-307.945) -- 0:00:24
      591000 -- (-306.907) (-311.575) [-308.166] (-309.351) * (-311.936) (-308.577) [-308.147] (-312.468) -- 0:00:24
      591500 -- [-311.234] (-311.384) (-307.715) (-310.582) * [-310.419] (-308.113) (-307.650) (-308.989) -- 0:00:24
      592000 -- (-309.102) [-307.819] (-311.831) (-308.778) * (-312.305) (-316.184) (-308.473) [-307.141] -- 0:00:24
      592500 -- (-309.503) (-309.419) (-306.997) [-308.277] * (-309.066) [-309.773] (-311.705) (-312.165) -- 0:00:24
      593000 -- (-307.618) (-307.986) [-308.620] (-307.706) * [-310.462] (-311.356) (-310.573) (-309.556) -- 0:00:24
      593500 -- (-307.656) (-307.103) (-308.307) [-311.638] * (-311.967) [-308.827] (-310.573) (-309.518) -- 0:00:23
      594000 -- (-310.607) [-308.919] (-307.113) (-308.515) * (-308.869) (-309.662) (-311.872) [-314.549] -- 0:00:23
      594500 -- (-317.503) (-309.418) [-306.589] (-309.502) * (-314.267) [-308.942] (-307.484) (-309.214) -- 0:00:24
      595000 -- (-306.875) [-310.399] (-306.533) (-308.586) * (-309.760) (-306.870) [-311.130] (-308.860) -- 0:00:24

      Average standard deviation of split frequencies: 0.010233

      595500 -- (-309.926) [-307.196] (-308.722) (-309.516) * (-308.354) (-307.050) [-309.837] (-312.255) -- 0:00:24
      596000 -- (-307.734) (-308.226) (-307.710) [-308.045] * (-308.152) (-312.301) (-307.727) [-309.374] -- 0:00:24
      596500 -- [-307.389] (-308.823) (-311.372) (-307.724) * (-307.334) (-309.700) (-308.998) [-309.490] -- 0:00:24
      597000 -- [-308.059] (-308.996) (-316.621) (-311.880) * (-308.022) [-307.897] (-310.999) (-308.279) -- 0:00:24
      597500 -- (-307.356) (-308.436) (-309.009) [-310.325] * (-308.976) [-308.617] (-311.863) (-310.550) -- 0:00:24
      598000 -- [-308.507] (-307.052) (-308.792) (-309.056) * (-309.338) [-308.899] (-312.653) (-308.399) -- 0:00:24
      598500 -- (-309.366) (-309.092) [-307.481] (-308.586) * (-308.195) (-307.896) (-308.092) [-308.825] -- 0:00:24
      599000 -- [-309.735] (-307.217) (-320.287) (-308.264) * (-308.389) [-308.215] (-308.537) (-311.063) -- 0:00:24
      599500 -- (-307.690) (-307.540) (-318.319) [-314.255] * [-311.530] (-308.635) (-307.637) (-309.172) -- 0:00:24
      600000 -- (-308.554) (-310.977) [-307.055] (-311.858) * [-307.474] (-307.752) (-308.542) (-309.540) -- 0:00:24

      Average standard deviation of split frequencies: 0.010448

      600500 -- (-308.652) (-308.769) (-306.653) [-308.012] * [-308.679] (-308.004) (-309.122) (-310.896) -- 0:00:23
      601000 -- (-307.769) [-307.767] (-307.361) (-313.507) * (-309.930) (-306.826) (-308.426) [-312.316] -- 0:00:23
      601500 -- (-308.059) (-307.366) [-311.352] (-307.883) * [-307.341] (-308.848) (-308.130) (-311.205) -- 0:00:23
      602000 -- [-306.896] (-308.956) (-309.527) (-309.902) * (-308.616) [-309.879] (-307.554) (-309.536) -- 0:00:23
      602500 -- (-312.421) (-314.290) [-307.891] (-307.013) * (-308.918) (-308.255) [-308.184] (-310.892) -- 0:00:23
      603000 -- (-308.431) (-315.997) (-310.302) [-309.531] * [-310.504] (-308.315) (-309.064) (-313.253) -- 0:00:23
      603500 -- [-308.256] (-307.825) (-310.505) (-308.103) * (-310.559) (-311.339) (-307.286) [-308.928] -- 0:00:23
      604000 -- (-306.736) (-310.718) [-309.623] (-306.841) * [-306.866] (-310.913) (-307.593) (-310.087) -- 0:00:23
      604500 -- [-307.181] (-307.394) (-311.184) (-308.606) * (-309.232) (-307.595) [-307.255] (-311.494) -- 0:00:23
      605000 -- [-309.149] (-309.672) (-309.961) (-308.386) * [-308.623] (-309.633) (-307.894) (-308.303) -- 0:00:23

      Average standard deviation of split frequencies: 0.010502

      605500 -- (-306.661) (-312.037) (-307.024) [-306.519] * (-307.310) (-309.867) (-308.806) [-309.703] -- 0:00:23
      606000 -- (-313.161) (-309.520) (-307.260) [-308.225] * (-307.874) [-306.577] (-310.477) (-307.864) -- 0:00:23
      606500 -- (-309.090) (-308.597) (-307.021) [-307.147] * (-307.144) (-306.946) [-309.274] (-307.901) -- 0:00:23
      607000 -- (-307.389) (-310.855) [-306.505] (-307.393) * (-308.025) [-310.604] (-307.453) (-308.764) -- 0:00:23
      607500 -- [-308.277] (-311.481) (-307.222) (-314.529) * [-310.747] (-308.362) (-307.377) (-307.845) -- 0:00:23
      608000 -- [-308.092] (-309.651) (-309.513) (-307.140) * (-312.856) [-306.785] (-306.664) (-309.042) -- 0:00:23
      608500 -- [-307.640] (-310.028) (-308.241) (-307.987) * (-310.937) [-306.765] (-310.785) (-308.540) -- 0:00:23
      609000 -- (-310.513) [-308.634] (-308.290) (-308.972) * (-308.400) (-310.363) [-307.795] (-308.115) -- 0:00:23
      609500 -- (-312.246) (-307.325) (-307.911) [-308.752] * [-307.299] (-312.079) (-309.402) (-308.207) -- 0:00:23
      610000 -- (-311.109) [-308.306] (-309.894) (-310.115) * [-307.544] (-309.983) (-307.273) (-308.835) -- 0:00:23

      Average standard deviation of split frequencies: 0.010952

      610500 -- (-307.128) (-312.263) [-311.812] (-310.670) * (-309.153) (-307.334) [-306.499] (-309.408) -- 0:00:22
      611000 -- [-308.693] (-308.994) (-309.228) (-307.356) * (-309.822) (-307.567) (-309.335) [-312.453] -- 0:00:22
      611500 -- [-309.253] (-309.907) (-308.075) (-308.805) * (-309.547) [-308.458] (-309.518) (-309.520) -- 0:00:23
      612000 -- [-308.114] (-308.211) (-307.457) (-308.218) * (-310.903) (-308.956) (-309.583) [-307.211] -- 0:00:23
      612500 -- [-308.911] (-306.933) (-311.148) (-308.808) * [-307.098] (-310.612) (-308.695) (-308.288) -- 0:00:23
      613000 -- (-306.924) [-307.297] (-314.925) (-309.152) * (-311.090) (-307.584) (-307.708) [-310.253] -- 0:00:23
      613500 -- [-310.454] (-306.815) (-309.685) (-307.084) * [-311.636] (-308.046) (-307.189) (-307.989) -- 0:00:23
      614000 -- (-309.704) (-308.447) [-307.462] (-307.995) * [-309.937] (-308.447) (-311.106) (-313.485) -- 0:00:23
      614500 -- [-311.989] (-308.879) (-309.211) (-307.843) * (-310.160) (-308.223) [-308.286] (-309.871) -- 0:00:23
      615000 -- (-309.280) (-309.511) (-307.562) [-307.817] * (-308.575) (-309.169) (-310.162) [-307.652] -- 0:00:23

      Average standard deviation of split frequencies: 0.011383

      615500 -- [-307.529] (-307.050) (-308.340) (-307.597) * (-308.128) (-307.345) (-308.866) [-310.211] -- 0:00:23
      616000 -- (-306.437) [-310.781] (-309.070) (-307.775) * (-307.472) (-309.273) [-307.208] (-309.483) -- 0:00:23
      616500 -- (-307.415) (-307.881) [-307.095] (-306.593) * [-307.960] (-309.370) (-308.539) (-306.703) -- 0:00:23
      617000 -- (-309.456) (-308.706) (-308.369) [-308.839] * [-308.234] (-308.617) (-310.213) (-308.702) -- 0:00:22
      617500 -- (-307.761) (-308.277) (-309.090) [-310.157] * (-311.494) (-307.382) (-307.631) [-308.765] -- 0:00:22
      618000 -- (-309.265) (-306.329) [-308.430] (-308.067) * (-307.699) (-308.768) (-308.673) [-308.013] -- 0:00:22
      618500 -- (-307.928) (-308.868) (-308.138) [-310.406] * (-309.929) [-309.220] (-313.272) (-309.777) -- 0:00:22
      619000 -- (-307.824) (-315.014) [-307.563] (-308.739) * (-309.393) [-306.899] (-308.714) (-310.268) -- 0:00:22
      619500 -- (-307.933) (-309.917) [-309.166] (-309.415) * [-308.812] (-310.830) (-308.678) (-312.539) -- 0:00:22
      620000 -- [-308.959] (-307.215) (-309.886) (-308.639) * (-307.916) (-308.342) [-309.100] (-313.018) -- 0:00:22

      Average standard deviation of split frequencies: 0.011060

      620500 -- (-307.892) (-307.440) (-308.789) [-308.758] * (-307.399) (-307.427) (-311.753) [-306.992] -- 0:00:22
      621000 -- (-313.416) [-309.523] (-312.349) (-308.740) * (-308.128) (-307.667) [-309.820] (-308.916) -- 0:00:22
      621500 -- (-310.432) (-311.344) [-308.320] (-311.921) * [-306.738] (-311.726) (-309.189) (-307.988) -- 0:00:22
      622000 -- (-309.012) (-308.018) [-307.899] (-310.002) * [-307.788] (-309.236) (-307.951) (-308.349) -- 0:00:22
      622500 -- (-309.262) [-308.478] (-306.674) (-310.436) * (-306.573) [-307.478] (-306.926) (-309.974) -- 0:00:22
      623000 -- [-308.443] (-309.280) (-308.115) (-311.149) * [-307.313] (-306.911) (-308.412) (-310.905) -- 0:00:22
      623500 -- (-312.262) [-307.073] (-309.443) (-307.667) * [-310.366] (-309.177) (-310.460) (-310.037) -- 0:00:22
      624000 -- (-308.729) (-307.975) [-307.541] (-309.943) * [-308.751] (-308.069) (-307.804) (-311.236) -- 0:00:22
      624500 -- [-307.456] (-309.108) (-311.555) (-308.813) * (-307.350) [-308.563] (-308.090) (-308.959) -- 0:00:22
      625000 -- (-308.151) [-310.698] (-311.012) (-310.456) * (-309.490) (-309.241) [-307.868] (-311.804) -- 0:00:22

      Average standard deviation of split frequencies: 0.010543

      625500 -- [-312.695] (-308.852) (-314.858) (-311.020) * (-308.447) [-308.483] (-311.068) (-306.958) -- 0:00:22
      626000 -- (-310.782) (-309.322) (-310.291) [-310.099] * (-309.036) [-308.219] (-311.033) (-310.924) -- 0:00:22
      626500 -- (-307.621) (-307.950) (-309.153) [-311.259] * (-309.906) [-310.948] (-307.474) (-309.028) -- 0:00:22
      627000 -- [-308.059] (-310.948) (-309.608) (-309.970) * (-308.896) [-306.556] (-306.671) (-309.880) -- 0:00:22
      627500 -- (-308.514) [-308.753] (-308.629) (-307.444) * (-308.613) (-306.614) [-310.542] (-310.981) -- 0:00:21
      628000 -- (-309.375) (-308.053) [-307.333] (-306.718) * (-310.301) (-307.900) (-307.555) [-308.274] -- 0:00:21
      628500 -- (-309.873) (-308.243) (-307.743) [-309.482] * [-308.348] (-309.187) (-308.972) (-307.611) -- 0:00:22
      629000 -- (-308.290) (-309.377) (-306.933) [-306.630] * (-307.623) (-307.355) [-310.628] (-310.293) -- 0:00:22
      629500 -- (-307.986) [-307.798] (-308.159) (-309.349) * (-309.149) [-308.566] (-309.001) (-310.409) -- 0:00:22
      630000 -- [-307.764] (-310.173) (-308.023) (-307.854) * (-308.506) (-307.693) (-307.743) [-307.843] -- 0:00:22

      Average standard deviation of split frequencies: 0.010511

      630500 -- [-309.121] (-309.298) (-310.986) (-308.570) * (-306.676) (-309.720) (-307.626) [-311.394] -- 0:00:22
      631000 -- (-307.008) (-309.548) [-310.086] (-308.260) * (-307.731) [-311.845] (-307.501) (-310.962) -- 0:00:22
      631500 -- (-308.463) [-311.643] (-306.862) (-312.037) * (-309.872) [-307.302] (-306.622) (-308.140) -- 0:00:22
      632000 -- [-306.779] (-311.188) (-309.283) (-308.230) * (-309.636) (-308.982) (-307.458) [-310.521] -- 0:00:22
      632500 -- (-309.513) (-306.844) (-306.875) [-307.538] * (-308.106) (-309.994) (-307.450) [-313.707] -- 0:00:22
      633000 -- (-307.047) [-307.616] (-313.908) (-307.892) * [-307.187] (-310.877) (-307.125) (-307.114) -- 0:00:22
      633500 -- [-308.349] (-308.262) (-308.633) (-307.335) * (-308.198) (-308.324) (-308.289) [-308.365] -- 0:00:21
      634000 -- (-308.629) [-306.552] (-307.596) (-306.841) * [-307.755] (-309.759) (-308.422) (-308.581) -- 0:00:21
      634500 -- (-307.388) (-307.934) [-307.396] (-308.608) * (-308.873) (-308.532) [-308.865] (-307.324) -- 0:00:21
      635000 -- (-310.417) (-309.758) (-309.437) [-308.005] * [-307.223] (-311.987) (-308.680) (-308.750) -- 0:00:21

      Average standard deviation of split frequencies: 0.010238

      635500 -- [-311.573] (-309.034) (-309.067) (-308.396) * (-309.233) (-310.016) [-315.883] (-306.474) -- 0:00:21
      636000 -- (-307.246) (-307.891) [-307.766] (-307.629) * (-308.730) (-309.465) (-309.157) [-306.746] -- 0:00:21
      636500 -- (-307.345) (-308.387) [-307.781] (-310.843) * (-309.392) (-309.296) (-307.054) [-309.813] -- 0:00:21
      637000 -- (-307.732) (-308.344) (-307.694) [-309.051] * (-308.246) [-311.153] (-309.791) (-309.776) -- 0:00:21
      637500 -- (-308.603) [-310.253] (-308.218) (-312.789) * (-312.113) [-306.974] (-310.775) (-308.799) -- 0:00:21
      638000 -- (-308.344) [-311.312] (-308.260) (-311.038) * [-306.734] (-307.839) (-308.195) (-308.669) -- 0:00:21
      638500 -- [-307.255] (-313.789) (-308.653) (-307.892) * (-309.512) [-307.120] (-313.005) (-310.880) -- 0:00:21
      639000 -- (-307.434) (-308.534) [-308.450] (-307.158) * (-307.843) [-308.043] (-308.675) (-309.142) -- 0:00:21
      639500 -- (-310.689) [-308.803] (-310.769) (-310.265) * (-306.769) [-313.006] (-311.192) (-309.231) -- 0:00:21
      640000 -- (-309.152) [-307.545] (-308.077) (-308.457) * (-311.890) (-307.436) (-307.630) [-307.801] -- 0:00:21

      Average standard deviation of split frequencies: 0.009887

      640500 -- (-311.571) (-306.446) (-309.633) [-308.461] * (-309.109) (-311.298) [-313.555] (-308.749) -- 0:00:21
      641000 -- (-312.383) [-306.707] (-307.665) (-307.193) * (-307.316) (-307.674) (-307.090) [-309.863] -- 0:00:21
      641500 -- (-308.977) (-306.710) (-308.646) [-307.091] * (-310.807) (-307.823) (-310.729) [-307.872] -- 0:00:21
      642000 -- (-307.007) [-308.978] (-307.755) (-308.655) * [-308.011] (-309.914) (-311.443) (-310.630) -- 0:00:21
      642500 -- [-307.769] (-309.543) (-307.974) (-308.052) * (-309.057) (-306.944) (-311.250) [-307.600] -- 0:00:21
      643000 -- (-308.566) (-311.520) [-307.772] (-307.751) * (-311.277) (-307.040) [-307.996] (-307.196) -- 0:00:21
      643500 -- (-308.744) [-306.926] (-306.879) (-306.904) * (-308.687) [-307.747] (-309.504) (-308.144) -- 0:00:21
      644000 -- (-312.339) (-307.229) [-307.571] (-306.586) * (-314.196) (-307.487) [-307.122] (-308.237) -- 0:00:21
      644500 -- (-310.842) (-309.095) [-308.458] (-310.343) * (-309.312) (-311.592) (-308.193) [-310.635] -- 0:00:20
      645000 -- (-308.116) [-306.587] (-306.656) (-309.266) * (-308.673) (-306.723) [-309.799] (-310.157) -- 0:00:20

      Average standard deviation of split frequencies: 0.009669

      645500 -- (-308.556) (-307.456) (-310.749) [-307.968] * (-308.533) (-309.169) [-307.771] (-311.803) -- 0:00:21
      646000 -- (-307.387) [-308.645] (-309.028) (-310.094) * [-307.002] (-320.063) (-311.639) (-311.981) -- 0:00:21
      646500 -- (-310.354) (-309.066) (-309.370) [-309.709] * (-307.584) [-309.887] (-308.100) (-309.911) -- 0:00:21
      647000 -- (-309.658) (-309.150) [-307.628] (-309.306) * (-308.326) (-309.591) (-312.606) [-308.221] -- 0:00:21
      647500 -- (-309.004) [-306.814] (-308.925) (-311.228) * (-309.914) [-310.085] (-308.378) (-307.359) -- 0:00:21
      648000 -- [-307.422] (-310.549) (-312.362) (-313.095) * (-307.223) (-306.876) (-309.643) [-308.622] -- 0:00:21
      648500 -- (-308.843) [-307.635] (-310.857) (-310.253) * (-307.360) (-307.912) (-308.641) [-309.537] -- 0:00:21
      649000 -- [-306.857] (-307.404) (-310.248) (-312.563) * (-309.371) (-307.377) [-308.599] (-307.166) -- 0:00:21
      649500 -- (-310.483) [-308.239] (-310.281) (-310.828) * [-307.590] (-306.538) (-308.093) (-310.799) -- 0:00:21
      650000 -- (-308.296) (-309.597) (-308.804) [-307.213] * (-307.516) (-311.802) [-311.108] (-308.825) -- 0:00:21

      Average standard deviation of split frequencies: 0.009735

      650500 -- [-310.001] (-306.509) (-308.432) (-307.629) * [-308.164] (-311.292) (-308.086) (-308.901) -- 0:00:20
      651000 -- (-309.050) (-307.053) (-310.024) [-307.041] * (-310.378) (-307.344) (-308.221) [-307.029] -- 0:00:20
      651500 -- [-310.008] (-306.960) (-314.511) (-309.247) * (-309.715) (-307.659) [-307.388] (-308.524) -- 0:00:20
      652000 -- (-307.194) [-311.637] (-308.286) (-309.688) * [-310.563] (-308.822) (-310.969) (-308.692) -- 0:00:20
      652500 -- (-310.785) [-307.436] (-314.692) (-308.074) * [-309.518] (-308.464) (-307.573) (-310.587) -- 0:00:20
      653000 -- (-314.274) (-307.303) (-310.690) [-309.833] * [-309.825] (-311.056) (-307.255) (-312.692) -- 0:00:20
      653500 -- (-313.484) [-308.071] (-310.139) (-311.068) * (-309.147) (-308.531) (-312.954) [-309.409] -- 0:00:20
      654000 -- (-309.191) (-307.742) (-313.160) [-309.445] * (-311.398) (-309.198) (-311.797) [-309.115] -- 0:00:20
      654500 -- (-307.528) (-308.043) [-312.652] (-308.029) * (-308.036) (-306.964) (-309.092) [-310.729] -- 0:00:20
      655000 -- (-308.636) (-309.426) (-308.863) [-308.161] * (-309.330) (-314.934) [-310.574] (-311.976) -- 0:00:20

      Average standard deviation of split frequencies: 0.010060

      655500 -- (-307.523) [-311.834] (-307.178) (-306.986) * [-309.508] (-307.214) (-312.948) (-312.279) -- 0:00:20
      656000 -- (-309.493) (-307.098) (-308.438) [-308.014] * (-309.655) [-306.755] (-309.402) (-307.541) -- 0:00:20
      656500 -- [-308.075] (-308.065) (-311.412) (-308.816) * (-307.371) (-307.032) [-308.706] (-310.242) -- 0:00:20
      657000 -- (-309.020) (-308.261) (-309.034) [-309.831] * (-309.970) (-308.270) [-307.906] (-307.946) -- 0:00:20
      657500 -- (-312.129) (-314.903) [-306.522] (-308.775) * (-311.306) (-308.138) [-309.549] (-308.047) -- 0:00:20
      658000 -- (-310.649) [-311.108] (-307.190) (-307.792) * (-309.424) [-308.898] (-307.894) (-309.647) -- 0:00:20
      658500 -- (-307.574) [-309.731] (-309.465) (-310.219) * (-308.979) (-309.336) [-308.371] (-310.585) -- 0:00:20
      659000 -- (-307.678) (-310.577) [-309.859] (-309.344) * (-308.535) [-307.532] (-307.519) (-308.680) -- 0:00:20
      659500 -- (-307.711) [-307.931] (-308.251) (-313.490) * [-308.246] (-308.910) (-307.851) (-308.484) -- 0:00:20
      660000 -- (-308.592) (-308.745) [-309.208] (-308.460) * (-308.071) [-307.662] (-311.937) (-309.318) -- 0:00:20

      Average standard deviation of split frequencies: 0.010614

      660500 -- (-308.654) (-308.303) (-307.160) [-308.403] * [-309.434] (-306.397) (-309.830) (-307.809) -- 0:00:20
      661000 -- (-310.688) (-310.561) (-308.433) [-309.236] * (-307.508) (-309.556) (-314.058) [-308.345] -- 0:00:20
      661500 -- [-307.060] (-308.473) (-309.909) (-309.224) * (-309.670) [-307.075] (-307.647) (-308.774) -- 0:00:19
      662000 -- (-308.687) (-310.610) [-309.890] (-307.398) * [-307.146] (-311.542) (-308.482) (-309.244) -- 0:00:19
      662500 -- (-309.354) [-310.148] (-314.586) (-308.443) * (-308.684) (-313.925) (-314.330) [-310.816] -- 0:00:20
      663000 -- (-308.385) [-308.955] (-308.840) (-308.749) * [-306.686] (-309.119) (-309.692) (-311.256) -- 0:00:20
      663500 -- [-311.137] (-309.495) (-308.267) (-311.281) * [-309.904] (-310.893) (-312.088) (-307.535) -- 0:00:20
      664000 -- (-307.258) (-309.489) (-308.137) [-312.137] * (-310.843) [-309.595] (-309.766) (-314.551) -- 0:00:20
      664500 -- [-307.158] (-311.518) (-311.271) (-307.954) * (-306.753) (-307.210) (-308.648) [-307.975] -- 0:00:20
      665000 -- (-308.056) (-312.084) [-306.982] (-311.975) * (-308.417) (-307.005) [-307.244] (-308.328) -- 0:00:20

      Average standard deviation of split frequencies: 0.010352

      665500 -- (-310.481) (-311.946) (-307.487) [-309.115] * (-310.635) [-309.552] (-308.927) (-307.227) -- 0:00:20
      666000 -- (-307.879) [-307.211] (-309.574) (-307.003) * [-307.565] (-307.640) (-306.940) (-309.098) -- 0:00:20
      666500 -- (-312.389) (-309.533) (-308.480) [-308.124] * (-307.712) (-308.560) [-308.767] (-307.408) -- 0:00:20
      667000 -- [-311.262] (-312.680) (-309.734) (-307.985) * (-307.449) [-310.081] (-310.891) (-308.546) -- 0:00:19
      667500 -- (-309.650) (-308.011) [-309.572] (-307.186) * (-308.903) [-309.861] (-309.085) (-310.274) -- 0:00:19
      668000 -- (-306.522) (-308.550) (-312.794) [-307.243] * [-307.378] (-309.416) (-308.380) (-308.675) -- 0:00:19
      668500 -- (-306.759) [-311.414] (-307.958) (-309.454) * (-309.852) (-309.096) (-307.073) [-308.731] -- 0:00:19
      669000 -- (-306.886) (-310.157) [-307.816] (-307.603) * (-309.225) (-308.919) [-309.298] (-310.884) -- 0:00:19
      669500 -- [-309.152] (-307.763) (-307.968) (-308.254) * (-308.979) (-309.627) (-308.439) [-310.123] -- 0:00:19
      670000 -- (-308.043) (-307.747) [-311.650] (-307.181) * (-308.232) (-312.062) (-308.209) [-309.260] -- 0:00:19

      Average standard deviation of split frequencies: 0.010280

      670500 -- (-307.943) [-310.193] (-312.674) (-309.284) * (-309.335) (-308.080) [-310.010] (-308.182) -- 0:00:19
      671000 -- [-310.521] (-308.213) (-311.957) (-311.089) * (-307.741) (-308.227) (-312.182) [-306.940] -- 0:00:19
      671500 -- (-311.374) [-308.552] (-307.952) (-308.178) * (-309.783) (-309.383) [-308.942] (-308.431) -- 0:00:19
      672000 -- (-309.092) [-308.019] (-308.338) (-311.255) * (-308.812) (-310.508) (-308.425) [-307.884] -- 0:00:19
      672500 -- (-308.553) (-308.288) (-309.144) [-308.122] * (-308.190) (-308.436) (-307.533) [-307.129] -- 0:00:19
      673000 -- (-306.961) (-308.039) [-308.489] (-307.469) * (-310.573) [-307.382] (-308.350) (-308.430) -- 0:00:19
      673500 -- (-307.876) (-309.076) (-308.573) [-309.195] * (-310.653) [-308.363] (-308.853) (-310.361) -- 0:00:19
      674000 -- [-309.634] (-309.185) (-307.756) (-310.196) * [-313.477] (-308.900) (-313.826) (-309.569) -- 0:00:19
      674500 -- (-309.987) (-307.962) [-307.856] (-310.856) * (-309.741) [-311.283] (-311.565) (-306.586) -- 0:00:19
      675000 -- [-308.141] (-307.229) (-307.958) (-312.250) * (-311.159) [-308.312] (-308.658) (-309.310) -- 0:00:19

      Average standard deviation of split frequencies: 0.010373

      675500 -- (-307.646) (-309.236) [-307.483] (-308.913) * (-310.792) [-308.247] (-307.773) (-309.490) -- 0:00:19
      676000 -- (-308.337) [-310.474] (-310.821) (-308.729) * (-306.507) (-309.691) (-309.319) [-310.731] -- 0:00:19
      676500 -- [-307.556] (-310.117) (-313.182) (-307.999) * (-306.703) (-308.600) (-307.312) [-308.599] -- 0:00:19
      677000 -- (-308.179) (-310.097) [-309.198] (-308.803) * (-307.017) (-308.610) (-311.860) [-307.406] -- 0:00:19
      677500 -- (-310.777) (-309.444) [-306.943] (-314.831) * (-307.453) (-310.746) [-306.873] (-310.913) -- 0:00:19
      678000 -- (-309.846) (-307.228) (-307.796) [-308.679] * (-309.989) (-310.986) [-306.899] (-309.484) -- 0:00:18
      678500 -- (-308.625) (-308.595) [-306.778] (-312.363) * (-310.571) (-309.407) (-308.259) [-308.786] -- 0:00:18
      679000 -- (-308.707) [-308.808] (-311.177) (-310.448) * (-309.974) [-306.817] (-307.533) (-308.470) -- 0:00:18
      679500 -- [-311.021] (-312.254) (-306.574) (-307.641) * (-309.186) [-313.309] (-307.034) (-313.027) -- 0:00:19
      680000 -- (-308.307) [-307.413] (-306.781) (-306.866) * [-309.000] (-310.578) (-307.550) (-314.079) -- 0:00:19

      Average standard deviation of split frequencies: 0.010042

      680500 -- (-307.022) (-307.870) [-306.641] (-310.228) * (-308.335) [-309.321] (-309.198) (-308.622) -- 0:00:19
      681000 -- (-308.920) (-313.483) [-306.580] (-311.433) * [-311.492] (-307.962) (-307.740) (-310.318) -- 0:00:19
      681500 -- [-307.158] (-311.164) (-308.867) (-308.368) * [-307.606] (-308.513) (-308.628) (-307.516) -- 0:00:19
      682000 -- (-308.560) (-307.744) [-306.730] (-309.966) * (-308.214) [-309.852] (-308.038) (-307.313) -- 0:00:19
      682500 -- (-307.521) [-310.851] (-309.109) (-308.582) * (-308.376) (-309.486) (-308.189) [-308.231] -- 0:00:19
      683000 -- (-307.678) [-308.721] (-307.177) (-308.707) * (-309.564) (-309.521) [-309.125] (-309.874) -- 0:00:19
      683500 -- (-307.987) [-308.439] (-307.794) (-307.689) * (-311.119) (-309.860) (-307.894) [-309.520] -- 0:00:18
      684000 -- (-307.418) (-308.291) [-310.387] (-310.403) * (-309.304) (-306.951) [-308.376] (-311.126) -- 0:00:18
      684500 -- (-307.582) (-309.862) (-311.847) [-308.051] * (-308.499) [-306.887] (-306.894) (-309.560) -- 0:00:18
      685000 -- (-309.359) (-310.065) (-308.340) [-307.569] * (-312.627) (-306.888) [-307.847] (-310.773) -- 0:00:18

      Average standard deviation of split frequencies: 0.010007

      685500 -- (-311.747) (-308.755) (-309.445) [-308.180] * (-309.140) [-307.938] (-307.174) (-312.947) -- 0:00:18
      686000 -- (-307.243) (-310.646) [-307.669] (-309.855) * (-309.777) (-307.573) (-308.196) [-309.420] -- 0:00:18
      686500 -- [-310.367] (-307.860) (-310.615) (-312.413) * (-310.605) [-307.579] (-307.574) (-312.991) -- 0:00:18
      687000 -- (-311.269) (-314.275) [-309.086] (-309.003) * (-310.169) [-309.217] (-307.601) (-308.374) -- 0:00:18
      687500 -- (-309.798) [-308.668] (-309.295) (-306.404) * (-309.394) (-306.748) (-309.231) [-308.562] -- 0:00:18
      688000 -- (-309.464) (-308.268) (-309.520) [-308.598] * (-309.805) (-308.213) [-308.381] (-309.168) -- 0:00:18
      688500 -- (-313.142) [-309.325] (-309.510) (-310.023) * (-311.276) (-310.121) (-307.904) [-309.555] -- 0:00:18
      689000 -- (-307.313) [-308.797] (-307.193) (-309.688) * (-308.717) [-307.379] (-307.877) (-313.051) -- 0:00:18
      689500 -- (-311.594) (-311.305) [-308.166] (-308.681) * (-308.728) [-308.567] (-310.044) (-308.978) -- 0:00:18
      690000 -- (-310.669) (-307.549) (-308.954) [-309.253] * (-309.541) [-308.381] (-312.818) (-311.583) -- 0:00:18

      Average standard deviation of split frequencies: 0.009811

      690500 -- [-309.197] (-309.457) (-307.920) (-306.760) * (-311.407) (-307.565) [-313.328] (-307.986) -- 0:00:18
      691000 -- (-310.957) (-306.522) [-311.227] (-308.108) * [-309.614] (-310.323) (-307.136) (-309.823) -- 0:00:18
      691500 -- (-309.064) (-309.243) (-309.630) [-307.306] * (-308.587) (-309.304) [-308.480] (-309.949) -- 0:00:18
      692000 -- (-308.828) [-311.692] (-308.957) (-308.190) * [-308.026] (-306.841) (-309.881) (-310.372) -- 0:00:18
      692500 -- (-307.830) (-309.075) [-310.366] (-306.968) * (-308.872) [-307.805] (-317.894) (-309.451) -- 0:00:18
      693000 -- [-311.049] (-307.653) (-309.343) (-308.287) * (-308.248) (-306.742) [-306.871] (-309.389) -- 0:00:18
      693500 -- (-309.050) (-306.660) (-309.355) [-307.120] * (-308.068) [-306.475] (-307.411) (-309.159) -- 0:00:18
      694000 -- (-307.888) [-306.648] (-311.596) (-310.958) * (-307.459) (-309.891) [-308.558] (-310.703) -- 0:00:18
      694500 -- (-312.185) [-307.966] (-309.900) (-307.616) * (-310.334) (-308.639) (-307.205) [-310.538] -- 0:00:18
      695000 -- (-311.511) (-309.023) [-306.762] (-310.548) * (-309.057) (-307.877) [-307.112] (-316.862) -- 0:00:17

      Average standard deviation of split frequencies: 0.009990

      695500 -- (-307.716) [-309.113] (-306.768) (-312.195) * [-308.695] (-308.557) (-310.116) (-308.405) -- 0:00:17
      696000 -- (-308.764) (-308.870) [-306.448] (-313.227) * [-307.684] (-309.288) (-307.111) (-308.694) -- 0:00:17
      696500 -- (-309.387) (-308.478) (-307.320) [-307.642] * [-308.168] (-308.027) (-308.287) (-309.689) -- 0:00:18
      697000 -- (-307.367) (-307.995) [-307.743] (-307.234) * (-308.692) (-309.049) (-309.154) [-311.595] -- 0:00:18
      697500 -- (-307.337) [-308.217] (-308.126) (-307.748) * [-310.224] (-307.687) (-310.174) (-308.255) -- 0:00:18
      698000 -- (-316.095) [-310.053] (-309.610) (-307.764) * (-307.919) (-308.756) (-306.970) [-308.848] -- 0:00:18
      698500 -- (-314.853) (-307.408) [-307.013] (-312.010) * (-309.602) (-307.719) [-306.615] (-308.054) -- 0:00:18
      699000 -- (-309.004) (-306.909) (-306.550) [-309.600] * (-307.718) (-309.493) (-308.387) [-310.716] -- 0:00:18
      699500 -- [-307.434] (-310.176) (-308.361) (-311.668) * (-306.978) [-307.551] (-307.085) (-307.919) -- 0:00:18
      700000 -- (-308.914) (-308.884) [-313.200] (-308.559) * (-309.029) (-306.994) [-307.163] (-309.488) -- 0:00:18

      Average standard deviation of split frequencies: 0.010218

      700500 -- (-311.917) [-307.499] (-306.783) (-309.664) * (-308.332) (-310.856) (-307.538) [-308.856] -- 0:00:17
      701000 -- (-307.698) [-312.924] (-308.048) (-311.060) * [-307.076] (-310.676) (-310.442) (-309.789) -- 0:00:17
      701500 -- (-306.989) (-308.025) (-308.157) [-307.969] * [-308.649] (-307.952) (-310.993) (-307.486) -- 0:00:17
      702000 -- (-308.319) (-312.539) [-308.199] (-307.607) * (-306.497) (-307.625) [-306.855] (-307.293) -- 0:00:17
      702500 -- (-308.869) (-308.014) (-308.908) [-307.605] * (-307.475) [-308.355] (-307.417) (-308.015) -- 0:00:17
      703000 -- [-307.636] (-307.758) (-309.738) (-310.040) * (-307.573) [-308.121] (-313.722) (-307.729) -- 0:00:17
      703500 -- (-307.066) [-307.149] (-307.439) (-310.294) * (-307.587) [-307.308] (-308.205) (-310.887) -- 0:00:17
      704000 -- [-311.166] (-311.389) (-311.220) (-308.388) * (-310.152) (-307.455) [-307.468] (-307.407) -- 0:00:17
      704500 -- (-312.717) (-309.222) (-310.692) [-309.525] * (-308.254) (-310.530) [-307.154] (-310.035) -- 0:00:17
      705000 -- (-308.890) (-306.641) (-307.382) [-307.574] * (-307.415) [-311.122] (-308.193) (-308.420) -- 0:00:17

      Average standard deviation of split frequencies: 0.010141

      705500 -- (-317.765) [-307.223] (-310.700) (-307.687) * [-307.620] (-308.606) (-308.537) (-307.299) -- 0:00:17
      706000 -- (-311.623) [-309.485] (-312.790) (-307.498) * (-307.810) (-310.408) (-308.263) [-309.714] -- 0:00:17
      706500 -- (-308.656) [-314.094] (-309.836) (-311.814) * (-308.422) (-307.679) (-311.012) [-309.896] -- 0:00:17
      707000 -- (-308.729) (-308.336) (-307.925) [-309.821] * (-308.699) (-307.475) (-307.619) [-307.961] -- 0:00:17
      707500 -- [-306.941] (-307.387) (-309.771) (-307.627) * (-307.324) (-307.421) [-309.570] (-310.625) -- 0:00:17
      708000 -- (-307.861) (-307.997) (-307.213) [-309.493] * [-308.270] (-307.871) (-313.195) (-307.079) -- 0:00:17
      708500 -- (-313.217) (-310.237) (-312.815) [-308.757] * (-307.577) (-310.249) [-313.499] (-308.497) -- 0:00:17
      709000 -- (-309.327) [-309.058] (-309.335) (-307.653) * (-306.886) (-311.929) (-310.150) [-311.129] -- 0:00:17
      709500 -- (-307.813) (-308.818) [-309.568] (-308.212) * (-306.880) (-312.754) [-309.406] (-312.221) -- 0:00:17
      710000 -- (-310.601) [-308.650] (-311.581) (-307.480) * (-309.746) (-307.970) (-307.964) [-311.313] -- 0:00:17

      Average standard deviation of split frequencies: 0.010447

      710500 -- [-309.747] (-308.314) (-309.197) (-308.813) * (-307.831) (-307.810) (-308.185) [-309.283] -- 0:00:17
      711000 -- [-312.216] (-309.388) (-309.317) (-308.760) * (-307.633) (-308.150) (-307.445) [-309.550] -- 0:00:17
      711500 -- [-309.096] (-310.083) (-308.552) (-310.407) * (-309.158) (-311.588) (-307.887) [-309.421] -- 0:00:17
      712000 -- (-308.131) (-309.011) [-308.803] (-310.222) * [-308.787] (-310.063) (-312.063) (-312.415) -- 0:00:16
      712500 -- [-306.972] (-307.206) (-310.412) (-306.964) * (-308.055) [-307.896] (-307.589) (-307.644) -- 0:00:16
      713000 -- (-308.657) (-309.253) [-306.908] (-308.626) * [-307.744] (-311.288) (-307.069) (-308.206) -- 0:00:16
      713500 -- (-310.857) (-306.543) [-308.944] (-310.417) * (-308.725) (-310.690) (-310.060) [-309.395] -- 0:00:16
      714000 -- (-312.426) (-309.593) [-310.854] (-310.260) * (-307.243) [-306.817] (-311.025) (-308.616) -- 0:00:17
      714500 -- (-311.197) [-312.172] (-309.734) (-309.571) * [-308.096] (-307.404) (-307.151) (-308.897) -- 0:00:17
      715000 -- (-307.862) (-308.598) (-311.169) [-307.553] * (-308.087) (-314.723) [-307.951] (-309.310) -- 0:00:17

      Average standard deviation of split frequencies: 0.010411

      715500 -- (-308.071) (-308.234) (-306.949) [-307.347] * (-307.170) (-313.640) (-309.819) [-307.248] -- 0:00:17
      716000 -- [-308.045] (-309.816) (-309.296) (-306.799) * [-307.528] (-309.980) (-307.047) (-308.127) -- 0:00:17
      716500 -- [-308.671] (-312.300) (-308.827) (-307.307) * [-307.108] (-308.530) (-308.496) (-308.130) -- 0:00:17
      717000 -- [-307.394] (-308.423) (-307.282) (-306.719) * [-309.183] (-307.390) (-307.313) (-307.143) -- 0:00:16
      717500 -- (-306.690) (-307.451) [-306.438] (-308.845) * [-306.883] (-306.938) (-310.749) (-308.130) -- 0:00:16
      718000 -- (-309.604) [-307.507] (-310.222) (-310.037) * (-310.540) (-306.532) [-307.830] (-312.611) -- 0:00:16
      718500 -- (-311.691) (-308.842) [-312.568] (-310.469) * (-307.136) (-306.976) (-308.799) [-309.441] -- 0:00:16
      719000 -- [-309.659] (-307.478) (-316.673) (-307.375) * (-307.754) (-306.737) (-310.055) [-309.253] -- 0:00:16
      719500 -- (-309.210) (-308.811) [-310.822] (-308.870) * (-314.305) [-307.901] (-313.613) (-307.627) -- 0:00:16
      720000 -- (-308.421) [-308.909] (-312.594) (-313.387) * (-308.425) [-307.730] (-313.688) (-308.857) -- 0:00:16

      Average standard deviation of split frequencies: 0.010629

      720500 -- (-307.703) (-307.985) [-308.065] (-309.496) * [-310.971] (-307.055) (-311.569) (-308.778) -- 0:00:16
      721000 -- (-307.718) (-307.053) (-308.396) [-310.844] * (-307.234) [-312.219] (-310.906) (-307.227) -- 0:00:16
      721500 -- (-310.318) [-311.071] (-309.860) (-311.592) * (-310.958) [-306.543] (-309.458) (-307.514) -- 0:00:16
      722000 -- (-307.621) (-311.274) (-309.674) [-308.580] * (-310.556) (-306.618) [-307.617] (-310.779) -- 0:00:16
      722500 -- (-309.128) [-309.126] (-308.394) (-310.752) * [-307.259] (-307.679) (-307.467) (-309.252) -- 0:00:16
      723000 -- [-307.064] (-309.539) (-308.398) (-308.768) * (-311.124) [-307.505] (-308.380) (-310.943) -- 0:00:16
      723500 -- (-313.012) (-307.434) [-309.842] (-308.893) * (-315.127) [-310.537] (-309.378) (-307.151) -- 0:00:16
      724000 -- [-308.282] (-307.850) (-311.727) (-307.628) * (-308.769) [-309.217] (-309.044) (-309.568) -- 0:00:16
      724500 -- (-313.631) (-307.765) (-313.439) [-308.108] * (-309.441) [-307.711] (-309.473) (-309.823) -- 0:00:16
      725000 -- (-308.457) (-308.157) [-309.138] (-308.953) * (-309.616) (-309.904) (-309.022) [-308.279] -- 0:00:16

      Average standard deviation of split frequencies: 0.010024

      725500 -- [-307.192] (-308.322) (-309.801) (-309.241) * (-309.713) (-308.148) (-311.724) [-308.495] -- 0:00:16
      726000 -- (-306.664) (-310.697) (-308.434) [-308.574] * (-311.298) (-308.503) (-308.480) [-307.409] -- 0:00:16
      726500 -- (-311.255) [-308.057] (-308.338) (-307.983) * [-310.316] (-308.270) (-311.228) (-310.639) -- 0:00:16
      727000 -- [-308.450] (-307.116) (-309.574) (-308.019) * (-312.332) (-308.814) [-307.703] (-311.795) -- 0:00:16
      727500 -- (-312.180) [-307.669] (-309.868) (-309.079) * (-307.211) [-309.301] (-308.631) (-310.258) -- 0:00:16
      728000 -- (-308.158) [-307.996] (-307.591) (-306.900) * [-313.191] (-308.003) (-312.793) (-307.875) -- 0:00:16
      728500 -- (-310.307) (-309.235) [-308.124] (-308.024) * [-307.025] (-308.041) (-311.784) (-319.864) -- 0:00:16
      729000 -- (-306.599) (-307.800) [-308.157] (-309.621) * [-307.943] (-308.011) (-309.344) (-314.748) -- 0:00:15
      729500 -- (-307.213) (-307.383) [-307.197] (-312.984) * (-306.815) [-307.088] (-306.861) (-308.347) -- 0:00:15
      730000 -- [-312.586] (-308.069) (-308.225) (-309.692) * [-309.775] (-307.062) (-309.274) (-313.156) -- 0:00:15

      Average standard deviation of split frequencies: 0.010000

      730500 -- (-308.355) [-307.432] (-310.013) (-311.476) * (-308.828) [-311.414] (-310.314) (-309.488) -- 0:00:16
      731000 -- [-308.405] (-308.065) (-307.476) (-312.859) * (-308.045) [-309.116] (-310.585) (-310.601) -- 0:00:16
      731500 -- [-309.125] (-307.474) (-306.739) (-315.095) * (-306.662) (-308.225) [-312.559] (-308.712) -- 0:00:16
      732000 -- (-309.789) (-307.732) [-310.220] (-311.052) * (-307.309) (-307.198) [-312.538] (-309.291) -- 0:00:16
      732500 -- (-312.470) [-309.007] (-310.229) (-310.382) * [-308.177] (-307.711) (-309.698) (-309.226) -- 0:00:16
      733000 -- [-309.072] (-310.200) (-307.069) (-308.111) * (-306.470) (-309.121) [-307.307] (-309.556) -- 0:00:16
      733500 -- (-309.117) (-309.345) (-309.533) [-307.908] * [-310.277] (-307.266) (-306.609) (-310.174) -- 0:00:15
      734000 -- (-310.250) (-308.123) [-308.573] (-306.739) * (-310.193) (-306.871) [-306.478] (-311.328) -- 0:00:15
      734500 -- (-311.416) (-309.971) [-307.194] (-306.814) * [-307.578] (-309.659) (-309.038) (-307.954) -- 0:00:15
      735000 -- [-308.078] (-312.456) (-310.672) (-308.862) * (-308.911) (-308.878) (-308.357) [-307.167] -- 0:00:15

      Average standard deviation of split frequencies: 0.010288

      735500 -- (-309.072) (-310.161) (-308.930) [-310.403] * [-309.554] (-312.917) (-307.328) (-309.814) -- 0:00:15
      736000 -- (-309.796) (-308.582) [-309.082] (-312.447) * (-310.560) [-309.237] (-310.325) (-309.235) -- 0:00:15
      736500 -- (-309.922) (-307.672) [-307.638] (-309.843) * [-307.077] (-310.837) (-309.981) (-318.081) -- 0:00:15
      737000 -- (-309.434) (-315.660) (-308.686) [-307.553] * (-309.051) (-312.938) (-314.887) [-307.564] -- 0:00:15
      737500 -- [-308.628] (-308.311) (-308.633) (-310.506) * [-311.262] (-307.795) (-311.604) (-311.884) -- 0:00:15
      738000 -- (-307.665) (-309.595) [-311.212] (-309.488) * [-307.377] (-310.359) (-307.147) (-307.629) -- 0:00:15
      738500 -- [-312.395] (-307.725) (-308.118) (-307.548) * (-306.662) (-309.058) (-307.058) [-311.652] -- 0:00:15
      739000 -- (-309.374) (-306.869) (-309.474) [-307.417] * (-309.505) [-307.706] (-307.698) (-311.659) -- 0:00:15
      739500 -- (-307.701) (-306.725) (-308.024) [-307.158] * (-308.626) (-308.383) (-309.730) [-308.895] -- 0:00:15
      740000 -- (-309.979) (-309.982) [-308.727] (-311.769) * (-313.123) (-307.630) [-307.565] (-311.489) -- 0:00:15

      Average standard deviation of split frequencies: 0.010303

      740500 -- (-307.156) [-308.824] (-311.202) (-311.755) * (-307.507) [-310.175] (-311.833) (-306.792) -- 0:00:15
      741000 -- (-310.965) [-307.518] (-310.846) (-309.439) * (-311.668) (-307.337) [-309.073] (-307.918) -- 0:00:15
      741500 -- (-308.416) (-312.105) (-310.120) [-308.181] * (-307.669) (-309.662) (-307.791) [-309.568] -- 0:00:15
      742000 -- [-309.470] (-306.924) (-306.803) (-309.432) * [-308.648] (-309.454) (-308.464) (-308.865) -- 0:00:15
      742500 -- (-307.500) (-308.317) [-307.167] (-310.799) * (-307.251) (-308.960) [-308.251] (-310.261) -- 0:00:15
      743000 -- (-307.358) [-307.382] (-306.750) (-308.274) * (-306.754) (-307.952) (-307.010) [-308.300] -- 0:00:15
      743500 -- (-307.764) (-316.583) [-313.194] (-310.622) * [-308.481] (-318.265) (-307.234) (-307.162) -- 0:00:15
      744000 -- (-308.425) [-307.494] (-311.066) (-311.439) * [-307.734] (-307.851) (-310.336) (-309.148) -- 0:00:15
      744500 -- [-310.111] (-308.359) (-310.635) (-312.334) * (-308.621) (-307.606) [-311.445] (-309.920) -- 0:00:15
      745000 -- (-311.748) [-307.188] (-310.233) (-308.072) * (-308.838) [-308.699] (-309.140) (-309.937) -- 0:00:15

      Average standard deviation of split frequencies: 0.010150

      745500 -- (-311.961) [-307.171] (-310.008) (-307.141) * (-310.735) (-309.543) [-308.843] (-308.009) -- 0:00:15
      746000 -- [-313.051] (-307.618) (-307.106) (-308.009) * (-306.583) (-306.953) [-307.759] (-307.116) -- 0:00:14
      746500 -- (-306.941) (-308.391) (-308.823) [-308.163] * (-309.211) [-307.945] (-307.000) (-307.990) -- 0:00:14
      747000 -- (-306.966) [-310.210] (-312.963) (-307.505) * (-312.181) [-307.359] (-306.657) (-307.711) -- 0:00:14
      747500 -- (-308.336) (-309.205) (-312.917) [-307.635] * [-311.660] (-307.468) (-308.734) (-309.003) -- 0:00:15
      748000 -- (-309.356) [-310.345] (-312.900) (-309.908) * (-307.888) (-310.944) [-309.036] (-308.221) -- 0:00:15
      748500 -- (-310.114) [-308.200] (-309.873) (-309.331) * (-311.836) (-310.375) [-307.870] (-307.087) -- 0:00:15
      749000 -- (-310.603) (-310.997) (-307.020) [-308.978] * (-310.110) (-308.082) (-307.850) [-307.684] -- 0:00:15
      749500 -- (-309.703) (-309.986) [-307.381] (-308.650) * (-309.732) (-311.911) [-308.803] (-307.854) -- 0:00:15
      750000 -- [-306.815] (-308.548) (-307.810) (-311.002) * (-308.536) (-311.600) (-309.175) [-306.306] -- 0:00:15

      Average standard deviation of split frequencies: 0.010131

      750500 -- [-307.036] (-312.656) (-309.839) (-309.630) * (-308.332) (-307.746) [-308.867] (-306.329) -- 0:00:14
      751000 -- (-308.061) (-309.953) [-308.214] (-307.765) * (-309.139) (-311.689) (-310.692) [-307.696] -- 0:00:14
      751500 -- [-306.651] (-310.499) (-310.310) (-309.920) * (-309.907) (-311.587) [-309.945] (-309.228) -- 0:00:14
      752000 -- (-307.104) [-311.881] (-308.552) (-309.749) * [-308.526] (-309.967) (-307.180) (-306.856) -- 0:00:14
      752500 -- [-307.222] (-306.747) (-308.485) (-311.640) * [-309.801] (-318.768) (-307.926) (-308.136) -- 0:00:14
      753000 -- (-306.817) [-307.503] (-310.061) (-307.747) * (-308.663) (-315.913) (-307.306) [-310.860] -- 0:00:14
      753500 -- (-308.042) (-307.396) (-309.065) [-309.098] * [-307.235] (-314.087) (-307.600) (-306.890) -- 0:00:14
      754000 -- (-308.112) [-308.417] (-309.952) (-309.382) * (-307.916) (-311.727) [-307.882] (-307.332) -- 0:00:14
      754500 -- (-308.982) [-307.654] (-312.051) (-313.829) * (-310.601) [-308.168] (-308.747) (-310.342) -- 0:00:14
      755000 -- [-309.264] (-310.578) (-311.111) (-310.285) * [-307.266] (-308.322) (-308.238) (-309.690) -- 0:00:14

      Average standard deviation of split frequencies: 0.010060

      755500 -- (-308.688) (-307.653) (-308.394) [-308.855] * (-315.391) (-309.703) [-308.564] (-308.329) -- 0:00:14
      756000 -- (-311.987) (-309.968) [-309.573] (-308.447) * (-310.614) (-310.289) (-308.501) [-307.334] -- 0:00:14
      756500 -- [-309.185] (-307.923) (-308.641) (-309.836) * (-309.984) (-308.515) (-310.072) [-308.951] -- 0:00:14
      757000 -- [-309.745] (-310.147) (-309.526) (-307.619) * [-307.286] (-308.457) (-308.044) (-308.598) -- 0:00:14
      757500 -- (-309.358) [-307.926] (-310.291) (-308.753) * (-307.489) (-309.292) [-308.143] (-306.889) -- 0:00:14
      758000 -- (-309.154) (-309.179) (-310.475) [-310.367] * (-309.998) [-313.097] (-313.231) (-309.879) -- 0:00:14
      758500 -- (-308.155) (-317.239) (-309.344) [-307.853] * (-311.786) [-306.320] (-312.154) (-308.098) -- 0:00:14
      759000 -- [-307.906] (-313.880) (-315.798) (-309.271) * [-310.462] (-308.711) (-311.910) (-309.270) -- 0:00:14
      759500 -- (-313.747) (-308.314) (-313.957) [-308.638] * [-308.088] (-308.189) (-308.431) (-314.989) -- 0:00:14
      760000 -- (-307.406) [-308.387] (-309.558) (-312.995) * (-311.373) (-309.355) [-308.715] (-309.824) -- 0:00:14

      Average standard deviation of split frequencies: 0.010264

      760500 -- (-308.194) (-310.769) [-308.815] (-311.894) * (-308.193) [-308.657] (-308.680) (-309.915) -- 0:00:14
      761000 -- (-310.110) (-310.599) (-312.888) [-308.809] * (-307.427) [-306.975] (-308.091) (-310.991) -- 0:00:14
      761500 -- (-312.262) [-308.549] (-308.300) (-310.730) * [-306.520] (-309.095) (-308.067) (-308.427) -- 0:00:14
      762000 -- (-310.015) (-308.261) [-308.287] (-309.525) * (-307.200) [-308.616] (-309.331) (-306.895) -- 0:00:14
      762500 -- (-310.447) (-308.085) [-309.330] (-308.178) * (-308.464) (-306.570) [-309.442] (-308.593) -- 0:00:14
      763000 -- (-311.229) [-308.504] (-314.110) (-308.934) * (-307.814) [-308.523] (-311.634) (-307.227) -- 0:00:13
      763500 -- (-307.314) (-310.564) (-310.335) [-307.606] * [-309.071] (-314.302) (-312.188) (-307.128) -- 0:00:13
      764000 -- (-308.928) (-308.869) (-306.910) [-306.947] * [-308.613] (-310.132) (-309.414) (-311.773) -- 0:00:13
      764500 -- (-307.667) (-309.615) [-312.341] (-307.448) * (-306.503) [-307.398] (-308.580) (-312.291) -- 0:00:14
      765000 -- (-308.091) [-308.171] (-310.465) (-309.400) * [-308.651] (-309.262) (-312.247) (-310.199) -- 0:00:14

      Average standard deviation of split frequencies: 0.009577

      765500 -- (-313.149) (-308.583) [-310.213] (-309.678) * (-309.175) [-310.114] (-310.211) (-307.921) -- 0:00:14
      766000 -- (-307.278) [-307.638] (-312.520) (-307.536) * (-306.910) [-307.397] (-310.917) (-307.736) -- 0:00:14
      766500 -- [-308.592] (-306.937) (-314.908) (-309.817) * (-306.609) (-309.863) [-307.781] (-307.433) -- 0:00:14
      767000 -- (-308.144) [-307.894] (-309.053) (-307.745) * (-306.866) (-309.058) (-311.072) [-308.119] -- 0:00:13
      767500 -- (-315.393) [-309.284] (-311.815) (-308.841) * (-308.130) (-308.550) (-306.999) [-308.315] -- 0:00:13
      768000 -- (-307.741) (-306.913) (-309.814) [-307.463] * [-307.658] (-308.405) (-307.408) (-307.905) -- 0:00:13
      768500 -- [-308.972] (-309.735) (-307.968) (-308.860) * (-308.255) (-308.555) (-312.551) [-308.774] -- 0:00:13
      769000 -- [-306.449] (-313.072) (-310.836) (-306.915) * (-308.287) [-307.628] (-307.988) (-310.550) -- 0:00:13
      769500 -- (-307.236) (-307.257) (-307.011) [-306.909] * (-314.026) [-310.465] (-307.942) (-309.026) -- 0:00:13
      770000 -- [-312.561] (-309.137) (-310.398) (-306.877) * (-311.775) [-311.115] (-307.670) (-309.250) -- 0:00:13

      Average standard deviation of split frequencies: 0.009596

      770500 -- (-308.946) (-307.692) (-308.537) [-308.224] * [-310.856] (-309.526) (-307.766) (-307.072) -- 0:00:13
      771000 -- (-307.971) [-309.459] (-307.324) (-307.853) * (-310.725) [-310.999] (-307.678) (-308.914) -- 0:00:13
      771500 -- [-308.038] (-310.081) (-308.470) (-309.181) * (-312.546) (-307.612) [-307.772] (-308.280) -- 0:00:13
      772000 -- (-310.148) (-307.811) (-306.911) [-309.528] * [-308.992] (-309.236) (-309.092) (-309.207) -- 0:00:13
      772500 -- [-308.717] (-308.756) (-309.970) (-308.734) * (-308.933) (-311.271) [-308.502] (-309.827) -- 0:00:13
      773000 -- (-309.787) (-308.725) (-308.264) [-306.934] * (-307.574) [-308.107] (-307.678) (-313.181) -- 0:00:13
      773500 -- [-308.430] (-308.463) (-310.246) (-307.199) * (-309.647) [-308.581] (-310.671) (-309.996) -- 0:00:13
      774000 -- (-307.229) (-310.113) (-309.949) [-308.547] * (-309.885) [-309.764] (-309.876) (-308.106) -- 0:00:13
      774500 -- (-308.947) (-311.634) (-308.003) [-307.122] * (-308.548) (-308.293) [-308.534] (-307.933) -- 0:00:13
      775000 -- [-307.421] (-307.378) (-307.654) (-311.765) * [-307.487] (-309.745) (-307.933) (-309.862) -- 0:00:13

      Average standard deviation of split frequencies: 0.009302

      775500 -- (-311.391) (-308.940) (-308.502) [-308.883] * (-307.381) (-306.867) [-307.401] (-308.162) -- 0:00:13
      776000 -- (-310.798) (-307.101) [-309.376] (-312.759) * (-308.094) [-310.293] (-307.773) (-311.415) -- 0:00:13
      776500 -- (-309.168) [-307.567] (-306.963) (-312.524) * (-309.168) (-308.496) (-310.995) [-310.485] -- 0:00:13
      777000 -- (-309.817) [-306.731] (-306.986) (-308.556) * (-307.933) [-308.384] (-309.247) (-311.779) -- 0:00:13
      777500 -- [-310.707] (-307.063) (-308.118) (-308.558) * (-307.098) (-312.589) (-310.123) [-309.168] -- 0:00:13
      778000 -- (-307.178) (-308.946) [-307.329] (-312.024) * [-310.493] (-311.841) (-308.063) (-308.690) -- 0:00:13
      778500 -- (-307.301) [-308.668] (-308.621) (-308.584) * (-311.747) (-314.648) [-307.548] (-311.217) -- 0:00:13
      779000 -- [-307.104] (-308.628) (-307.603) (-307.944) * [-307.509] (-311.209) (-306.909) (-307.252) -- 0:00:13
      779500 -- (-307.008) (-308.185) [-309.649] (-309.725) * (-310.343) (-309.711) (-310.724) [-308.220] -- 0:00:13
      780000 -- (-307.438) (-314.508) (-308.328) [-307.497] * (-307.518) (-311.265) [-310.046] (-307.054) -- 0:00:12

      Average standard deviation of split frequencies: 0.009322

      780500 -- [-308.294] (-307.821) (-307.749) (-307.689) * (-308.360) (-310.801) (-308.863) [-309.955] -- 0:00:12
      781000 -- [-314.168] (-306.583) (-308.566) (-307.618) * (-308.568) (-308.181) [-307.774] (-307.739) -- 0:00:12
      781500 -- [-309.457] (-307.008) (-307.770) (-307.185) * (-309.514) (-309.147) (-306.748) [-307.312] -- 0:00:13
      782000 -- (-306.657) [-306.470] (-309.198) (-307.022) * (-306.464) [-310.644] (-311.213) (-308.569) -- 0:00:13
      782500 -- [-307.760] (-309.830) (-313.582) (-308.885) * (-308.078) (-307.090) (-310.847) [-307.378] -- 0:00:13
      783000 -- (-308.354) (-306.545) (-308.595) [-309.910] * (-308.972) (-311.971) [-309.926] (-310.420) -- 0:00:13
      783500 -- (-313.892) (-307.914) [-308.444] (-309.387) * (-310.553) (-308.810) (-308.604) [-307.822] -- 0:00:12
      784000 -- (-312.815) [-309.128] (-311.038) (-309.756) * [-311.340] (-307.030) (-308.795) (-308.785) -- 0:00:12
      784500 -- (-313.316) [-307.890] (-308.343) (-308.135) * (-310.266) (-307.495) (-307.026) [-306.855] -- 0:00:12
      785000 -- [-308.857] (-308.195) (-310.145) (-307.537) * (-311.642) (-308.471) [-307.340] (-306.862) -- 0:00:12

      Average standard deviation of split frequencies: 0.009420

      785500 -- (-307.158) (-307.663) (-308.831) [-309.867] * (-313.553) (-308.742) (-307.437) [-306.821] -- 0:00:12
      786000 -- [-308.693] (-306.920) (-307.049) (-314.907) * (-309.094) (-307.851) (-308.693) [-309.342] -- 0:00:12
      786500 -- [-309.721] (-310.913) (-310.780) (-310.832) * [-307.868] (-310.297) (-307.852) (-307.129) -- 0:00:12
      787000 -- (-311.474) (-310.650) [-307.216] (-306.965) * (-309.011) (-308.546) (-307.670) [-310.081] -- 0:00:12
      787500 -- (-313.114) (-309.226) [-310.182] (-307.994) * (-311.507) (-307.820) (-308.468) [-307.459] -- 0:00:12
      788000 -- (-307.321) (-308.547) [-310.473] (-307.841) * (-310.362) (-308.294) (-308.264) [-309.741] -- 0:00:12
      788500 -- (-306.934) (-307.799) [-310.228] (-309.587) * (-308.817) (-310.396) (-308.041) [-308.905] -- 0:00:12
      789000 -- [-308.473] (-307.679) (-309.032) (-309.809) * (-308.471) [-308.175] (-306.995) (-308.049) -- 0:00:12
      789500 -- (-309.832) [-309.494] (-308.863) (-309.845) * (-306.919) [-310.047] (-311.326) (-308.778) -- 0:00:12