--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 17:38:20 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0431/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1063.11         -1067.03
2      -1063.14         -1066.72
--------------------------------------
TOTAL    -1063.13         -1066.88
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.878346    0.088669    0.378800    1.507150    0.847670   1393.81   1439.94    1.000
r(A<->C){all}   0.156776    0.019421    0.000363    0.443137    0.116882     41.34    101.49    1.004
r(A<->G){all}   0.218958    0.025211    0.000435    0.519815    0.188285    175.99    187.20    1.001
r(A<->T){all}   0.174259    0.021925    0.000064    0.472546    0.133424    146.81    201.71    1.000
r(C<->G){all}   0.136592    0.017124    0.000035    0.395176    0.096848    231.38    242.16    1.000
r(C<->T){all}   0.169695    0.021574    0.000008    0.465974    0.127628    200.44    205.20    1.000
r(G<->T){all}   0.143720    0.015791    0.000047    0.407148    0.110301    202.71    214.75    1.007
pi(A){all}      0.230657    0.000222    0.201243    0.259657    0.230381   1250.15   1326.53    1.000
pi(C){all}      0.351937    0.000278    0.319905    0.383715    0.352567   1199.07   1208.41    1.000
pi(G){all}      0.253172    0.000237    0.222745    0.282469    0.252933   1194.93   1204.82    1.000
pi(T){all}      0.164234    0.000177    0.138511    0.190658    0.163776   1300.60   1349.42    1.000
alpha{1,2}      0.278740    0.107735    0.000175    0.893726    0.178806   1416.34   1458.67    1.000
alpha{3}        0.418570    0.248528    0.000316    1.451539    0.230656   1057.19   1207.33    1.000
pinvar{all}     0.995450    0.000014    0.988286    0.999937    0.996431    959.91   1061.56    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1035.647153
Model 2: PositiveSelection	-1035.277566
Model 0: one-ratio	-1035.277732
Model 7: beta	-1035.647156
Model 8: beta&w>1	-1035.277173


Model 0 vs 1	0.7388419999997495

Model 2 vs 1	0.7391739999998208

Model 8 vs 7	0.7399660000000949
>C1
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C2
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C3
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C4
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C5
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C6
MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=259 

C1              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C2              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C3              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C4              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C5              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C6              MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
                *************** **********************************

C1              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C2              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C3              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C4              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C5              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C6              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
                **************************************************

C1              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C2              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C3              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C4              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C5              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C6              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
                **************************************************

C1              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C2              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C3              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C4              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C5              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C6              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
                **************************************************

C1              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C2              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C3              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C4              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C5              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C6              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
                **************************************************

C1              GLTICDAPR
C2              GLTICDAPR
C3              GLTICDAPR
C4              GLTICDAPR
C5              GLTICDAPR
C6              GLTICDAPR
                *********




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  259 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  259 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7770]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7770]--->[7770]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.496 Mb, Max= 30.813 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C2              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C3              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C4              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C5              MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C6              MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
                *************** **********************************

C1              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C2              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C3              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C4              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C5              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C6              PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
                **************************************************

C1              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C2              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C3              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C4              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C5              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C6              ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
                **************************************************

C1              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C2              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C3              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C4              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C5              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C6              TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
                **************************************************

C1              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C2              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C3              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C4              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C5              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C6              EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
                **************************************************

C1              GLTICDAPR
C2              GLTICDAPR
C3              GLTICDAPR
C4              GLTICDAPR
C5              GLTICDAPR
C6              GLTICDAPR
                *********




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.61 C1	 C6	 99.61
TOP	    5    0	 99.61 C6	 C1	 99.61
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.61 C2	 C6	 99.61
TOP	    5    1	 99.61 C6	 C2	 99.61
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.61 C3	 C6	 99.61
TOP	    5    2	 99.61 C6	 C3	 99.61
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.61 C4	 C6	 99.61
TOP	    5    3	 99.61 C6	 C4	 99.61
BOT	    4    5	 99.61 C5	 C6	 99.61
TOP	    5    4	 99.61 C6	 C5	 99.61
AVG	 0	 C1	  *	 99.92
AVG	 1	 C2	  *	 99.92
AVG	 2	 C3	  *	 99.92
AVG	 3	 C4	  *	 99.92
AVG	 4	 C5	  *	 99.92
AVG	 5	 C6	  *	 99.61
TOT	 TOT	  *	 99.87
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C2              ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C3              ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C4              ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C5              ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C6              ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGAGTC
                **********************************************.***

C1              TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C2              TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C3              TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C4              TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C5              TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C6              TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
                **************************************************

C1              CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C2              CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C3              CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C4              CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C5              CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C6              CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
                **************************************************

C1              CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C2              CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C3              CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C4              CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C5              CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C6              CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
                **************************************************

C1              AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C2              AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C3              AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C4              AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C5              AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C6              AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
                **************************************************

C1              CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C2              CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C3              CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C4              CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C5              CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C6              CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
                **************************************************

C1              GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C2              GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C3              GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C4              GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C5              GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C6              GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
                **************************************************

C1              CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C2              CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C3              CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C4              CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C5              CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C6              CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
                **************************************************

C1              AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C2              AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C3              AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C4              AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C5              AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C6              AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
                **************************************************

C1              ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C2              ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C3              ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C4              ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C5              ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C6              ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
                **************************************************

C1              TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C2              TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C3              TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C4              TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C5              TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C6              TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
                **************************************************

C1              GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C2              GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C3              GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C4              GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C5              GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C6              GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
                **************************************************

C1              GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C2              GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C3              GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C4              GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C5              GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C6              GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
                **************************************************

C1              AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C2              AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C3              AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C4              AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C5              AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C6              AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
                **************************************************

C1              CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C2              CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C3              CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C4              CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C5              CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C6              CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
                **************************************************

C1              GGCCTGACGATCTGCGATGCTCCCCGC
C2              GGCCTGACGATCTGCGATGCTCCCCGC
C3              GGCCTGACGATCTGCGATGCTCCCCGC
C4              GGCCTGACGATCTGCGATGCTCCCCGC
C5              GGCCTGACGATCTGCGATGCTCCCCGC
C6              GGCCTGACGATCTGCGATGCTCCCCGC
                ***************************



>C1
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C2
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C3
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C4
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C5
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C6
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGAGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C1
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C2
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C3
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C4
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C5
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C6
MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 777 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579801007
      Setting output file names to "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 688405482
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1182100392
      Seed = 1214136522
      Swapseed = 1579801007
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1742.366122 -- -24.965149
         Chain 2 -- -1742.364572 -- -24.965149
         Chain 3 -- -1742.366122 -- -24.965149
         Chain 4 -- -1742.366023 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1742.365790 -- -24.965149
         Chain 2 -- -1742.366122 -- -24.965149
         Chain 3 -- -1742.366023 -- -24.965149
         Chain 4 -- -1742.366023 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1742.366] (-1742.365) (-1742.366) (-1742.366) * [-1742.366] (-1742.366) (-1742.366) (-1742.366) 
        500 -- (-1074.739) (-1086.597) [-1068.458] (-1068.831) * (-1070.087) [-1072.355] (-1077.569) (-1075.692) -- 0:00:00
       1000 -- (-1074.644) (-1076.588) (-1067.248) [-1072.828] * (-1069.004) (-1066.642) (-1065.780) [-1066.096] -- 0:00:00
       1500 -- (-1066.883) [-1063.839] (-1070.597) (-1087.626) * (-1066.849) (-1071.073) (-1071.846) [-1067.071] -- 0:00:00
       2000 -- (-1070.687) [-1064.508] (-1080.862) (-1077.654) * (-1067.782) (-1071.179) (-1066.158) [-1063.758] -- 0:00:00
       2500 -- [-1067.164] (-1071.191) (-1066.972) (-1072.272) * [-1065.346] (-1070.315) (-1068.811) (-1067.103) -- 0:00:00
       3000 -- (-1071.720) (-1070.893) (-1067.024) [-1070.883] * (-1071.163) (-1079.651) (-1067.103) [-1067.479] -- 0:00:00
       3500 -- [-1066.961] (-1067.331) (-1068.481) (-1066.637) * (-1070.070) (-1067.090) [-1071.386] (-1080.277) -- 0:00:00
       4000 -- (-1067.448) (-1065.621) [-1066.172] (-1070.314) * (-1067.612) [-1063.871] (-1080.288) (-1065.986) -- 0:00:00
       4500 -- (-1068.256) (-1066.897) (-1066.814) [-1076.360] * (-1064.847) (-1074.163) (-1077.770) [-1065.716] -- 0:00:00
       5000 -- (-1072.895) (-1072.666) (-1070.603) [-1071.622] * (-1069.910) [-1062.842] (-1068.324) (-1066.908) -- 0:00:00

      Average standard deviation of split frequencies: 0.111304

       5500 -- (-1068.158) [-1068.711] (-1067.698) (-1073.402) * (-1068.047) [-1066.686] (-1070.886) (-1069.641) -- 0:00:00
       6000 -- (-1070.421) [-1069.227] (-1062.928) (-1076.891) * [-1067.172] (-1065.448) (-1070.447) (-1066.646) -- 0:00:00
       6500 -- (-1084.717) (-1069.663) [-1069.799] (-1069.561) * (-1070.942) (-1066.304) (-1070.189) [-1072.574] -- 0:02:32
       7000 -- (-1073.763) (-1069.920) [-1072.695] (-1067.911) * (-1065.878) (-1068.693) (-1064.312) [-1065.439] -- 0:02:21
       7500 -- [-1066.234] (-1068.971) (-1077.625) (-1071.378) * (-1065.907) (-1071.617) [-1067.924] (-1062.577) -- 0:02:12
       8000 -- (-1067.623) (-1070.699) (-1071.830) [-1064.938] * (-1066.233) (-1074.797) (-1065.281) [-1071.532] -- 0:02:04
       8500 -- (-1070.328) (-1068.395) [-1071.217] (-1064.790) * [-1062.918] (-1079.187) (-1069.060) (-1070.320) -- 0:01:56
       9000 -- [-1063.232] (-1066.590) (-1072.815) (-1065.872) * (-1068.630) (-1073.787) (-1064.243) [-1069.685] -- 0:01:50
       9500 -- (-1061.677) [-1064.779] (-1062.681) (-1066.251) * (-1070.469) (-1074.715) (-1067.908) [-1072.487] -- 0:01:44
      10000 -- (-1069.784) (-1068.177) [-1065.710] (-1064.693) * [-1074.489] (-1073.808) (-1079.328) (-1066.464) -- 0:01:39

      Average standard deviation of split frequencies: 0.067344

      10500 -- (-1068.262) (-1069.858) [-1068.934] (-1066.725) * (-1072.643) (-1071.672) [-1067.366] (-1069.517) -- 0:01:34
      11000 -- (-1068.612) (-1069.752) (-1069.064) [-1062.326] * (-1064.910) [-1070.097] (-1070.197) (-1061.199) -- 0:01:29
      11500 -- (-1072.411) (-1069.859) [-1066.205] (-1066.925) * (-1065.913) [-1064.387] (-1069.246) (-1073.169) -- 0:01:25
      12000 -- (-1068.827) (-1070.112) [-1066.096] (-1065.211) * (-1069.213) (-1062.958) [-1066.172] (-1069.499) -- 0:01:22
      12500 -- (-1075.234) [-1069.244] (-1068.963) (-1070.445) * (-1070.337) (-1071.334) (-1064.734) [-1070.108] -- 0:01:19
      13000 -- (-1075.408) (-1076.222) [-1063.818] (-1063.228) * [-1064.805] (-1067.820) (-1068.151) (-1065.653) -- 0:01:15
      13500 -- (-1063.521) (-1071.389) [-1067.765] (-1063.157) * (-1075.927) (-1065.573) [-1070.263] (-1068.624) -- 0:01:13
      14000 -- (-1066.361) [-1066.745] (-1066.218) (-1065.152) * (-1069.753) (-1074.111) [-1066.353] (-1073.581) -- 0:01:10
      14500 -- [-1062.832] (-1062.183) (-1066.325) (-1066.092) * (-1064.687) (-1064.932) (-1071.701) [-1073.898] -- 0:01:07
      15000 -- (-1069.463) (-1069.203) (-1076.179) [-1069.757] * (-1071.633) (-1067.055) [-1068.737] (-1071.468) -- 0:01:05

      Average standard deviation of split frequencies: 0.066679

      15500 -- [-1064.541] (-1077.706) (-1067.454) (-1062.512) * (-1072.273) [-1064.844] (-1070.499) (-1075.299) -- 0:01:03
      16000 -- [-1069.303] (-1066.288) (-1063.374) (-1064.702) * (-1072.843) (-1064.201) [-1068.990] (-1084.294) -- 0:01:01
      16500 -- (-1077.701) (-1075.147) (-1070.017) [-1064.915] * (-1074.694) (-1067.911) (-1066.283) [-1062.902] -- 0:00:59
      17000 -- (-1065.869) [-1072.010] (-1072.334) (-1063.136) * (-1078.702) [-1066.644] (-1065.782) (-1062.325) -- 0:00:57
      17500 -- (-1076.914) [-1071.652] (-1071.845) (-1066.613) * (-1082.487) [-1064.328] (-1066.693) (-1064.015) -- 0:00:56
      18000 -- [-1069.395] (-1067.164) (-1066.420) (-1066.681) * (-1071.503) [-1072.663] (-1066.844) (-1063.320) -- 0:00:54
      18500 -- (-1069.653) [-1068.191] (-1070.472) (-1063.247) * (-1073.478) (-1066.504) [-1063.764] (-1063.342) -- 0:00:53
      19000 -- (-1079.029) (-1066.262) [-1072.847] (-1064.347) * (-1071.557) [-1068.215] (-1071.668) (-1064.550) -- 0:00:51
      19500 -- (-1088.219) [-1067.462] (-1068.719) (-1065.544) * (-1071.655) (-1069.236) [-1065.734] (-1063.862) -- 0:00:50
      20000 -- (-1063.517) (-1066.561) (-1074.588) [-1063.734] * (-1073.309) [-1062.077] (-1064.374) (-1063.984) -- 0:00:49

      Average standard deviation of split frequencies: 0.064628

      20500 -- (-1063.528) (-1074.728) [-1066.472] (-1064.642) * (-1069.717) (-1064.600) [-1071.672] (-1066.315) -- 0:00:47
      21000 -- [-1064.237] (-1071.574) (-1069.619) (-1069.062) * (-1074.470) [-1061.818] (-1074.506) (-1063.743) -- 0:00:46
      21500 -- (-1061.133) (-1070.498) [-1063.124] (-1062.783) * (-1073.149) [-1070.469] (-1062.951) (-1063.558) -- 0:01:31
      22000 -- (-1062.340) (-1071.280) [-1068.465] (-1063.698) * (-1069.652) [-1063.208] (-1064.626) (-1063.525) -- 0:01:28
      22500 -- (-1067.710) [-1065.924] (-1064.841) (-1065.425) * (-1063.507) [-1065.383] (-1068.873) (-1067.881) -- 0:01:26
      23000 -- (-1063.256) (-1078.274) (-1065.259) [-1065.076] * (-1068.536) (-1072.976) (-1067.677) [-1067.376] -- 0:01:24
      23500 -- (-1062.306) (-1089.548) [-1063.692] (-1063.480) * (-1071.118) (-1074.254) [-1068.953] (-1064.874) -- 0:01:23
      24000 -- (-1063.172) (-1069.087) [-1065.388] (-1073.092) * [-1064.473] (-1085.834) (-1066.761) (-1065.407) -- 0:01:21
      24500 -- (-1062.412) [-1065.716] (-1065.558) (-1065.402) * (-1070.118) (-1069.950) (-1070.358) [-1061.250] -- 0:01:19
      25000 -- [-1064.823] (-1064.768) (-1070.406) (-1066.242) * (-1063.492) [-1063.668] (-1066.452) (-1063.490) -- 0:01:18

      Average standard deviation of split frequencies: 0.051371

      25500 -- (-1064.642) (-1064.981) (-1067.565) [-1063.295] * (-1061.400) [-1062.577] (-1073.020) (-1061.764) -- 0:01:16
      26000 -- [-1063.789] (-1071.848) (-1065.871) (-1062.931) * [-1071.362] (-1062.463) (-1068.469) (-1065.111) -- 0:01:14
      26500 -- (-1067.292) (-1070.466) [-1064.258] (-1064.406) * (-1070.377) (-1062.697) [-1067.263] (-1063.848) -- 0:01:13
      27000 -- (-1066.152) [-1063.568] (-1064.791) (-1062.647) * (-1065.679) (-1065.201) [-1069.156] (-1064.608) -- 0:01:12
      27500 -- (-1067.338) (-1066.285) (-1068.875) [-1063.709] * (-1070.625) (-1062.174) [-1070.218] (-1064.034) -- 0:01:10
      28000 -- (-1064.931) (-1064.655) [-1064.303] (-1063.078) * (-1074.143) (-1064.031) [-1066.238] (-1064.146) -- 0:01:09
      28500 -- (-1063.350) (-1067.579) [-1069.441] (-1065.388) * [-1066.117] (-1063.467) (-1066.942) (-1065.488) -- 0:01:08
      29000 -- (-1064.268) (-1064.245) [-1071.020] (-1062.842) * (-1067.301) (-1064.400) [-1067.358] (-1067.488) -- 0:01:06
      29500 -- (-1067.139) [-1063.880] (-1073.587) (-1065.232) * (-1075.254) (-1066.041) (-1072.081) [-1064.388] -- 0:01:05
      30000 -- (-1066.318) [-1063.161] (-1069.352) (-1063.890) * (-1067.399) (-1065.591) [-1070.866] (-1066.725) -- 0:01:04

      Average standard deviation of split frequencies: 0.059391

      30500 -- (-1065.756) (-1067.446) [-1066.205] (-1064.154) * (-1068.043) [-1064.923] (-1071.586) (-1065.518) -- 0:01:03
      31000 -- (-1067.317) (-1066.024) [-1066.489] (-1064.266) * (-1067.383) (-1063.074) (-1063.749) [-1065.003] -- 0:01:02
      31500 -- [-1063.398] (-1064.033) (-1066.271) (-1067.522) * [-1067.818] (-1061.164) (-1068.497) (-1066.695) -- 0:01:01
      32000 -- (-1064.206) (-1067.032) [-1064.601] (-1065.367) * (-1065.512) (-1064.036) [-1064.467] (-1068.175) -- 0:01:00
      32500 -- (-1063.188) (-1065.277) [-1066.188] (-1065.472) * (-1070.706) (-1064.959) [-1067.249] (-1064.237) -- 0:00:59
      33000 -- (-1063.539) (-1062.869) (-1066.627) [-1064.374] * (-1073.847) (-1062.767) [-1069.463] (-1063.733) -- 0:00:58
      33500 -- (-1065.123) (-1064.186) (-1070.720) [-1062.476] * (-1072.337) (-1060.926) [-1071.347] (-1063.590) -- 0:00:57
      34000 -- (-1064.700) (-1063.214) [-1066.300] (-1064.040) * (-1073.096) (-1060.660) (-1065.136) [-1063.291] -- 0:00:56
      34500 -- (-1069.754) (-1063.884) (-1069.085) [-1061.567] * (-1076.075) (-1062.923) [-1067.598] (-1065.862) -- 0:00:55
      35000 -- [-1063.498] (-1063.798) (-1067.272) (-1061.440) * (-1076.551) (-1062.648) [-1064.904] (-1065.771) -- 0:00:55

      Average standard deviation of split frequencies: 0.053625

      35500 -- (-1068.044) (-1064.712) (-1064.518) [-1063.777] * [-1069.537] (-1062.033) (-1066.789) (-1061.853) -- 0:00:54
      36000 -- [-1063.848] (-1066.992) (-1072.095) (-1066.242) * (-1067.342) (-1061.853) [-1070.450] (-1064.202) -- 0:00:53
      36500 -- [-1063.711] (-1067.447) (-1066.488) (-1064.458) * [-1067.969] (-1062.252) (-1082.672) (-1062.561) -- 0:01:19
      37000 -- (-1064.661) (-1066.284) [-1075.529] (-1067.149) * [-1068.937] (-1065.712) (-1076.883) (-1063.664) -- 0:01:18
      37500 -- (-1065.583) (-1065.399) [-1066.538] (-1067.851) * (-1067.216) (-1063.253) [-1064.247] (-1065.579) -- 0:01:17
      38000 -- (-1064.305) (-1065.385) [-1070.152] (-1068.166) * (-1072.122) (-1066.913) [-1063.529] (-1063.866) -- 0:01:15
      38500 -- (-1064.864) [-1066.739] (-1074.220) (-1066.689) * (-1073.154) [-1065.300] (-1065.041) (-1062.558) -- 0:01:14
      39000 -- (-1065.566) (-1062.453) [-1076.110] (-1063.339) * [-1066.886] (-1065.016) (-1062.950) (-1063.363) -- 0:01:13
      39500 -- (-1063.535) (-1064.944) [-1067.635] (-1066.262) * (-1069.598) (-1064.583) [-1063.168] (-1063.582) -- 0:01:12
      40000 -- (-1064.596) (-1063.119) [-1065.517] (-1066.278) * [-1068.415] (-1063.971) (-1064.567) (-1062.606) -- 0:01:12

      Average standard deviation of split frequencies: 0.056129

      40500 -- (-1065.983) (-1068.137) [-1061.835] (-1062.793) * (-1065.975) (-1065.769) [-1064.116] (-1062.424) -- 0:01:11
      41000 -- (-1062.012) (-1065.828) [-1063.607] (-1063.251) * (-1083.588) [-1063.455] (-1064.527) (-1065.797) -- 0:01:10
      41500 -- (-1067.068) (-1064.302) [-1064.040] (-1063.000) * (-1071.490) (-1062.628) (-1062.690) [-1065.294] -- 0:01:09
      42000 -- (-1066.271) (-1066.869) [-1063.919] (-1069.947) * (-1069.072) (-1063.324) (-1063.755) [-1065.698] -- 0:01:08
      42500 -- (-1065.537) (-1065.406) (-1063.832) [-1064.218] * (-1073.599) (-1064.652) [-1068.011] (-1062.712) -- 0:01:07
      43000 -- [-1066.450] (-1063.341) (-1063.719) (-1063.668) * [-1069.444] (-1066.761) (-1064.279) (-1063.093) -- 0:01:06
      43500 -- (-1064.319) (-1067.358) [-1063.610] (-1062.902) * (-1067.233) (-1068.565) [-1063.769] (-1063.266) -- 0:01:05
      44000 -- (-1064.874) [-1067.647] (-1063.985) (-1063.510) * [-1071.079] (-1064.578) (-1062.490) (-1069.564) -- 0:01:05
      44500 -- [-1064.659] (-1068.493) (-1062.778) (-1061.229) * [-1066.453] (-1064.565) (-1064.155) (-1065.018) -- 0:01:04
      45000 -- (-1062.353) (-1069.176) [-1062.723] (-1065.596) * [-1067.855] (-1065.992) (-1062.965) (-1064.920) -- 0:01:03

      Average standard deviation of split frequencies: 0.046581

      45500 -- (-1061.322) [-1065.657] (-1063.365) (-1062.325) * (-1073.666) (-1064.256) [-1064.165] (-1063.618) -- 0:01:02
      46000 -- (-1063.000) (-1065.392) (-1062.762) [-1062.737] * (-1073.728) (-1063.815) [-1063.567] (-1063.713) -- 0:01:02
      46500 -- [-1063.125] (-1062.183) (-1063.653) (-1065.418) * [-1066.982] (-1062.375) (-1064.969) (-1065.523) -- 0:01:01
      47000 -- (-1064.307) [-1065.677] (-1067.004) (-1063.951) * [-1068.595] (-1065.033) (-1069.175) (-1063.022) -- 0:01:00
      47500 -- [-1063.883] (-1065.758) (-1065.817) (-1069.091) * (-1068.456) [-1062.659] (-1062.679) (-1065.024) -- 0:01:00
      48000 -- [-1065.382] (-1062.352) (-1065.557) (-1065.341) * (-1077.241) [-1063.413] (-1062.972) (-1061.240) -- 0:00:59
      48500 -- [-1064.534] (-1065.923) (-1065.590) (-1065.753) * [-1070.339] (-1063.853) (-1064.631) (-1065.223) -- 0:00:58
      49000 -- [-1061.485] (-1065.697) (-1064.405) (-1063.797) * [-1070.755] (-1064.829) (-1063.521) (-1064.389) -- 0:00:58
      49500 -- (-1063.783) (-1067.437) (-1065.007) [-1062.325] * (-1068.963) (-1061.518) (-1063.483) [-1062.609] -- 0:00:57
      50000 -- (-1066.069) [-1066.320] (-1062.490) (-1063.403) * [-1072.611] (-1061.726) (-1064.046) (-1063.044) -- 0:00:57

      Average standard deviation of split frequencies: 0.042976

      50500 -- (-1063.237) (-1062.680) (-1065.765) [-1062.856] * (-1073.117) (-1063.752) [-1062.691] (-1064.083) -- 0:00:56
      51000 -- (-1069.193) (-1066.474) (-1061.912) [-1063.467] * [-1071.993] (-1061.467) (-1065.048) (-1068.581) -- 0:00:55
      51500 -- (-1071.352) [-1064.162] (-1064.028) (-1063.546) * (-1076.568) (-1062.296) [-1063.900] (-1067.493) -- 0:01:13
      52000 -- (-1064.518) (-1063.145) (-1064.694) [-1066.199] * [-1074.966] (-1062.697) (-1061.910) (-1064.211) -- 0:01:12
      52500 -- (-1064.688) (-1064.967) (-1066.333) [-1062.295] * [-1064.918] (-1063.323) (-1065.949) (-1064.306) -- 0:01:12
      53000 -- (-1063.341) (-1066.993) (-1066.196) [-1063.911] * (-1077.127) (-1062.774) (-1065.132) [-1064.271] -- 0:01:11
      53500 -- (-1063.567) (-1066.283) (-1067.916) [-1064.130] * (-1077.807) (-1063.148) [-1066.971] (-1063.873) -- 0:01:10
      54000 -- [-1062.806] (-1067.098) (-1065.433) (-1063.306) * (-1072.352) (-1061.672) [-1065.540] (-1064.923) -- 0:01:10
      54500 -- (-1065.765) [-1068.399] (-1071.139) (-1072.866) * (-1081.603) (-1063.302) [-1063.685] (-1064.259) -- 0:01:09
      55000 -- (-1063.983) (-1061.643) (-1066.018) [-1062.030] * (-1074.913) (-1064.361) [-1062.943] (-1063.711) -- 0:01:08

      Average standard deviation of split frequencies: 0.037881

      55500 -- [-1063.188] (-1061.874) (-1066.223) (-1064.919) * (-1067.010) (-1063.477) (-1066.475) [-1063.341] -- 0:01:08
      56000 -- (-1064.124) (-1067.324) [-1062.687] (-1062.310) * (-1094.677) (-1064.023) (-1062.140) [-1063.315] -- 0:01:07
      56500 -- (-1066.178) (-1064.753) [-1065.102] (-1065.750) * (-1067.958) (-1064.607) (-1062.174) [-1062.836] -- 0:01:06
      57000 -- (-1068.167) (-1062.645) (-1065.390) [-1064.552] * (-1064.988) [-1061.884] (-1062.792) (-1064.378) -- 0:01:06
      57500 -- (-1064.718) [-1062.892] (-1064.560) (-1062.041) * [-1065.963] (-1063.807) (-1063.122) (-1064.247) -- 0:01:05
      58000 -- (-1061.549) (-1062.032) (-1064.999) [-1065.627] * (-1064.698) (-1063.120) [-1064.481] (-1064.656) -- 0:01:04
      58500 -- (-1062.887) [-1063.033] (-1063.765) (-1065.108) * (-1067.180) [-1061.642] (-1064.550) (-1064.084) -- 0:01:04
      59000 -- [-1064.132] (-1062.045) (-1065.737) (-1063.383) * (-1066.175) (-1062.319) (-1063.564) [-1064.223] -- 0:01:03
      59500 -- (-1065.981) (-1065.732) (-1065.739) [-1063.233] * (-1067.801) [-1063.726] (-1064.705) (-1073.213) -- 0:01:03
      60000 -- (-1067.981) (-1066.584) [-1067.213] (-1063.598) * (-1063.858) [-1065.965] (-1066.279) (-1067.907) -- 0:01:02

      Average standard deviation of split frequencies: 0.039629

      60500 -- [-1067.267] (-1065.738) (-1063.985) (-1065.638) * (-1065.438) (-1064.326) [-1064.503] (-1067.466) -- 0:01:02
      61000 -- (-1070.713) (-1062.398) (-1065.389) [-1063.080] * (-1066.236) (-1062.654) (-1066.454) [-1065.355] -- 0:01:01
      61500 -- (-1068.078) [-1061.974] (-1064.599) (-1062.040) * (-1065.924) (-1062.459) (-1066.102) [-1063.898] -- 0:01:01
      62000 -- (-1068.905) (-1063.014) [-1062.773] (-1064.042) * (-1074.955) [-1063.161] (-1063.153) (-1066.901) -- 0:01:00
      62500 -- (-1063.983) [-1062.229] (-1064.861) (-1065.628) * (-1065.677) (-1066.479) (-1065.008) [-1066.117] -- 0:01:00
      63000 -- (-1067.243) [-1064.526] (-1065.579) (-1064.402) * (-1065.537) [-1062.897] (-1061.892) (-1065.971) -- 0:00:59
      63500 -- (-1066.406) (-1066.409) (-1064.747) [-1064.184] * [-1063.613] (-1062.000) (-1063.938) (-1064.356) -- 0:00:58
      64000 -- (-1066.600) [-1066.365] (-1064.372) (-1063.759) * (-1067.343) [-1063.335] (-1061.897) (-1064.434) -- 0:00:58
      64500 -- (-1064.241) (-1065.206) (-1064.909) [-1062.022] * [-1064.570] (-1071.269) (-1063.963) (-1065.234) -- 0:00:58
      65000 -- (-1064.452) [-1063.240] (-1063.264) (-1064.383) * (-1066.117) (-1063.311) (-1064.114) [-1065.782] -- 0:00:57

      Average standard deviation of split frequencies: 0.039454

      65500 -- (-1062.344) (-1062.680) (-1063.646) [-1064.193] * [-1066.879] (-1064.123) (-1066.368) (-1065.597) -- 0:00:57
      66000 -- (-1066.928) (-1061.260) (-1063.130) [-1064.492] * [-1065.452] (-1063.063) (-1065.061) (-1066.404) -- 0:00:56
      66500 -- (-1067.579) [-1064.840] (-1064.986) (-1068.352) * (-1065.303) [-1065.276] (-1064.684) (-1062.189) -- 0:01:10
      67000 -- [-1066.715] (-1063.869) (-1068.509) (-1064.518) * (-1067.599) (-1065.848) (-1063.477) [-1062.964] -- 0:01:09
      67500 -- [-1063.072] (-1067.383) (-1065.377) (-1068.472) * (-1065.890) (-1067.725) [-1064.124] (-1065.299) -- 0:01:09
      68000 -- (-1064.813) (-1066.301) (-1065.124) [-1064.898] * (-1063.946) [-1067.801] (-1064.936) (-1063.902) -- 0:01:08
      68500 -- (-1062.212) (-1064.830) [-1061.720] (-1064.418) * [-1064.058] (-1064.322) (-1067.987) (-1070.629) -- 0:01:07
      69000 -- (-1063.686) [-1064.513] (-1064.732) (-1064.442) * (-1062.770) [-1062.450] (-1066.929) (-1063.542) -- 0:01:07
      69500 -- (-1062.374) (-1063.493) [-1063.610] (-1061.904) * (-1064.919) [-1061.706] (-1065.998) (-1065.689) -- 0:01:06
      70000 -- (-1065.919) (-1064.399) [-1062.039] (-1064.683) * (-1063.336) [-1061.349] (-1068.946) (-1063.360) -- 0:01:06

      Average standard deviation of split frequencies: 0.033672

      70500 -- (-1065.607) (-1065.979) [-1064.347] (-1063.186) * (-1064.608) (-1062.823) [-1064.398] (-1064.259) -- 0:01:05
      71000 -- (-1066.332) (-1068.333) (-1064.021) [-1063.443] * (-1066.030) (-1061.372) [-1068.549] (-1067.099) -- 0:01:05
      71500 -- (-1066.804) [-1066.289] (-1064.861) (-1063.060) * [-1065.052] (-1065.746) (-1068.235) (-1067.140) -- 0:01:04
      72000 -- [-1068.195] (-1064.145) (-1064.380) (-1062.019) * (-1063.173) (-1061.225) [-1064.788] (-1066.118) -- 0:01:04
      72500 -- (-1066.159) (-1063.503) (-1065.051) [-1063.471] * [-1063.202] (-1060.902) (-1065.040) (-1064.545) -- 0:01:03
      73000 -- [-1064.329] (-1065.046) (-1063.961) (-1061.749) * (-1062.603) (-1063.048) (-1067.617) [-1062.400] -- 0:01:03
      73500 -- [-1062.846] (-1066.115) (-1066.371) (-1064.021) * (-1066.386) (-1065.776) (-1064.861) [-1064.294] -- 0:01:03
      74000 -- (-1063.855) (-1065.167) [-1063.426] (-1061.883) * [-1062.654] (-1063.460) (-1064.720) (-1066.712) -- 0:01:02
      74500 -- (-1062.243) (-1064.422) (-1063.350) [-1064.571] * (-1064.118) [-1062.370] (-1066.487) (-1063.938) -- 0:01:02
      75000 -- [-1065.098] (-1068.627) (-1064.538) (-1062.408) * (-1063.266) (-1064.617) (-1065.904) [-1061.483] -- 0:01:01

      Average standard deviation of split frequencies: 0.030393

      75500 -- (-1066.077) (-1068.913) (-1063.693) [-1067.109] * (-1063.729) (-1065.520) [-1066.235] (-1062.563) -- 0:01:01
      76000 -- (-1066.346) [-1065.724] (-1062.552) (-1063.993) * [-1064.798] (-1073.720) (-1066.267) (-1064.734) -- 0:01:00
      76500 -- (-1065.946) (-1065.308) (-1067.653) [-1063.638] * (-1063.570) (-1064.208) (-1064.750) [-1062.230] -- 0:01:00
      77000 -- (-1064.538) [-1063.630] (-1064.562) (-1065.619) * (-1064.799) [-1064.521] (-1064.419) (-1063.268) -- 0:00:59
      77500 -- (-1067.522) (-1064.778) [-1065.332] (-1063.757) * (-1065.266) (-1065.099) (-1065.708) [-1067.327] -- 0:00:59
      78000 -- [-1062.373] (-1064.534) (-1062.093) (-1064.694) * [-1062.839] (-1064.811) (-1067.819) (-1063.634) -- 0:00:59
      78500 -- [-1065.319] (-1065.065) (-1063.962) (-1060.827) * (-1064.826) (-1064.367) (-1064.571) [-1062.801] -- 0:00:58
      79000 -- [-1064.635] (-1060.961) (-1063.049) (-1064.753) * (-1063.430) (-1063.356) (-1064.195) [-1063.297] -- 0:00:58
      79500 -- [-1064.737] (-1065.126) (-1066.382) (-1064.287) * (-1064.294) (-1066.084) [-1064.376] (-1062.645) -- 0:00:57
      80000 -- (-1063.826) [-1063.264] (-1063.855) (-1066.807) * (-1064.033) [-1062.395] (-1064.819) (-1064.139) -- 0:00:57

      Average standard deviation of split frequencies: 0.030757

      80500 -- [-1064.291] (-1063.418) (-1066.173) (-1065.932) * (-1062.723) (-1065.325) [-1062.583] (-1065.542) -- 0:01:08
      81000 -- (-1063.198) [-1062.847] (-1064.850) (-1062.908) * [-1061.339] (-1063.682) (-1063.670) (-1066.192) -- 0:01:08
      81500 -- [-1065.016] (-1066.851) (-1066.577) (-1064.095) * (-1064.415) (-1064.928) [-1061.848] (-1063.371) -- 0:01:07
      82000 -- (-1067.095) [-1061.693] (-1066.127) (-1064.367) * (-1064.148) (-1064.589) (-1062.835) [-1063.783] -- 0:01:07
      82500 -- (-1066.327) [-1061.989] (-1072.435) (-1065.469) * (-1065.658) (-1064.287) (-1065.714) [-1062.608] -- 0:01:06
      83000 -- (-1064.050) (-1063.161) (-1068.809) [-1069.320] * (-1062.989) (-1063.435) (-1065.068) [-1064.843] -- 0:01:06
      83500 -- (-1063.663) [-1063.107] (-1069.846) (-1065.294) * (-1063.945) (-1063.925) [-1064.779] (-1063.033) -- 0:01:05
      84000 -- [-1064.122] (-1064.385) (-1065.435) (-1068.220) * [-1061.879] (-1068.940) (-1063.791) (-1062.313) -- 0:01:05
      84500 -- (-1065.457) (-1065.021) [-1068.729] (-1066.009) * [-1063.697] (-1069.400) (-1062.640) (-1067.303) -- 0:01:05
      85000 -- (-1065.237) (-1064.791) (-1062.902) [-1060.957] * (-1065.938) (-1065.939) (-1063.052) [-1063.252] -- 0:01:04

      Average standard deviation of split frequencies: 0.027696

      85500 -- (-1068.193) (-1061.504) [-1064.022] (-1062.955) * (-1066.577) [-1063.981] (-1064.265) (-1063.253) -- 0:01:04
      86000 -- (-1066.390) [-1062.719] (-1062.868) (-1064.771) * (-1063.395) (-1067.741) [-1062.648] (-1062.503) -- 0:01:03
      86500 -- (-1065.507) (-1066.322) (-1064.857) [-1065.409] * (-1064.437) (-1065.513) [-1064.410] (-1064.985) -- 0:01:03
      87000 -- (-1064.745) [-1065.523] (-1064.044) (-1066.833) * [-1062.793] (-1066.110) (-1069.401) (-1064.699) -- 0:01:02
      87500 -- [-1063.523] (-1067.727) (-1065.420) (-1061.633) * [-1064.171] (-1063.997) (-1064.649) (-1063.379) -- 0:01:02
      88000 -- (-1067.409) [-1064.916] (-1065.350) (-1066.728) * (-1063.951) [-1064.229] (-1062.161) (-1063.502) -- 0:01:02
      88500 -- [-1064.658] (-1063.942) (-1062.108) (-1066.239) * (-1064.953) (-1063.761) (-1066.861) [-1064.129] -- 0:01:01
      89000 -- (-1063.713) [-1065.818] (-1062.584) (-1064.151) * (-1068.047) [-1063.830] (-1061.353) (-1063.253) -- 0:01:01
      89500 -- [-1063.744] (-1065.349) (-1062.981) (-1064.703) * [-1062.799] (-1062.031) (-1068.575) (-1066.152) -- 0:01:01
      90000 -- (-1065.602) (-1063.863) (-1066.494) [-1062.289] * (-1062.991) [-1067.703] (-1062.626) (-1067.819) -- 0:01:00

      Average standard deviation of split frequencies: 0.025419

      90500 -- (-1074.389) (-1065.180) [-1063.560] (-1062.615) * [-1063.411] (-1064.636) (-1062.937) (-1064.668) -- 0:01:00
      91000 -- (-1062.930) (-1064.868) [-1062.745] (-1062.108) * (-1063.124) (-1061.851) (-1063.023) [-1061.567] -- 0:00:59
      91500 -- (-1063.691) (-1065.208) [-1064.047] (-1063.263) * (-1067.942) (-1063.715) (-1065.842) [-1064.496] -- 0:00:59
      92000 -- [-1063.084] (-1065.109) (-1062.411) (-1064.158) * (-1065.209) (-1062.848) [-1067.514] (-1066.128) -- 0:00:59
      92500 -- [-1062.793] (-1067.586) (-1067.040) (-1065.026) * [-1063.356] (-1065.259) (-1066.415) (-1068.393) -- 0:00:58
      93000 -- [-1063.629] (-1066.067) (-1064.497) (-1062.539) * [-1061.884] (-1063.800) (-1065.952) (-1063.261) -- 0:00:58
      93500 -- (-1063.653) (-1064.039) (-1066.958) [-1063.356] * [-1062.540] (-1062.627) (-1063.301) (-1066.547) -- 0:00:58
      94000 -- (-1063.232) (-1065.865) [-1064.693] (-1060.137) * (-1063.223) [-1062.438] (-1062.798) (-1065.792) -- 0:00:57
      94500 -- (-1065.690) [-1065.088] (-1064.833) (-1062.652) * (-1065.358) (-1063.479) [-1063.666] (-1064.808) -- 0:01:07
      95000 -- (-1064.395) (-1064.312) (-1064.802) [-1063.170] * (-1064.435) (-1069.213) (-1066.408) [-1065.243] -- 0:01:06

      Average standard deviation of split frequencies: 0.027280

      95500 -- (-1067.132) [-1063.364] (-1065.873) (-1064.472) * (-1062.917) (-1070.604) (-1067.793) [-1065.497] -- 0:01:06
      96000 -- (-1065.306) [-1064.176] (-1065.990) (-1065.148) * (-1064.114) (-1063.595) (-1065.287) [-1063.479] -- 0:01:05
      96500 -- (-1068.155) (-1070.966) [-1063.649] (-1062.340) * (-1063.505) (-1065.753) [-1062.345] (-1064.903) -- 0:01:05
      97000 -- (-1064.224) (-1071.172) [-1063.433] (-1064.710) * (-1062.876) (-1063.937) [-1067.366] (-1065.523) -- 0:01:05
      97500 -- (-1064.625) [-1068.078] (-1062.094) (-1067.056) * [-1065.553] (-1064.208) (-1066.732) (-1065.460) -- 0:01:04
      98000 -- (-1065.043) [-1063.377] (-1061.603) (-1065.188) * (-1064.247) (-1064.103) (-1063.292) [-1064.676] -- 0:01:04
      98500 -- (-1066.017) (-1064.913) (-1063.300) [-1061.258] * (-1061.786) (-1067.765) [-1063.919] (-1065.233) -- 0:01:04
      99000 -- (-1063.340) (-1066.898) (-1061.798) [-1063.835] * [-1066.572] (-1066.052) (-1065.379) (-1066.322) -- 0:01:03
      99500 -- (-1062.514) (-1066.516) [-1063.450] (-1063.861) * (-1062.862) (-1064.627) (-1068.351) [-1064.797] -- 0:01:03
      100000 -- [-1061.735] (-1066.860) (-1062.776) (-1065.985) * (-1069.913) (-1065.129) (-1069.443) [-1064.143] -- 0:01:02

      Average standard deviation of split frequencies: 0.023674

      100500 -- (-1062.828) (-1064.100) [-1065.336] (-1064.893) * (-1064.322) [-1063.403] (-1064.447) (-1064.356) -- 0:01:02
      101000 -- [-1062.491] (-1065.778) (-1063.509) (-1066.132) * (-1063.507) (-1063.347) [-1065.410] (-1064.935) -- 0:01:02
      101500 -- (-1063.031) (-1065.461) (-1065.602) [-1063.501] * [-1062.510] (-1063.362) (-1067.196) (-1063.181) -- 0:01:01
      102000 -- (-1066.729) (-1067.963) [-1063.294] (-1062.502) * [-1063.892] (-1062.578) (-1064.445) (-1065.215) -- 0:01:01
      102500 -- (-1063.656) [-1066.359] (-1063.336) (-1062.634) * (-1064.556) (-1063.913) (-1066.626) [-1064.941] -- 0:01:01
      103000 -- [-1062.932] (-1066.195) (-1062.997) (-1063.232) * (-1063.944) (-1064.212) [-1064.040] (-1064.471) -- 0:01:00
      103500 -- (-1063.646) (-1067.242) (-1062.302) [-1065.066] * (-1065.089) (-1064.112) (-1066.942) [-1064.312] -- 0:01:00
      104000 -- (-1066.648) (-1066.677) (-1062.280) [-1061.950] * [-1062.033] (-1064.893) (-1065.482) (-1062.131) -- 0:01:00
      104500 -- [-1070.220] (-1065.943) (-1064.117) (-1064.407) * (-1061.310) (-1065.060) (-1066.216) [-1067.426] -- 0:00:59
      105000 -- (-1065.071) [-1065.962] (-1070.584) (-1060.644) * (-1063.578) [-1064.975] (-1065.169) (-1065.215) -- 0:00:59

      Average standard deviation of split frequencies: 0.022483

      105500 -- (-1063.454) (-1066.018) (-1065.794) [-1062.450] * [-1060.615] (-1061.277) (-1064.194) (-1066.434) -- 0:00:59
      106000 -- (-1064.896) (-1065.589) (-1063.484) [-1062.943] * [-1062.369] (-1063.688) (-1065.806) (-1068.597) -- 0:00:59
      106500 -- [-1065.724] (-1063.374) (-1064.444) (-1064.527) * [-1063.308] (-1064.641) (-1066.650) (-1063.750) -- 0:00:58
      107000 -- [-1064.609] (-1062.245) (-1064.442) (-1062.780) * (-1064.210) (-1062.689) (-1064.959) [-1065.065] -- 0:00:58
      107500 -- (-1065.346) (-1064.816) (-1064.616) [-1062.448] * [-1063.907] (-1064.969) (-1064.792) (-1063.595) -- 0:00:58
      108000 -- (-1062.765) (-1066.081) (-1065.113) [-1064.998] * (-1063.150) (-1062.343) (-1065.377) [-1064.804] -- 0:00:57
      108500 -- [-1063.887] (-1066.322) (-1066.635) (-1065.641) * (-1061.032) [-1061.280] (-1065.246) (-1063.729) -- 0:00:57
      109000 -- (-1065.969) (-1069.266) (-1069.543) [-1065.534] * [-1063.437] (-1064.976) (-1069.993) (-1068.578) -- 0:00:57
      109500 -- [-1065.339] (-1065.914) (-1066.692) (-1068.653) * (-1065.815) (-1064.063) (-1066.241) [-1062.842] -- 0:00:56
      110000 -- (-1067.362) [-1064.657] (-1061.657) (-1062.162) * (-1065.326) (-1063.411) (-1065.244) [-1060.775] -- 0:01:04

      Average standard deviation of split frequencies: 0.021074

      110500 -- (-1067.616) [-1064.039] (-1062.517) (-1067.251) * (-1069.826) (-1066.821) [-1063.767] (-1066.166) -- 0:01:04
      111000 -- (-1065.094) (-1065.807) [-1067.460] (-1064.267) * [-1064.558] (-1063.138) (-1064.674) (-1064.748) -- 0:01:04
      111500 -- [-1063.902] (-1065.462) (-1062.404) (-1068.436) * [-1065.957] (-1064.482) (-1063.951) (-1065.890) -- 0:01:03
      112000 -- (-1066.314) [-1065.089] (-1064.045) (-1063.847) * (-1065.271) (-1063.157) [-1063.633] (-1066.762) -- 0:01:03
      112500 -- (-1066.504) (-1064.359) (-1064.870) [-1065.205] * (-1070.545) (-1065.519) (-1065.403) [-1062.958] -- 0:01:03
      113000 -- (-1063.332) [-1066.560] (-1063.477) (-1063.992) * (-1071.464) [-1063.135] (-1075.917) (-1062.549) -- 0:01:02
      113500 -- [-1064.282] (-1061.944) (-1062.243) (-1064.825) * (-1071.437) (-1063.647) [-1067.445] (-1063.885) -- 0:01:02
      114000 -- (-1066.437) [-1064.252] (-1065.275) (-1064.347) * (-1063.392) [-1062.507] (-1064.736) (-1066.251) -- 0:01:02
      114500 -- [-1065.476] (-1061.321) (-1065.651) (-1064.485) * (-1064.756) [-1063.900] (-1067.798) (-1061.628) -- 0:01:01
      115000 -- (-1062.653) (-1062.350) (-1063.448) [-1066.718] * (-1063.470) (-1064.184) (-1064.678) [-1064.272] -- 0:01:01

      Average standard deviation of split frequencies: 0.019891

      115500 -- (-1063.969) (-1064.000) [-1066.390] (-1064.885) * (-1063.650) (-1068.662) [-1062.941] (-1066.342) -- 0:01:01
      116000 -- (-1062.973) [-1062.195] (-1068.710) (-1066.984) * (-1062.895) (-1064.297) (-1064.396) [-1065.773] -- 0:01:00
      116500 -- [-1064.952] (-1063.600) (-1066.617) (-1065.925) * (-1063.579) [-1063.120] (-1064.198) (-1067.596) -- 0:01:00
      117000 -- [-1065.609] (-1062.226) (-1064.355) (-1064.388) * (-1062.348) [-1062.321] (-1065.203) (-1066.381) -- 0:01:00
      117500 -- (-1064.547) (-1064.973) (-1064.714) [-1067.400] * (-1063.408) [-1063.953] (-1061.900) (-1064.265) -- 0:01:00
      118000 -- [-1063.906] (-1063.214) (-1062.114) (-1068.923) * (-1065.555) (-1065.295) (-1063.804) [-1068.016] -- 0:00:59
      118500 -- (-1064.497) (-1061.140) (-1065.924) [-1064.570] * (-1064.796) [-1062.656] (-1070.171) (-1064.339) -- 0:00:59
      119000 -- (-1068.510) (-1061.258) [-1062.647] (-1064.821) * (-1064.124) [-1063.571] (-1065.131) (-1063.135) -- 0:00:59
      119500 -- (-1066.295) (-1062.373) [-1065.832] (-1066.328) * [-1065.378] (-1066.535) (-1064.974) (-1062.293) -- 0:00:58
      120000 -- (-1064.654) (-1062.460) (-1063.893) [-1066.134] * (-1065.276) (-1065.513) (-1066.215) [-1063.586] -- 0:00:58

      Average standard deviation of split frequencies: 0.019750

      120500 -- (-1065.353) [-1061.950] (-1062.938) (-1063.153) * (-1067.269) (-1063.735) (-1064.043) [-1066.687] -- 0:00:58
      121000 -- [-1062.838] (-1062.069) (-1063.084) (-1063.366) * (-1064.608) [-1064.826] (-1066.529) (-1065.278) -- 0:00:58
      121500 -- (-1064.967) [-1062.134] (-1067.891) (-1064.054) * [-1063.639] (-1065.477) (-1065.519) (-1065.869) -- 0:00:57
      122000 -- (-1065.723) (-1065.144) [-1062.826] (-1063.798) * (-1062.188) [-1061.987] (-1064.626) (-1070.468) -- 0:00:57
      122500 -- (-1065.667) (-1066.205) (-1068.062) [-1065.505] * [-1063.583] (-1065.118) (-1065.794) (-1066.594) -- 0:00:57
      123000 -- [-1066.055] (-1065.021) (-1065.196) (-1063.973) * (-1064.483) (-1063.194) (-1064.199) [-1060.378] -- 0:00:57
      123500 -- [-1066.593] (-1064.012) (-1064.636) (-1063.072) * (-1065.362) (-1064.251) [-1063.231] (-1066.893) -- 0:00:56
      124000 -- (-1064.809) [-1063.852] (-1064.961) (-1067.196) * [-1064.010] (-1063.368) (-1065.698) (-1070.840) -- 0:00:56
      124500 -- (-1065.615) [-1066.169] (-1064.836) (-1065.762) * (-1062.477) (-1062.914) (-1065.344) [-1063.093] -- 0:00:56
      125000 -- [-1063.476] (-1068.871) (-1065.266) (-1065.288) * (-1069.825) (-1063.754) [-1065.673] (-1062.514) -- 0:01:03

      Average standard deviation of split frequencies: 0.018083

      125500 -- (-1063.254) [-1064.113] (-1067.009) (-1065.453) * [-1065.349] (-1066.597) (-1064.033) (-1062.062) -- 0:01:02
      126000 -- [-1064.261] (-1064.342) (-1062.532) (-1063.715) * (-1065.590) [-1062.283] (-1065.886) (-1063.274) -- 0:01:02
      126500 -- (-1065.025) (-1068.366) [-1063.649] (-1063.493) * (-1067.572) (-1066.613) (-1071.059) [-1062.219] -- 0:01:02
      127000 -- [-1063.740] (-1065.095) (-1067.757) (-1066.384) * (-1064.630) (-1064.466) (-1063.996) [-1065.724] -- 0:01:01
      127500 -- (-1067.725) (-1066.083) (-1067.059) [-1066.241] * (-1069.975) (-1064.610) (-1063.575) [-1062.405] -- 0:01:01
      128000 -- (-1066.987) (-1066.780) [-1065.640] (-1068.304) * (-1065.308) (-1063.392) [-1062.878] (-1063.815) -- 0:01:01
      128500 -- (-1069.847) (-1065.541) [-1065.231] (-1062.481) * (-1061.189) (-1065.334) (-1066.367) [-1063.021] -- 0:01:01
      129000 -- (-1067.253) [-1067.131] (-1066.430) (-1061.645) * [-1061.080] (-1063.035) (-1065.790) (-1063.764) -- 0:01:00
      129500 -- (-1066.027) [-1065.153] (-1064.621) (-1066.210) * (-1064.665) (-1063.772) (-1067.883) [-1062.100] -- 0:01:00
      130000 -- (-1068.190) (-1065.374) [-1064.644] (-1062.517) * (-1063.012) (-1063.204) (-1064.245) [-1062.632] -- 0:01:00

      Average standard deviation of split frequencies: 0.018760

      130500 -- (-1065.039) (-1065.947) (-1066.583) [-1065.846] * (-1070.528) (-1067.014) [-1064.679] (-1063.100) -- 0:00:59
      131000 -- (-1069.214) (-1063.555) [-1061.589] (-1064.707) * (-1068.363) [-1063.955] (-1063.538) (-1065.051) -- 0:00:59
      131500 -- (-1065.085) [-1064.670] (-1062.405) (-1066.711) * (-1064.711) (-1065.918) (-1063.959) [-1064.204] -- 0:00:59
      132000 -- [-1064.780] (-1065.778) (-1064.448) (-1066.136) * (-1063.797) [-1066.628] (-1063.415) (-1064.675) -- 0:00:59
      132500 -- (-1067.653) [-1061.834] (-1065.791) (-1063.405) * (-1065.082) (-1066.799) (-1066.182) [-1063.041] -- 0:00:58
      133000 -- (-1068.133) [-1063.105] (-1066.650) (-1061.335) * (-1063.596) (-1065.718) [-1066.163] (-1063.327) -- 0:00:58
      133500 -- [-1066.181] (-1064.336) (-1064.193) (-1065.456) * (-1065.168) (-1064.231) [-1063.809] (-1064.757) -- 0:00:58
      134000 -- (-1064.900) (-1063.254) [-1063.319] (-1063.343) * (-1063.070) (-1062.416) (-1065.682) [-1060.256] -- 0:00:58
      134500 -- (-1063.399) [-1064.065] (-1064.521) (-1065.546) * (-1067.072) (-1063.308) [-1065.404] (-1062.405) -- 0:00:57
      135000 -- (-1070.404) (-1065.449) [-1063.340] (-1065.168) * (-1064.193) (-1061.262) (-1067.847) [-1064.116] -- 0:00:57

      Average standard deviation of split frequencies: 0.016368

      135500 -- (-1063.842) [-1063.171] (-1063.603) (-1065.310) * (-1066.980) (-1065.154) [-1063.247] (-1066.671) -- 0:00:57
      136000 -- [-1062.637] (-1065.759) (-1071.536) (-1065.129) * (-1066.640) [-1065.836] (-1064.442) (-1065.915) -- 0:00:57
      136500 -- (-1064.578) [-1064.074] (-1063.990) (-1065.110) * (-1064.705) (-1063.875) (-1064.196) [-1064.361] -- 0:00:56
      137000 -- (-1066.288) (-1070.423) (-1064.169) [-1062.207] * (-1065.148) (-1065.511) [-1065.526] (-1065.203) -- 0:00:56
      137500 -- [-1066.003] (-1070.491) (-1062.799) (-1065.265) * (-1062.626) (-1066.137) (-1064.477) [-1062.810] -- 0:00:56
      138000 -- (-1066.040) (-1065.083) [-1063.234] (-1062.138) * (-1063.819) (-1064.814) (-1065.802) [-1062.947] -- 0:00:56
      138500 -- (-1062.672) (-1063.156) [-1063.814] (-1063.775) * [-1062.292] (-1064.627) (-1063.440) (-1065.787) -- 0:00:55
      139000 -- (-1062.908) [-1061.420] (-1063.747) (-1066.167) * [-1064.251] (-1065.628) (-1066.126) (-1064.980) -- 0:00:55
      139500 -- [-1064.351] (-1064.057) (-1063.204) (-1063.230) * (-1064.337) [-1063.294] (-1066.261) (-1068.762) -- 0:00:55
      140000 -- (-1065.429) (-1061.728) [-1061.982] (-1068.720) * (-1063.168) (-1062.606) (-1067.032) [-1064.681] -- 0:00:55

      Average standard deviation of split frequencies: 0.017991

      140500 -- (-1064.230) (-1065.001) (-1065.361) [-1062.701] * [-1063.071] (-1062.402) (-1064.048) (-1062.701) -- 0:01:01
      141000 -- (-1063.389) [-1062.051] (-1062.671) (-1066.407) * (-1062.130) (-1061.210) [-1063.915] (-1062.703) -- 0:01:00
      141500 -- (-1063.356) (-1064.237) (-1062.882) [-1065.605] * [-1061.881] (-1062.939) (-1065.773) (-1068.821) -- 0:01:00
      142000 -- (-1065.290) (-1066.287) [-1062.720] (-1063.191) * (-1063.522) (-1063.037) [-1063.526] (-1066.213) -- 0:01:00
      142500 -- [-1064.976] (-1064.993) (-1062.540) (-1064.813) * (-1063.885) (-1063.157) [-1062.237] (-1064.758) -- 0:01:00
      143000 -- (-1068.479) (-1062.716) (-1062.337) [-1060.927] * (-1066.585) (-1061.867) (-1063.041) [-1062.523] -- 0:00:59
      143500 -- (-1064.781) [-1062.479] (-1063.300) (-1065.165) * (-1063.951) [-1064.593] (-1064.166) (-1064.842) -- 0:00:59
      144000 -- (-1063.188) (-1064.471) (-1064.268) [-1060.737] * [-1062.061] (-1062.848) (-1063.928) (-1064.313) -- 0:00:59
      144500 -- (-1065.506) [-1062.430] (-1064.186) (-1063.550) * [-1064.950] (-1064.103) (-1066.691) (-1065.192) -- 0:00:59
      145000 -- (-1064.114) [-1062.557] (-1071.334) (-1064.453) * (-1064.715) (-1062.388) (-1064.823) [-1064.834] -- 0:00:58

      Average standard deviation of split frequencies: 0.018404

      145500 -- (-1063.821) [-1063.596] (-1065.702) (-1061.780) * (-1067.110) (-1062.418) (-1065.132) [-1066.918] -- 0:00:58
      146000 -- [-1062.189] (-1065.591) (-1063.701) (-1063.587) * (-1063.714) (-1060.196) (-1063.051) [-1063.766] -- 0:00:58
      146500 -- (-1064.262) (-1066.484) (-1062.398) [-1064.794] * [-1061.010] (-1063.285) (-1066.370) (-1067.672) -- 0:00:58
      147000 -- (-1065.314) (-1062.224) (-1065.371) [-1061.904] * (-1064.516) (-1064.872) (-1071.036) [-1065.124] -- 0:00:58
      147500 -- (-1065.774) [-1065.027] (-1061.666) (-1062.977) * (-1065.042) [-1065.165] (-1068.776) (-1063.293) -- 0:00:57
      148000 -- [-1063.832] (-1064.459) (-1062.405) (-1064.897) * (-1065.723) [-1065.940] (-1064.531) (-1061.630) -- 0:00:57
      148500 -- (-1065.107) [-1064.535] (-1062.799) (-1062.911) * [-1063.015] (-1064.245) (-1065.102) (-1063.798) -- 0:00:57
      149000 -- (-1067.901) (-1066.585) [-1062.636] (-1062.221) * (-1061.968) (-1062.118) (-1063.662) [-1064.179] -- 0:00:57
      149500 -- (-1063.672) (-1066.913) [-1062.592] (-1065.132) * (-1061.256) (-1064.735) (-1066.023) [-1067.501] -- 0:00:56
      150000 -- [-1065.444] (-1064.375) (-1063.766) (-1064.945) * [-1063.519] (-1065.357) (-1064.654) (-1064.040) -- 0:00:56

      Average standard deviation of split frequencies: 0.017291

      150500 -- [-1065.407] (-1063.941) (-1067.526) (-1064.195) * (-1064.466) (-1067.928) [-1064.499] (-1064.011) -- 0:00:56
      151000 -- (-1065.984) (-1064.208) [-1064.857] (-1068.456) * (-1070.702) (-1065.208) (-1067.817) [-1064.053] -- 0:00:56
      151500 -- [-1065.393] (-1064.933) (-1064.687) (-1066.374) * (-1064.832) (-1064.940) (-1068.733) [-1062.426] -- 0:00:56
      152000 -- [-1066.053] (-1064.628) (-1064.572) (-1064.525) * [-1066.354] (-1064.260) (-1067.918) (-1064.144) -- 0:00:55
      152500 -- (-1064.712) [-1065.869] (-1066.101) (-1065.827) * (-1071.015) (-1063.357) (-1069.089) [-1064.436] -- 0:00:55
      153000 -- (-1062.796) (-1065.907) (-1066.332) [-1060.860] * (-1070.624) (-1063.662) (-1064.582) [-1066.792] -- 0:00:55
      153500 -- (-1066.755) (-1065.633) (-1062.749) [-1062.780] * (-1069.609) [-1062.877] (-1065.267) (-1065.240) -- 0:00:55
      154000 -- (-1065.535) (-1066.560) [-1065.249] (-1064.116) * (-1066.306) (-1063.489) [-1064.181] (-1067.948) -- 0:00:54
      154500 -- (-1063.344) (-1065.024) (-1067.056) [-1063.379] * [-1062.627] (-1061.891) (-1063.476) (-1069.483) -- 0:00:54
      155000 -- (-1061.827) [-1062.948] (-1065.124) (-1062.785) * (-1062.155) (-1063.466) (-1065.285) [-1063.561] -- 0:00:54

      Average standard deviation of split frequencies: 0.016381

      155500 -- (-1064.335) (-1064.309) (-1065.690) [-1060.801] * (-1061.544) (-1064.035) (-1066.870) [-1064.803] -- 0:00:59
      156000 -- (-1063.574) [-1065.357] (-1065.337) (-1062.246) * (-1064.553) (-1062.683) [-1066.491] (-1065.955) -- 0:00:59
      156500 -- [-1064.771] (-1065.178) (-1064.991) (-1065.007) * (-1067.549) [-1062.405] (-1064.863) (-1070.649) -- 0:00:59
      157000 -- (-1065.084) [-1064.485] (-1064.991) (-1063.316) * [-1063.660] (-1064.053) (-1065.678) (-1062.900) -- 0:00:59
      157500 -- (-1061.633) [-1063.752] (-1064.978) (-1065.647) * (-1063.666) (-1064.432) (-1066.315) [-1064.281] -- 0:00:58
      158000 -- (-1064.141) (-1066.424) [-1068.036] (-1063.280) * (-1062.990) (-1064.777) (-1066.097) [-1061.683] -- 0:00:58
      158500 -- (-1066.109) (-1065.358) (-1066.164) [-1064.478] * (-1066.302) [-1067.172] (-1066.821) (-1061.997) -- 0:00:58
      159000 -- (-1065.118) (-1065.576) (-1065.432) [-1065.883] * [-1064.095] (-1065.655) (-1067.304) (-1062.795) -- 0:00:58
      159500 -- (-1070.324) (-1064.096) [-1063.872] (-1068.986) * (-1067.711) (-1066.258) [-1066.065] (-1061.289) -- 0:00:57
      160000 -- (-1069.704) [-1065.002] (-1063.045) (-1066.168) * [-1066.262] (-1064.985) (-1062.563) (-1065.801) -- 0:00:57

      Average standard deviation of split frequencies: 0.017141

      160500 -- (-1063.886) (-1063.964) (-1066.770) [-1065.138] * [-1064.937] (-1062.873) (-1065.464) (-1064.953) -- 0:00:57
      161000 -- (-1062.695) (-1064.735) [-1066.288] (-1066.379) * (-1065.136) [-1064.408] (-1066.206) (-1063.403) -- 0:00:57
      161500 -- (-1066.138) [-1064.014] (-1072.267) (-1061.253) * (-1066.291) (-1064.849) [-1064.999] (-1067.744) -- 0:00:57
      162000 -- [-1064.985] (-1066.510) (-1064.002) (-1064.750) * (-1064.515) (-1068.089) [-1064.655] (-1068.251) -- 0:00:56
      162500 -- (-1064.166) [-1063.951] (-1065.549) (-1061.760) * [-1064.689] (-1067.280) (-1062.574) (-1066.892) -- 0:00:56
      163000 -- (-1064.043) (-1065.055) (-1065.489) [-1063.380] * (-1062.996) (-1062.977) (-1068.688) [-1069.638] -- 0:00:56
      163500 -- (-1063.482) (-1062.557) (-1065.039) [-1065.565] * (-1064.524) [-1064.373] (-1065.649) (-1067.444) -- 0:00:56
      164000 -- (-1065.659) (-1064.155) [-1065.735] (-1065.217) * (-1065.320) [-1062.545] (-1066.797) (-1069.331) -- 0:00:56
      164500 -- (-1066.408) (-1065.167) [-1064.722] (-1066.597) * (-1064.139) (-1063.459) (-1064.294) [-1067.157] -- 0:00:55
      165000 -- [-1066.514] (-1064.769) (-1064.371) (-1069.312) * (-1063.974) (-1064.212) [-1064.996] (-1063.635) -- 0:00:55

      Average standard deviation of split frequencies: 0.017487

      165500 -- [-1065.223] (-1065.104) (-1065.730) (-1063.271) * (-1064.604) (-1063.466) [-1064.960] (-1063.783) -- 0:00:55
      166000 -- (-1069.600) (-1065.441) (-1064.506) [-1064.044] * (-1064.829) [-1063.939] (-1064.214) (-1066.596) -- 0:00:55
      166500 -- (-1067.499) [-1062.328] (-1064.078) (-1065.468) * [-1066.255] (-1064.480) (-1067.471) (-1064.655) -- 0:00:55
      167000 -- [-1064.622] (-1063.695) (-1064.093) (-1064.583) * (-1066.393) (-1065.438) (-1064.677) [-1063.511] -- 0:00:54
      167500 -- (-1064.027) [-1062.858] (-1069.712) (-1064.155) * (-1068.422) (-1064.858) (-1064.780) [-1065.820] -- 0:00:54
      168000 -- (-1067.147) (-1062.600) (-1065.124) [-1063.872] * (-1071.394) (-1065.925) [-1064.593] (-1065.800) -- 0:00:54
      168500 -- (-1067.670) (-1062.558) [-1064.682] (-1065.129) * (-1063.722) (-1066.554) (-1065.728) [-1063.489] -- 0:00:54
      169000 -- (-1065.126) (-1064.910) (-1068.116) [-1063.543] * (-1067.473) [-1066.061] (-1067.968) (-1070.949) -- 0:00:54
      169500 -- [-1064.651] (-1064.432) (-1065.559) (-1064.986) * (-1067.629) (-1067.923) (-1066.393) [-1066.879] -- 0:00:53
      170000 -- [-1067.079] (-1063.018) (-1065.364) (-1065.774) * (-1067.704) [-1064.295] (-1070.496) (-1062.470) -- 0:00:53

      Average standard deviation of split frequencies: 0.016718

      170500 -- (-1063.612) (-1063.508) [-1063.371] (-1065.099) * (-1067.035) [-1063.101] (-1065.897) (-1066.208) -- 0:00:58
      171000 -- (-1065.798) (-1064.823) [-1062.893] (-1063.292) * (-1066.356) (-1064.320) [-1066.125] (-1064.060) -- 0:00:58
      171500 -- [-1065.261] (-1066.911) (-1066.614) (-1064.121) * (-1065.153) (-1062.471) [-1064.875] (-1063.765) -- 0:00:57
      172000 -- [-1066.050] (-1068.117) (-1065.459) (-1064.045) * [-1064.292] (-1066.295) (-1065.221) (-1065.904) -- 0:00:57
      172500 -- (-1064.283) [-1066.619] (-1068.555) (-1064.580) * (-1064.419) (-1065.366) [-1068.306] (-1064.308) -- 0:00:57
      173000 -- (-1066.953) [-1065.015] (-1064.736) (-1065.238) * (-1062.942) (-1064.083) [-1064.862] (-1067.114) -- 0:00:57
      173500 -- (-1067.006) (-1062.913) [-1064.325] (-1062.606) * (-1065.801) (-1066.686) [-1065.317] (-1067.170) -- 0:00:57
      174000 -- (-1068.674) [-1066.452] (-1062.948) (-1063.883) * (-1062.236) (-1068.397) (-1063.113) [-1065.699] -- 0:00:56
      174500 -- (-1064.363) [-1064.869] (-1062.869) (-1065.485) * (-1066.634) (-1066.467) (-1063.537) [-1064.987] -- 0:00:56
      175000 -- (-1064.725) [-1063.606] (-1064.561) (-1067.260) * [-1063.798] (-1064.227) (-1064.426) (-1069.137) -- 0:00:56

      Average standard deviation of split frequencies: 0.015803

      175500 -- (-1064.572) [-1067.977] (-1064.268) (-1066.000) * (-1067.301) (-1069.359) (-1065.239) [-1067.613] -- 0:00:56
      176000 -- (-1065.405) (-1065.946) [-1063.443] (-1070.783) * (-1064.603) (-1065.122) (-1064.863) [-1065.052] -- 0:00:56
      176500 -- (-1064.867) [-1066.039] (-1062.683) (-1068.267) * (-1067.675) (-1064.916) [-1065.118] (-1063.853) -- 0:00:55
      177000 -- (-1068.284) (-1067.616) (-1063.959) [-1063.466] * (-1064.974) (-1066.923) (-1067.551) [-1061.871] -- 0:00:55
      177500 -- (-1070.224) [-1069.643] (-1065.905) (-1062.231) * (-1064.421) (-1063.727) (-1065.532) [-1063.530] -- 0:00:55
      178000 -- (-1070.143) [-1066.632] (-1067.665) (-1064.996) * (-1065.100) [-1063.129] (-1065.582) (-1065.220) -- 0:00:55
      178500 -- (-1066.159) [-1064.818] (-1065.382) (-1064.114) * (-1068.393) (-1062.202) [-1062.647] (-1063.223) -- 0:00:55
      179000 -- (-1064.436) [-1067.786] (-1069.714) (-1067.713) * [-1066.509] (-1064.321) (-1064.606) (-1065.312) -- 0:00:55
      179500 -- (-1064.303) (-1064.936) (-1063.469) [-1062.481] * (-1065.838) (-1065.339) [-1061.935] (-1063.913) -- 0:00:54
      180000 -- (-1065.142) [-1063.170] (-1065.817) (-1064.495) * (-1066.423) (-1066.139) [-1066.136] (-1065.488) -- 0:00:54

      Average standard deviation of split frequencies: 0.012032

      180500 -- [-1068.146] (-1063.042) (-1067.294) (-1064.617) * (-1072.199) (-1063.882) [-1061.814] (-1069.164) -- 0:00:54
      181000 -- (-1069.095) [-1064.155] (-1063.301) (-1065.862) * (-1069.511) (-1065.607) [-1064.278] (-1065.090) -- 0:00:54
      181500 -- [-1066.043] (-1067.149) (-1062.096) (-1064.904) * [-1066.118] (-1062.497) (-1066.225) (-1062.928) -- 0:00:54
      182000 -- (-1065.014) (-1063.315) (-1064.214) [-1064.481] * (-1063.030) (-1064.263) [-1064.112] (-1068.380) -- 0:00:53
      182500 -- [-1066.153] (-1063.377) (-1066.472) (-1061.470) * [-1064.897] (-1065.549) (-1063.098) (-1067.300) -- 0:00:53
      183000 -- (-1064.342) (-1064.842) [-1067.653] (-1063.562) * [-1065.055] (-1065.540) (-1065.887) (-1065.586) -- 0:00:53
      183500 -- (-1063.641) (-1063.477) [-1066.499] (-1064.457) * [-1063.570] (-1066.966) (-1066.331) (-1064.550) -- 0:00:53
      184000 -- (-1063.760) (-1064.933) (-1066.642) [-1063.571] * [-1066.435] (-1066.927) (-1070.304) (-1067.635) -- 0:00:53
      184500 -- (-1065.137) (-1061.897) (-1064.164) [-1066.330] * (-1065.886) (-1070.614) (-1067.789) [-1066.429] -- 0:00:53
      185000 -- (-1062.467) (-1062.745) (-1063.144) [-1064.021] * [-1063.899] (-1066.491) (-1063.688) (-1066.571) -- 0:00:52

      Average standard deviation of split frequencies: 0.013716

      185500 -- (-1064.769) (-1064.026) [-1064.530] (-1066.453) * (-1062.631) [-1064.978] (-1068.391) (-1063.165) -- 0:00:57
      186000 -- (-1067.009) (-1067.608) (-1066.281) [-1065.083] * (-1063.577) (-1067.422) [-1063.444] (-1064.115) -- 0:00:56
      186500 -- (-1065.828) (-1067.291) (-1067.483) [-1063.593] * (-1062.894) (-1064.415) [-1062.265] (-1070.540) -- 0:00:56
      187000 -- [-1067.564] (-1061.945) (-1063.271) (-1068.902) * [-1065.502] (-1063.784) (-1063.901) (-1072.537) -- 0:00:56
      187500 -- (-1067.527) (-1067.737) (-1063.362) [-1064.466] * [-1065.351] (-1062.081) (-1065.837) (-1072.568) -- 0:00:56
      188000 -- (-1065.317) (-1064.655) (-1066.230) [-1062.823] * (-1066.348) [-1064.754] (-1067.320) (-1069.498) -- 0:00:56
      188500 -- (-1065.089) (-1063.373) [-1061.222] (-1063.687) * (-1064.371) (-1065.934) [-1067.699] (-1067.797) -- 0:00:55
      189000 -- (-1063.231) (-1063.411) [-1062.874] (-1069.525) * (-1062.911) [-1064.606] (-1063.764) (-1069.841) -- 0:00:55
      189500 -- [-1065.094] (-1063.175) (-1063.577) (-1066.233) * (-1063.060) [-1063.883] (-1063.787) (-1071.852) -- 0:00:55
      190000 -- (-1065.234) (-1064.346) [-1064.349] (-1068.078) * (-1066.377) [-1063.732] (-1064.584) (-1065.775) -- 0:00:55

      Average standard deviation of split frequencies: 0.012225

      190500 -- (-1066.006) (-1062.799) [-1063.739] (-1062.949) * (-1065.319) (-1064.632) [-1062.134] (-1066.335) -- 0:00:55
      191000 -- (-1063.704) [-1063.120] (-1063.777) (-1064.648) * (-1061.658) (-1063.778) (-1066.861) [-1062.165] -- 0:00:55
      191500 -- (-1066.761) [-1062.676] (-1065.950) (-1065.704) * (-1062.335) (-1068.168) [-1064.235] (-1062.282) -- 0:00:54
      192000 -- (-1063.827) (-1064.432) [-1068.348] (-1064.462) * [-1062.199] (-1061.008) (-1068.262) (-1065.848) -- 0:00:54
      192500 -- [-1065.010] (-1065.162) (-1063.739) (-1062.870) * (-1067.114) (-1067.095) [-1064.972] (-1065.018) -- 0:00:54
      193000 -- (-1064.952) (-1064.896) (-1064.008) [-1063.740] * (-1066.622) [-1064.984] (-1066.233) (-1064.870) -- 0:00:54
      193500 -- (-1063.619) (-1067.688) [-1067.507] (-1064.863) * [-1067.116] (-1066.011) (-1063.325) (-1064.342) -- 0:00:54
      194000 -- (-1064.848) (-1067.845) [-1064.868] (-1065.995) * [-1061.359] (-1064.740) (-1067.044) (-1063.410) -- 0:00:54
      194500 -- (-1062.538) (-1064.842) (-1068.642) [-1069.539] * (-1061.742) [-1062.334] (-1068.406) (-1063.070) -- 0:00:53
      195000 -- [-1063.767] (-1065.087) (-1067.251) (-1063.342) * (-1062.285) (-1065.491) [-1066.611] (-1065.867) -- 0:00:53

      Average standard deviation of split frequencies: 0.012159

      195500 -- [-1063.277] (-1066.421) (-1070.236) (-1065.104) * [-1064.558] (-1064.626) (-1067.855) (-1066.130) -- 0:00:53
      196000 -- (-1064.080) (-1065.526) [-1068.570] (-1065.084) * (-1063.476) (-1062.905) (-1066.007) [-1063.937] -- 0:00:53
      196500 -- [-1063.281] (-1063.706) (-1068.296) (-1065.006) * (-1063.598) [-1065.097] (-1069.642) (-1064.205) -- 0:00:53
      197000 -- [-1062.805] (-1065.298) (-1063.182) (-1062.529) * (-1064.573) (-1066.941) (-1064.834) [-1065.622] -- 0:00:52
      197500 -- (-1064.453) [-1064.807] (-1065.368) (-1068.473) * (-1064.737) (-1066.534) [-1064.443] (-1067.205) -- 0:00:52
      198000 -- [-1064.933] (-1067.013) (-1069.669) (-1066.183) * (-1068.187) (-1065.428) [-1064.333] (-1067.772) -- 0:00:52
      198500 -- [-1065.485] (-1064.233) (-1067.230) (-1064.875) * (-1061.475) (-1069.094) [-1065.767] (-1064.047) -- 0:00:52
      199000 -- (-1064.411) (-1064.539) (-1063.570) [-1063.663] * (-1065.775) (-1065.564) [-1064.697] (-1067.082) -- 0:00:52
      199500 -- (-1063.442) (-1065.524) (-1063.425) [-1064.278] * (-1065.400) [-1061.296] (-1064.424) (-1066.181) -- 0:00:52
      200000 -- (-1064.233) (-1065.498) [-1063.721] (-1063.877) * (-1064.875) [-1063.484] (-1063.251) (-1065.231) -- 0:00:51

      Average standard deviation of split frequencies: 0.012161

      200500 -- (-1065.676) [-1062.703] (-1067.793) (-1064.142) * (-1065.272) (-1063.457) [-1065.831] (-1063.073) -- 0:00:55
      201000 -- (-1066.859) (-1064.420) [-1067.591] (-1064.287) * (-1069.051) [-1063.214] (-1064.917) (-1066.115) -- 0:00:55
      201500 -- (-1066.611) (-1065.777) [-1063.385] (-1064.885) * (-1062.785) [-1061.315] (-1065.822) (-1064.142) -- 0:00:55
      202000 -- (-1065.553) [-1065.727] (-1062.675) (-1065.349) * (-1062.103) (-1063.127) (-1066.622) [-1068.683] -- 0:00:55
      202500 -- [-1067.338] (-1066.513) (-1067.283) (-1067.409) * [-1062.784] (-1066.075) (-1064.755) (-1064.501) -- 0:00:55
      203000 -- (-1064.604) [-1066.705] (-1064.438) (-1065.225) * (-1062.959) (-1065.460) (-1063.128) [-1064.447] -- 0:00:54
      203500 -- [-1064.554] (-1065.942) (-1065.214) (-1063.319) * (-1061.937) (-1064.783) (-1067.964) [-1065.405] -- 0:00:54
      204000 -- (-1064.517) (-1066.907) [-1063.753] (-1065.919) * [-1063.602] (-1063.783) (-1063.502) (-1065.233) -- 0:00:54
      204500 -- (-1065.945) (-1065.155) [-1063.978] (-1064.100) * [-1065.075] (-1065.315) (-1065.642) (-1064.329) -- 0:00:54
      205000 -- [-1067.123] (-1065.410) (-1064.372) (-1064.492) * (-1063.353) (-1068.020) [-1062.441] (-1065.353) -- 0:00:54

      Average standard deviation of split frequencies: 0.013095

      205500 -- (-1063.404) [-1065.586] (-1069.561) (-1070.684) * (-1063.027) (-1067.792) [-1063.907] (-1063.019) -- 0:00:54
      206000 -- [-1063.724] (-1065.848) (-1074.800) (-1065.010) * [-1066.529] (-1070.668) (-1068.218) (-1063.962) -- 0:00:53
      206500 -- (-1064.827) (-1065.623) [-1068.990] (-1064.438) * (-1063.196) (-1067.385) [-1067.285] (-1066.576) -- 0:00:53
      207000 -- (-1063.653) (-1067.709) (-1067.496) [-1063.888] * [-1063.656] (-1064.515) (-1068.311) (-1064.436) -- 0:00:53
      207500 -- (-1066.451) (-1067.187) (-1067.591) [-1063.034] * [-1061.416] (-1067.086) (-1064.457) (-1066.682) -- 0:00:53
      208000 -- (-1060.983) [-1066.302] (-1067.813) (-1063.986) * (-1062.984) [-1065.099] (-1066.254) (-1065.172) -- 0:00:53
      208500 -- (-1063.451) [-1064.585] (-1067.307) (-1063.979) * [-1062.094] (-1062.771) (-1065.249) (-1067.935) -- 0:00:53
      209000 -- (-1065.477) [-1064.460] (-1068.373) (-1062.770) * (-1064.202) (-1061.918) (-1064.941) [-1067.022] -- 0:00:52
      209500 -- (-1062.991) (-1065.257) [-1063.954] (-1063.016) * (-1063.292) (-1062.744) [-1065.244] (-1065.118) -- 0:00:52
      210000 -- (-1063.771) (-1063.844) (-1068.095) [-1064.384] * [-1062.759] (-1066.477) (-1066.236) (-1064.096) -- 0:00:52

      Average standard deviation of split frequencies: 0.011313

      210500 -- (-1063.077) (-1064.612) (-1069.471) [-1064.070] * (-1063.635) (-1065.409) (-1066.523) [-1065.030] -- 0:00:52
      211000 -- (-1063.011) (-1066.507) (-1065.388) [-1069.288] * (-1063.009) (-1063.839) (-1062.738) [-1063.754] -- 0:00:52
      211500 -- (-1064.663) [-1067.687] (-1072.414) (-1063.829) * (-1063.379) [-1063.517] (-1068.588) (-1065.178) -- 0:00:52
      212000 -- [-1062.175] (-1066.375) (-1065.149) (-1065.279) * (-1065.260) (-1063.593) (-1066.069) [-1063.724] -- 0:00:52
      212500 -- [-1062.889] (-1063.810) (-1063.937) (-1063.010) * (-1066.322) [-1064.589] (-1067.849) (-1065.327) -- 0:00:51
      213000 -- (-1066.286) (-1064.684) [-1064.482] (-1065.654) * (-1066.866) [-1062.898] (-1071.396) (-1063.535) -- 0:00:51
      213500 -- (-1062.935) [-1065.088] (-1067.085) (-1063.412) * [-1063.714] (-1062.531) (-1067.801) (-1065.023) -- 0:00:51
      214000 -- [-1061.600] (-1065.432) (-1067.093) (-1065.003) * (-1067.279) [-1063.526] (-1065.936) (-1063.022) -- 0:00:51
      214500 -- (-1063.891) [-1065.952] (-1064.272) (-1063.179) * (-1065.949) [-1064.296] (-1065.338) (-1064.549) -- 0:00:51
      215000 -- (-1064.554) (-1067.170) [-1064.441] (-1064.271) * (-1068.853) (-1065.098) (-1064.111) [-1064.243] -- 0:00:51

      Average standard deviation of split frequencies: 0.008858

      215500 -- (-1063.234) (-1066.137) (-1063.389) [-1063.095] * (-1066.255) [-1062.487] (-1063.331) (-1063.777) -- 0:00:54
      216000 -- [-1063.661] (-1067.107) (-1062.501) (-1067.596) * (-1066.307) (-1063.110) [-1064.658] (-1066.317) -- 0:00:54
      216500 -- (-1064.686) (-1063.221) [-1062.933] (-1066.626) * (-1066.511) (-1064.972) [-1062.642] (-1065.274) -- 0:00:54
      217000 -- [-1067.864] (-1072.411) (-1063.844) (-1062.938) * (-1065.794) (-1062.947) (-1062.878) [-1065.555] -- 0:00:54
      217500 -- (-1064.582) (-1066.762) [-1065.265] (-1064.337) * (-1070.329) (-1064.106) [-1061.638] (-1063.481) -- 0:00:53
      218000 -- (-1065.274) (-1067.968) [-1063.217] (-1062.651) * [-1062.160] (-1063.123) (-1062.918) (-1069.700) -- 0:00:53
      218500 -- (-1064.953) (-1066.231) (-1063.219) [-1065.453] * [-1066.720] (-1062.360) (-1067.216) (-1068.433) -- 0:00:53
      219000 -- (-1063.282) (-1066.100) [-1064.460] (-1064.307) * (-1063.522) (-1064.564) [-1064.752] (-1063.923) -- 0:00:53
      219500 -- (-1066.231) (-1064.947) [-1062.486] (-1066.163) * [-1062.092] (-1065.405) (-1065.001) (-1063.188) -- 0:00:53
      220000 -- (-1064.640) (-1065.972) [-1064.773] (-1066.082) * (-1065.007) [-1062.892] (-1065.607) (-1067.150) -- 0:00:53

      Average standard deviation of split frequencies: 0.009213

      220500 -- (-1065.621) (-1064.712) [-1061.649] (-1063.473) * [-1064.322] (-1063.368) (-1064.311) (-1064.352) -- 0:00:53
      221000 -- [-1063.710] (-1064.332) (-1065.034) (-1064.251) * [-1061.874] (-1064.262) (-1066.092) (-1065.576) -- 0:00:52
      221500 -- (-1061.756) (-1064.859) [-1064.610] (-1064.528) * [-1062.731] (-1067.362) (-1063.550) (-1064.121) -- 0:00:52
      222000 -- (-1065.583) (-1066.099) (-1062.512) [-1061.515] * (-1062.866) [-1065.475] (-1064.088) (-1064.647) -- 0:00:52
      222500 -- (-1064.971) (-1067.643) [-1066.735] (-1064.919) * (-1063.661) (-1066.508) (-1063.953) [-1062.231] -- 0:00:52
      223000 -- (-1068.294) (-1066.752) [-1065.124] (-1068.075) * (-1064.013) [-1063.518] (-1064.126) (-1065.376) -- 0:00:52
      223500 -- (-1065.170) (-1063.745) [-1063.147] (-1066.597) * (-1064.970) (-1063.234) (-1066.867) [-1063.007] -- 0:00:52
      224000 -- (-1064.944) (-1067.147) [-1064.645] (-1067.150) * [-1062.033] (-1064.970) (-1064.523) (-1065.864) -- 0:00:51
      224500 -- [-1068.286] (-1065.031) (-1063.980) (-1065.101) * (-1063.269) (-1063.881) [-1063.453] (-1064.092) -- 0:00:51
      225000 -- (-1066.927) [-1064.005] (-1066.870) (-1068.900) * (-1066.074) (-1064.072) (-1066.148) [-1062.911] -- 0:00:51

      Average standard deviation of split frequencies: 0.009816

      225500 -- [-1066.613] (-1064.349) (-1063.343) (-1067.291) * (-1064.974) (-1068.138) [-1065.293] (-1064.029) -- 0:00:51
      226000 -- (-1066.857) [-1066.499] (-1063.466) (-1065.087) * [-1062.935] (-1065.065) (-1064.301) (-1064.188) -- 0:00:51
      226500 -- [-1065.922] (-1065.678) (-1065.538) (-1065.442) * [-1063.102] (-1065.819) (-1065.892) (-1063.265) -- 0:00:51
      227000 -- (-1064.379) [-1065.664] (-1065.854) (-1065.991) * (-1064.426) (-1063.435) (-1064.786) [-1065.657] -- 0:00:51
      227500 -- [-1063.515] (-1069.906) (-1065.002) (-1067.669) * (-1065.828) (-1065.562) (-1066.114) [-1063.889] -- 0:00:50
      228000 -- (-1066.673) [-1066.476] (-1063.516) (-1066.875) * (-1061.586) (-1065.468) [-1067.089] (-1064.954) -- 0:00:50
      228500 -- (-1063.398) (-1066.955) [-1063.150] (-1063.136) * (-1064.618) (-1063.903) (-1065.100) [-1065.150] -- 0:00:50
      229000 -- (-1067.914) (-1065.673) (-1061.181) [-1064.779] * (-1061.958) (-1070.236) [-1066.519] (-1065.334) -- 0:00:50
      229500 -- (-1065.120) (-1063.183) (-1062.959) [-1067.651] * [-1067.520] (-1065.234) (-1066.120) (-1065.942) -- 0:00:50
      230000 -- (-1066.819) (-1063.674) [-1061.594] (-1066.861) * (-1063.742) (-1062.023) [-1066.061] (-1067.250) -- 0:00:50

      Average standard deviation of split frequencies: 0.009497

      230500 -- (-1065.425) (-1062.847) (-1062.955) [-1067.436] * (-1064.982) (-1066.840) (-1068.605) [-1065.381] -- 0:00:53
      231000 -- [-1065.083] (-1066.551) (-1063.941) (-1066.539) * [-1062.382] (-1069.350) (-1063.334) (-1064.062) -- 0:00:53
      231500 -- (-1065.841) [-1065.600] (-1066.014) (-1070.144) * (-1064.600) (-1068.551) [-1062.599] (-1067.347) -- 0:00:53
      232000 -- [-1064.663] (-1063.707) (-1069.310) (-1064.578) * [-1063.875] (-1066.042) (-1062.244) (-1065.472) -- 0:00:52
      232500 -- (-1063.889) (-1063.011) (-1064.151) [-1065.661] * (-1065.637) [-1064.893] (-1064.575) (-1069.845) -- 0:00:52
      233000 -- (-1065.182) (-1062.636) [-1062.764] (-1071.989) * (-1065.377) [-1064.413] (-1063.581) (-1070.852) -- 0:00:52
      233500 -- (-1066.732) [-1062.568] (-1068.502) (-1069.368) * (-1066.246) (-1062.095) (-1064.116) [-1065.541] -- 0:00:52
      234000 -- (-1066.303) [-1066.887] (-1067.165) (-1065.301) * (-1064.724) [-1064.031] (-1064.147) (-1068.056) -- 0:00:52
      234500 -- (-1063.121) (-1067.351) (-1064.984) [-1064.328] * [-1063.004] (-1065.110) (-1064.577) (-1061.893) -- 0:00:52
      235000 -- (-1070.989) (-1066.113) [-1065.700] (-1063.398) * [-1064.187] (-1066.910) (-1062.736) (-1064.071) -- 0:00:52

      Average standard deviation of split frequencies: 0.010237

      235500 -- (-1066.288) (-1065.089) (-1066.819) [-1064.355] * (-1065.788) (-1063.472) [-1065.722] (-1063.100) -- 0:00:51
      236000 -- [-1063.184] (-1063.966) (-1064.882) (-1065.775) * [-1065.253] (-1064.716) (-1063.249) (-1066.545) -- 0:00:51
      236500 -- (-1067.584) (-1063.304) [-1065.055] (-1064.925) * (-1065.807) (-1066.892) (-1068.724) [-1069.827] -- 0:00:51
      237000 -- (-1064.223) (-1064.290) (-1064.149) [-1064.547] * [-1067.042] (-1063.812) (-1064.917) (-1062.876) -- 0:00:51
      237500 -- (-1065.347) [-1064.625] (-1063.420) (-1069.625) * (-1061.737) (-1065.854) [-1061.969] (-1063.071) -- 0:00:51
      238000 -- (-1065.848) [-1063.754] (-1064.249) (-1064.618) * (-1065.205) [-1063.895] (-1062.423) (-1061.847) -- 0:00:51
      238500 -- (-1062.942) (-1063.744) (-1066.351) [-1064.746] * (-1063.113) [-1064.014] (-1065.597) (-1064.096) -- 0:00:51
      239000 -- (-1064.148) (-1064.601) (-1063.998) [-1062.896] * (-1066.925) (-1067.527) (-1063.863) [-1062.968] -- 0:00:50
      239500 -- (-1064.829) (-1065.865) (-1067.475) [-1065.868] * [-1063.281] (-1065.899) (-1064.190) (-1065.580) -- 0:00:50
      240000 -- [-1065.213] (-1065.725) (-1064.017) (-1065.396) * (-1066.106) [-1064.782] (-1064.310) (-1063.346) -- 0:00:50

      Average standard deviation of split frequencies: 0.008987

      240500 -- (-1063.014) [-1065.896] (-1067.187) (-1064.552) * [-1063.614] (-1064.660) (-1066.539) (-1067.339) -- 0:00:50
      241000 -- (-1063.146) (-1063.855) [-1066.059] (-1063.030) * (-1064.508) (-1065.367) [-1065.731] (-1067.297) -- 0:00:50
      241500 -- (-1066.432) (-1062.450) [-1063.989] (-1066.006) * [-1062.899] (-1063.561) (-1066.647) (-1065.816) -- 0:00:50
      242000 -- (-1068.386) [-1066.431] (-1065.750) (-1066.701) * [-1062.112] (-1063.081) (-1065.719) (-1063.828) -- 0:00:50
      242500 -- (-1074.035) [-1063.936] (-1065.916) (-1065.786) * (-1063.544) (-1066.101) [-1063.652] (-1063.327) -- 0:00:49
      243000 -- (-1064.330) (-1063.426) (-1070.285) [-1065.068] * (-1061.824) [-1064.432] (-1064.436) (-1064.728) -- 0:00:49
      243500 -- (-1065.792) (-1064.579) (-1066.867) [-1064.732] * (-1065.119) (-1066.536) [-1064.231] (-1066.496) -- 0:00:49
      244000 -- (-1066.061) (-1064.804) [-1067.061] (-1064.924) * [-1061.497] (-1065.975) (-1066.095) (-1065.217) -- 0:00:49
      244500 -- [-1067.224] (-1062.597) (-1067.018) (-1065.000) * (-1065.008) (-1064.767) (-1064.864) [-1063.112] -- 0:00:49
      245000 -- (-1066.736) [-1063.248] (-1065.934) (-1067.527) * (-1063.565) (-1065.209) (-1064.329) [-1064.482] -- 0:00:49

      Average standard deviation of split frequencies: 0.011817

      245500 -- (-1067.735) (-1065.429) [-1064.259] (-1065.415) * [-1062.985] (-1064.534) (-1064.774) (-1063.043) -- 0:00:49
      246000 -- (-1064.181) (-1068.254) (-1064.311) [-1063.578] * [-1062.176] (-1066.654) (-1062.318) (-1064.280) -- 0:00:52
      246500 -- [-1064.181] (-1068.388) (-1068.558) (-1065.612) * [-1063.568] (-1065.541) (-1065.660) (-1066.657) -- 0:00:51
      247000 -- (-1064.849) [-1062.001] (-1067.383) (-1064.452) * [-1063.134] (-1062.376) (-1066.477) (-1062.795) -- 0:00:51
      247500 -- (-1065.143) (-1063.091) [-1069.036] (-1063.747) * (-1062.859) [-1061.094] (-1070.387) (-1064.162) -- 0:00:51
      248000 -- (-1066.356) (-1063.112) [-1064.667] (-1064.308) * (-1066.289) [-1062.743] (-1064.230) (-1066.031) -- 0:00:51
      248500 -- (-1066.151) (-1064.094) [-1061.857] (-1069.796) * (-1060.861) [-1061.744] (-1066.184) (-1064.981) -- 0:00:51
      249000 -- (-1063.083) [-1063.651] (-1063.739) (-1067.928) * (-1066.184) (-1065.401) [-1068.848] (-1066.855) -- 0:00:51
      249500 -- (-1062.930) (-1067.523) (-1065.340) [-1064.441] * (-1063.162) [-1063.236] (-1065.283) (-1066.076) -- 0:00:51
      250000 -- [-1060.352] (-1064.626) (-1066.002) (-1065.538) * (-1065.014) (-1064.844) (-1066.913) [-1066.282] -- 0:00:51

      Average standard deviation of split frequencies: 0.012867

      250500 -- [-1068.884] (-1062.559) (-1063.194) (-1064.678) * (-1065.951) [-1064.437] (-1062.862) (-1065.855) -- 0:00:50
      251000 -- [-1063.000] (-1064.690) (-1064.541) (-1067.599) * (-1061.566) (-1066.463) (-1066.967) [-1064.809] -- 0:00:50
      251500 -- (-1060.697) (-1063.981) (-1062.564) [-1065.184] * [-1062.795] (-1064.232) (-1063.822) (-1067.630) -- 0:00:50
      252000 -- (-1061.111) [-1065.932] (-1065.226) (-1066.094) * (-1062.817) (-1066.400) [-1064.980] (-1066.529) -- 0:00:50
      252500 -- (-1061.517) (-1068.224) [-1061.052] (-1064.817) * (-1062.326) (-1064.435) [-1066.870] (-1066.595) -- 0:00:50
      253000 -- (-1060.917) (-1067.415) [-1062.193] (-1066.927) * (-1063.149) (-1066.410) [-1064.794] (-1067.564) -- 0:00:50
      253500 -- [-1062.268] (-1065.994) (-1071.906) (-1066.070) * [-1064.264] (-1065.954) (-1063.786) (-1067.261) -- 0:00:50
      254000 -- [-1062.988] (-1070.506) (-1062.750) (-1064.932) * (-1064.877) (-1064.587) [-1063.580] (-1063.675) -- 0:00:49
      254500 -- (-1062.622) (-1067.507) [-1061.631] (-1065.074) * [-1069.278] (-1066.136) (-1063.190) (-1061.500) -- 0:00:49
      255000 -- (-1063.440) (-1064.019) (-1065.715) [-1065.705] * (-1062.193) (-1063.797) [-1064.494] (-1065.448) -- 0:00:49

      Average standard deviation of split frequencies: 0.012788

      255500 -- [-1062.457] (-1063.364) (-1061.130) (-1065.904) * (-1063.496) (-1067.171) [-1065.487] (-1065.167) -- 0:00:49
      256000 -- (-1074.100) [-1062.587] (-1062.694) (-1067.315) * [-1061.330] (-1066.111) (-1066.862) (-1065.091) -- 0:00:49
      256500 -- (-1066.198) (-1063.453) [-1061.309] (-1066.137) * [-1061.338] (-1064.419) (-1068.526) (-1064.649) -- 0:00:49
      257000 -- (-1063.629) (-1065.747) (-1065.165) [-1069.725] * (-1062.757) (-1064.838) [-1065.698] (-1064.969) -- 0:00:49
      257500 -- (-1065.459) (-1064.802) [-1063.004] (-1065.477) * (-1068.289) (-1064.339) [-1065.435] (-1067.967) -- 0:00:49
      258000 -- (-1063.767) (-1067.232) (-1063.939) [-1067.355] * (-1062.097) (-1064.228) [-1066.091] (-1066.064) -- 0:00:48
      258500 -- (-1062.550) (-1065.930) [-1063.215] (-1062.344) * (-1064.323) [-1064.166] (-1067.048) (-1065.578) -- 0:00:48
      259000 -- (-1066.112) [-1065.626] (-1069.297) (-1066.196) * (-1062.512) [-1066.903] (-1061.964) (-1062.430) -- 0:00:48
      259500 -- [-1062.260] (-1067.858) (-1064.300) (-1065.746) * (-1062.576) (-1065.315) (-1067.002) [-1064.963] -- 0:00:48
      260000 -- (-1063.259) (-1066.396) [-1063.858] (-1066.330) * (-1063.414) (-1062.381) (-1065.718) [-1068.808] -- 0:00:48

      Average standard deviation of split frequencies: 0.013262

      260500 -- (-1063.163) (-1063.905) (-1064.081) [-1065.880] * (-1066.279) (-1065.253) [-1066.162] (-1065.249) -- 0:00:48
      261000 -- (-1065.151) (-1065.263) (-1066.392) [-1063.656] * (-1063.813) [-1065.711] (-1064.616) (-1063.712) -- 0:00:50
      261500 -- [-1064.286] (-1064.639) (-1063.731) (-1070.358) * (-1066.805) (-1069.947) (-1065.241) [-1064.800] -- 0:00:50
      262000 -- (-1064.142) (-1065.689) (-1066.639) [-1064.292] * (-1064.863) (-1065.072) [-1065.325] (-1063.665) -- 0:00:50
      262500 -- (-1066.677) (-1063.648) (-1066.610) [-1065.316] * (-1066.057) (-1068.396) [-1067.207] (-1070.102) -- 0:00:50
      263000 -- (-1066.245) (-1063.689) (-1063.670) [-1066.214] * (-1063.091) (-1067.262) (-1065.399) [-1063.992] -- 0:00:50
      263500 -- (-1065.238) (-1063.378) [-1066.191] (-1066.316) * (-1068.652) (-1063.771) (-1065.419) [-1061.902] -- 0:00:50
      264000 -- (-1065.770) [-1068.132] (-1062.796) (-1066.156) * [-1062.952] (-1063.220) (-1063.335) (-1065.376) -- 0:00:50
      264500 -- (-1065.628) [-1062.961] (-1067.210) (-1065.114) * (-1066.254) [-1064.273] (-1064.949) (-1065.047) -- 0:00:50
      265000 -- [-1062.624] (-1067.432) (-1062.259) (-1065.334) * (-1067.074) (-1067.943) [-1068.973] (-1065.326) -- 0:00:49

      Average standard deviation of split frequencies: 0.012701

      265500 -- [-1064.350] (-1064.002) (-1063.518) (-1067.146) * (-1064.157) [-1068.348] (-1069.399) (-1064.460) -- 0:00:49
      266000 -- (-1068.668) (-1063.993) [-1063.397] (-1064.542) * (-1066.227) (-1064.650) [-1066.414] (-1065.457) -- 0:00:49
      266500 -- [-1062.099] (-1063.695) (-1067.932) (-1064.013) * [-1063.591] (-1065.562) (-1064.315) (-1064.381) -- 0:00:49
      267000 -- (-1065.847) [-1063.634] (-1063.314) (-1064.534) * (-1062.444) [-1064.174] (-1062.513) (-1065.740) -- 0:00:49
      267500 -- (-1064.180) (-1066.261) (-1063.946) [-1064.933] * (-1062.770) [-1069.193] (-1064.489) (-1068.356) -- 0:00:49
      268000 -- (-1062.421) (-1066.857) [-1062.512] (-1065.749) * (-1061.101) (-1066.628) [-1066.303] (-1064.124) -- 0:00:49
      268500 -- [-1068.061] (-1070.268) (-1071.604) (-1064.333) * (-1063.877) [-1064.327] (-1064.592) (-1064.267) -- 0:00:49
      269000 -- (-1062.319) (-1068.460) (-1065.738) [-1065.366] * (-1064.014) (-1064.811) (-1067.895) [-1066.403] -- 0:00:48
      269500 -- (-1063.776) [-1067.964] (-1065.373) (-1074.023) * (-1065.080) [-1063.635] (-1062.479) (-1067.916) -- 0:00:48
      270000 -- (-1064.614) (-1063.964) [-1065.526] (-1066.526) * [-1064.413] (-1069.289) (-1061.912) (-1064.259) -- 0:00:48

      Average standard deviation of split frequencies: 0.010552

      270500 -- [-1063.562] (-1064.369) (-1066.396) (-1065.039) * (-1062.553) (-1065.948) (-1064.767) [-1064.554] -- 0:00:48
      271000 -- [-1065.195] (-1065.579) (-1066.901) (-1066.942) * (-1068.686) [-1062.178] (-1063.546) (-1065.178) -- 0:00:48
      271500 -- (-1064.721) [-1066.565] (-1068.746) (-1067.937) * (-1065.585) (-1067.725) [-1063.535] (-1063.325) -- 0:00:48
      272000 -- (-1062.716) [-1064.307] (-1065.900) (-1065.628) * (-1066.524) [-1063.479] (-1061.938) (-1066.127) -- 0:00:48
      272500 -- (-1061.752) (-1061.474) (-1065.646) [-1064.814] * (-1065.775) (-1065.005) [-1063.483] (-1070.947) -- 0:00:48
      273000 -- (-1066.473) (-1063.777) (-1065.169) [-1064.990] * (-1065.932) (-1063.892) [-1062.255] (-1063.386) -- 0:00:47
      273500 -- [-1064.992] (-1065.743) (-1064.798) (-1065.302) * (-1062.863) (-1063.112) [-1064.553] (-1063.316) -- 0:00:47
      274000 -- [-1063.826] (-1069.571) (-1064.740) (-1068.738) * [-1062.507] (-1065.504) (-1061.176) (-1063.460) -- 0:00:47
      274500 -- (-1064.576) (-1064.353) [-1062.637] (-1065.081) * (-1065.759) (-1069.136) (-1063.897) [-1062.646] -- 0:00:47
      275000 -- (-1063.706) (-1070.561) (-1063.356) [-1064.123] * (-1065.007) (-1064.779) (-1067.102) [-1065.980] -- 0:00:47

      Average standard deviation of split frequencies: 0.010549

      275500 -- (-1063.565) (-1063.931) [-1064.362] (-1063.292) * [-1063.361] (-1069.372) (-1069.431) (-1065.815) -- 0:00:47
      276000 -- (-1062.655) [-1063.919] (-1063.990) (-1065.168) * (-1065.592) (-1068.590) (-1066.461) [-1063.329] -- 0:00:47
      276500 -- (-1065.766) (-1063.320) [-1066.787] (-1064.353) * (-1066.827) (-1068.810) [-1064.303] (-1063.901) -- 0:00:49
      277000 -- (-1063.270) (-1064.897) [-1062.285] (-1066.282) * (-1070.242) [-1064.500] (-1065.627) (-1067.228) -- 0:00:49
      277500 -- [-1062.444] (-1064.407) (-1064.058) (-1064.472) * (-1065.905) (-1068.679) (-1067.851) [-1064.682] -- 0:00:49
      278000 -- (-1062.013) (-1066.245) (-1068.121) [-1064.660] * (-1066.110) (-1063.526) (-1063.752) [-1063.271] -- 0:00:49
      278500 -- [-1064.388] (-1062.558) (-1067.153) (-1063.920) * (-1062.318) (-1065.169) (-1065.479) [-1062.152] -- 0:00:49
      279000 -- (-1063.940) (-1068.642) (-1064.058) [-1066.198] * (-1064.276) (-1064.540) (-1065.923) [-1065.400] -- 0:00:49
      279500 -- (-1065.094) (-1065.420) [-1065.905] (-1066.687) * [-1062.835] (-1065.700) (-1065.283) (-1064.760) -- 0:00:48
      280000 -- (-1064.869) (-1068.237) [-1065.014] (-1069.622) * (-1066.104) [-1065.454] (-1067.495) (-1063.086) -- 0:00:48

      Average standard deviation of split frequencies: 0.012912

      280500 -- [-1062.387] (-1065.026) (-1062.534) (-1063.788) * (-1064.709) (-1066.280) (-1066.209) [-1062.948] -- 0:00:48
      281000 -- (-1065.721) (-1063.630) [-1062.679] (-1069.080) * (-1064.674) (-1067.251) [-1067.857] (-1067.162) -- 0:00:48
      281500 -- (-1063.300) [-1066.752] (-1071.126) (-1067.901) * (-1064.179) (-1067.878) [-1065.220] (-1062.709) -- 0:00:48
      282000 -- (-1066.725) [-1063.248] (-1064.872) (-1063.572) * (-1065.647) (-1063.879) (-1066.068) [-1061.393] -- 0:00:48
      282500 -- (-1063.234) [-1061.002] (-1064.905) (-1063.901) * [-1064.567] (-1069.497) (-1064.352) (-1062.164) -- 0:00:48
      283000 -- (-1062.398) [-1062.306] (-1062.751) (-1064.988) * (-1064.309) (-1066.022) (-1063.795) [-1065.439] -- 0:00:48
      283500 -- [-1065.762] (-1067.472) (-1064.428) (-1065.008) * [-1065.372] (-1066.785) (-1068.236) (-1063.367) -- 0:00:48
      284000 -- (-1065.407) [-1063.018] (-1063.571) (-1069.691) * [-1070.536] (-1065.201) (-1065.961) (-1063.327) -- 0:00:47
      284500 -- (-1068.292) [-1062.465] (-1065.597) (-1062.777) * (-1064.297) (-1065.922) [-1064.716] (-1063.033) -- 0:00:47
      285000 -- (-1061.627) (-1064.094) (-1066.901) [-1063.946] * (-1065.282) (-1068.735) [-1065.790] (-1064.125) -- 0:00:47

      Average standard deviation of split frequencies: 0.012798

      285500 -- [-1063.545] (-1065.021) (-1066.289) (-1063.884) * (-1065.164) (-1063.369) (-1064.509) [-1069.748] -- 0:00:47
      286000 -- [-1065.308] (-1069.169) (-1067.258) (-1064.274) * (-1063.859) (-1066.046) [-1066.639] (-1064.617) -- 0:00:47
      286500 -- [-1064.008] (-1066.555) (-1068.895) (-1066.456) * (-1064.942) [-1067.023] (-1063.852) (-1065.148) -- 0:00:47
      287000 -- (-1064.298) (-1064.986) (-1063.571) [-1069.149] * (-1067.638) (-1067.860) [-1062.879] (-1063.103) -- 0:00:47
      287500 -- [-1063.675] (-1066.343) (-1065.940) (-1065.691) * (-1064.848) [-1066.134] (-1064.699) (-1063.967) -- 0:00:47
      288000 -- (-1063.137) (-1064.835) [-1065.413] (-1065.297) * (-1066.543) (-1063.446) (-1065.683) [-1061.181] -- 0:00:46
      288500 -- (-1064.899) [-1062.135] (-1063.646) (-1065.604) * [-1066.543] (-1066.484) (-1063.745) (-1064.796) -- 0:00:46
      289000 -- (-1063.863) (-1065.540) [-1060.237] (-1062.679) * (-1062.927) (-1062.147) [-1062.795] (-1064.271) -- 0:00:46
      289500 -- (-1063.061) [-1066.263] (-1063.771) (-1064.209) * (-1061.821) (-1062.268) [-1066.068] (-1067.001) -- 0:00:46
      290000 -- [-1062.502] (-1065.158) (-1063.534) (-1067.239) * (-1061.921) (-1065.779) [-1066.233] (-1065.010) -- 0:00:46

      Average standard deviation of split frequencies: 0.012497

      290500 -- [-1061.249] (-1063.649) (-1064.078) (-1065.861) * (-1065.866) [-1064.487] (-1065.617) (-1065.849) -- 0:00:46
      291000 -- (-1065.229) (-1063.698) [-1063.740] (-1065.479) * (-1064.055) (-1068.418) [-1065.479] (-1067.567) -- 0:00:46
      291500 -- (-1063.123) (-1066.301) (-1063.430) [-1064.706] * (-1066.382) [-1065.215] (-1068.385) (-1063.022) -- 0:00:48
      292000 -- (-1064.574) (-1064.441) [-1065.862] (-1065.799) * (-1062.659) [-1063.315] (-1063.000) (-1064.402) -- 0:00:48
      292500 -- (-1072.307) (-1065.072) [-1064.266] (-1065.710) * [-1062.522] (-1065.540) (-1065.349) (-1066.680) -- 0:00:48
      293000 -- (-1063.947) (-1063.076) [-1063.559] (-1068.014) * [-1061.551] (-1065.676) (-1070.661) (-1062.029) -- 0:00:48
      293500 -- (-1070.459) [-1062.920] (-1063.700) (-1065.501) * [-1065.365] (-1064.383) (-1064.635) (-1064.092) -- 0:00:48
      294000 -- (-1063.911) (-1063.692) [-1066.117] (-1070.144) * [-1064.432] (-1065.114) (-1065.189) (-1061.992) -- 0:00:48
      294500 -- [-1063.427] (-1064.358) (-1066.350) (-1065.751) * (-1063.842) (-1066.685) (-1065.616) [-1062.347] -- 0:00:47
      295000 -- (-1064.804) (-1065.559) [-1060.735] (-1065.216) * (-1062.474) (-1069.819) (-1066.517) [-1062.554] -- 0:00:47

      Average standard deviation of split frequencies: 0.012840

      295500 -- (-1061.400) [-1062.042] (-1063.251) (-1064.298) * [-1062.035] (-1064.356) (-1069.788) (-1062.902) -- 0:00:47
      296000 -- (-1063.845) [-1064.643] (-1072.223) (-1070.756) * (-1062.198) (-1063.673) (-1063.263) [-1062.553] -- 0:00:47
      296500 -- (-1066.374) [-1065.096] (-1065.306) (-1065.104) * (-1062.819) (-1065.020) (-1066.007) [-1064.099] -- 0:00:47
      297000 -- (-1062.845) [-1063.117] (-1065.520) (-1066.138) * [-1062.298] (-1063.831) (-1064.884) (-1061.730) -- 0:00:47
      297500 -- (-1063.669) (-1065.117) [-1067.263] (-1064.565) * (-1065.750) (-1064.639) [-1065.797] (-1063.537) -- 0:00:47
      298000 -- (-1065.807) (-1064.345) [-1062.079] (-1064.710) * [-1061.380] (-1062.432) (-1065.731) (-1064.565) -- 0:00:47
      298500 -- (-1065.018) [-1062.059] (-1063.314) (-1065.606) * (-1065.825) [-1063.803] (-1065.199) (-1064.310) -- 0:00:47
      299000 -- (-1066.548) (-1066.194) [-1065.239] (-1065.792) * [-1062.243] (-1066.360) (-1064.511) (-1065.023) -- 0:00:46
      299500 -- (-1065.645) [-1064.578] (-1064.071) (-1065.985) * [-1062.929] (-1063.985) (-1065.532) (-1064.498) -- 0:00:46
      300000 -- (-1064.929) (-1066.996) (-1066.062) [-1064.162] * (-1066.050) (-1065.148) (-1066.636) [-1063.501] -- 0:00:46

      Average standard deviation of split frequencies: 0.015033

      300500 -- [-1063.010] (-1069.980) (-1065.911) (-1064.965) * (-1065.459) (-1066.464) (-1065.905) [-1063.531] -- 0:00:46
      301000 -- (-1066.763) (-1062.488) (-1064.851) [-1064.714] * (-1066.126) [-1071.135] (-1063.582) (-1068.068) -- 0:00:46
      301500 -- [-1061.533] (-1066.204) (-1064.840) (-1064.342) * (-1062.814) [-1066.347] (-1063.772) (-1064.551) -- 0:00:46
      302000 -- (-1064.381) (-1066.917) [-1065.191] (-1066.743) * [-1064.034] (-1065.819) (-1066.127) (-1064.891) -- 0:00:46
      302500 -- (-1066.387) [-1061.084] (-1067.670) (-1064.986) * (-1063.523) (-1068.542) [-1067.622] (-1063.136) -- 0:00:46
      303000 -- (-1065.902) (-1065.477) (-1069.829) [-1067.604] * [-1062.455] (-1066.900) (-1067.114) (-1065.039) -- 0:00:46
      303500 -- (-1064.431) (-1061.490) [-1065.857] (-1065.104) * (-1064.673) (-1063.543) [-1067.200] (-1069.130) -- 0:00:45
      304000 -- (-1062.158) (-1062.467) (-1065.272) [-1065.620] * (-1061.710) [-1065.663] (-1066.866) (-1067.019) -- 0:00:45
      304500 -- (-1063.508) [-1064.435] (-1064.567) (-1062.742) * (-1068.728) (-1065.501) [-1061.001] (-1065.126) -- 0:00:45
      305000 -- (-1066.923) [-1063.198] (-1063.188) (-1064.467) * (-1070.065) (-1066.068) (-1063.518) [-1064.544] -- 0:00:45

      Average standard deviation of split frequencies: 0.014838

      305500 -- (-1067.375) [-1063.694] (-1064.329) (-1063.759) * (-1070.197) (-1065.443) [-1067.964] (-1063.844) -- 0:00:45
      306000 -- [-1064.507] (-1064.148) (-1065.193) (-1065.764) * (-1071.705) [-1070.406] (-1067.003) (-1064.775) -- 0:00:45
      306500 -- [-1063.520] (-1063.853) (-1065.034) (-1063.229) * (-1064.406) (-1064.348) (-1062.793) [-1065.147] -- 0:00:47
      307000 -- (-1061.146) [-1064.123] (-1067.667) (-1066.294) * [-1064.307] (-1064.026) (-1064.662) (-1062.956) -- 0:00:47
      307500 -- (-1061.703) (-1067.520) (-1068.941) [-1062.285] * (-1061.763) (-1064.021) (-1064.143) [-1063.870] -- 0:00:47
      308000 -- (-1063.841) [-1065.144] (-1064.779) (-1063.962) * (-1062.563) (-1069.003) (-1067.326) [-1065.567] -- 0:00:47
      308500 -- [-1062.578] (-1066.280) (-1069.154) (-1065.379) * [-1062.601] (-1069.230) (-1066.104) (-1062.689) -- 0:00:47
      309000 -- [-1062.970] (-1066.269) (-1068.620) (-1070.685) * (-1067.319) (-1066.511) [-1063.809] (-1064.202) -- 0:00:46
      309500 -- (-1063.834) (-1069.474) (-1066.283) [-1062.622] * (-1064.611) [-1064.762] (-1064.615) (-1064.875) -- 0:00:46
      310000 -- [-1066.839] (-1065.175) (-1067.464) (-1065.541) * (-1064.963) (-1062.872) [-1062.812] (-1063.234) -- 0:00:46

      Average standard deviation of split frequencies: 0.013235

      310500 -- (-1065.187) (-1066.449) [-1061.556] (-1064.320) * (-1068.286) (-1064.797) [-1064.736] (-1065.273) -- 0:00:46
      311000 -- (-1063.170) (-1062.730) (-1062.714) [-1061.661] * [-1065.580] (-1064.528) (-1065.956) (-1063.517) -- 0:00:46
      311500 -- (-1061.656) [-1063.278] (-1063.992) (-1063.456) * (-1069.101) (-1062.598) [-1063.719] (-1062.873) -- 0:00:46
      312000 -- [-1062.180] (-1063.866) (-1063.224) (-1064.695) * (-1070.181) [-1067.521] (-1066.986) (-1066.698) -- 0:00:46
      312500 -- (-1061.601) [-1066.414] (-1060.822) (-1066.854) * (-1068.113) (-1064.886) [-1062.889] (-1061.416) -- 0:00:46
      313000 -- [-1062.942] (-1064.669) (-1063.653) (-1064.245) * (-1063.572) [-1060.972] (-1067.560) (-1066.764) -- 0:00:46
      313500 -- [-1063.491] (-1062.465) (-1060.784) (-1062.955) * (-1065.806) (-1063.320) [-1066.707] (-1065.568) -- 0:00:45
      314000 -- [-1063.205] (-1065.160) (-1063.547) (-1066.118) * (-1065.024) (-1066.995) [-1066.237] (-1062.445) -- 0:00:45
      314500 -- (-1061.957) (-1063.195) [-1064.172] (-1064.851) * (-1063.302) (-1066.761) (-1067.207) [-1066.516] -- 0:00:45
      315000 -- (-1062.456) (-1066.122) (-1066.280) [-1063.774] * (-1060.966) (-1065.423) [-1069.400] (-1072.116) -- 0:00:45

      Average standard deviation of split frequencies: 0.013177

      315500 -- (-1065.483) [-1064.507] (-1064.612) (-1064.596) * (-1065.390) (-1068.671) [-1063.549] (-1068.345) -- 0:00:45
      316000 -- (-1066.625) (-1066.611) (-1064.262) [-1066.083] * (-1066.235) [-1068.280] (-1065.578) (-1065.015) -- 0:00:45
      316500 -- (-1064.083) (-1063.734) [-1064.283] (-1066.029) * [-1062.465] (-1061.053) (-1063.405) (-1064.376) -- 0:00:45
      317000 -- [-1060.971] (-1062.560) (-1063.652) (-1065.315) * (-1062.664) [-1063.440] (-1067.410) (-1062.393) -- 0:00:45
      317500 -- [-1064.199] (-1063.263) (-1061.325) (-1064.001) * [-1064.101] (-1063.717) (-1061.888) (-1067.843) -- 0:00:45
      318000 -- [-1065.924] (-1064.483) (-1060.749) (-1064.152) * (-1064.672) (-1065.195) [-1063.976] (-1066.053) -- 0:00:45
      318500 -- (-1064.892) (-1063.522) (-1062.021) [-1065.450] * (-1062.726) [-1063.422] (-1064.426) (-1063.512) -- 0:00:44
      319000 -- [-1063.731] (-1065.544) (-1062.391) (-1065.290) * [-1063.623] (-1064.032) (-1067.067) (-1066.636) -- 0:00:44
      319500 -- (-1061.747) (-1065.593) [-1062.440] (-1062.587) * (-1065.367) (-1064.488) [-1066.508] (-1064.814) -- 0:00:44
      320000 -- (-1063.534) (-1068.603) (-1061.719) [-1063.455] * [-1064.373] (-1060.648) (-1061.977) (-1067.509) -- 0:00:44

      Average standard deviation of split frequencies: 0.014292

      320500 -- (-1063.274) (-1066.051) (-1063.982) [-1065.631] * (-1064.786) (-1063.967) [-1062.706] (-1064.581) -- 0:00:44
      321000 -- (-1062.270) (-1064.364) (-1064.367) [-1062.928] * (-1065.402) (-1063.456) [-1064.191] (-1064.276) -- 0:00:44
      321500 -- (-1062.349) [-1064.212] (-1063.936) (-1067.132) * (-1065.196) (-1065.766) [-1064.651] (-1064.883) -- 0:00:46
      322000 -- (-1062.611) (-1061.985) [-1062.058] (-1065.744) * (-1068.428) (-1069.423) (-1065.053) [-1065.664] -- 0:00:46
      322500 -- (-1061.894) [-1063.647] (-1063.174) (-1065.071) * (-1065.705) (-1066.019) (-1064.146) [-1064.739] -- 0:00:46
      323000 -- (-1068.452) [-1061.736] (-1063.477) (-1065.031) * (-1064.141) [-1065.914] (-1064.022) (-1063.923) -- 0:00:46
      323500 -- (-1064.584) [-1062.011] (-1065.689) (-1066.316) * (-1067.918) (-1066.359) [-1063.058] (-1064.536) -- 0:00:46
      324000 -- (-1064.626) (-1061.327) (-1068.713) [-1063.145] * (-1067.472) (-1067.505) [-1062.538] (-1064.838) -- 0:00:45
      324500 -- (-1063.504) (-1062.567) (-1067.004) [-1063.803] * (-1067.089) (-1062.886) [-1064.875] (-1063.241) -- 0:00:45
      325000 -- (-1064.055) (-1062.481) (-1065.434) [-1062.766] * (-1066.504) (-1067.137) [-1062.986] (-1061.451) -- 0:00:45

      Average standard deviation of split frequencies: 0.014917

      325500 -- [-1062.022] (-1064.385) (-1069.002) (-1063.998) * (-1063.834) (-1065.934) (-1065.810) [-1065.499] -- 0:00:45
      326000 -- [-1064.565] (-1063.334) (-1069.890) (-1066.016) * (-1066.169) (-1073.716) [-1066.108] (-1062.975) -- 0:00:45
      326500 -- [-1063.664] (-1062.701) (-1062.971) (-1063.161) * [-1064.301] (-1064.981) (-1063.993) (-1065.317) -- 0:00:45
      327000 -- (-1062.314) (-1063.456) (-1064.123) [-1063.731] * (-1063.589) [-1064.360] (-1065.935) (-1067.394) -- 0:00:45
      327500 -- [-1062.496] (-1063.717) (-1062.309) (-1063.259) * [-1064.554] (-1066.956) (-1064.696) (-1062.703) -- 0:00:45
      328000 -- (-1063.868) (-1065.532) [-1064.241] (-1065.945) * (-1065.405) [-1064.867] (-1067.715) (-1061.446) -- 0:00:45
      328500 -- (-1064.042) (-1063.565) (-1064.733) [-1063.827] * (-1066.511) (-1063.448) (-1065.727) [-1065.091] -- 0:00:44
      329000 -- (-1062.540) [-1064.962] (-1066.112) (-1063.468) * (-1067.185) [-1062.810] (-1065.804) (-1065.178) -- 0:00:44
      329500 -- (-1065.526) (-1064.825) [-1065.870] (-1063.603) * (-1063.231) [-1065.311] (-1065.962) (-1065.527) -- 0:00:44
      330000 -- (-1064.226) (-1066.633) (-1062.201) [-1065.173] * (-1064.388) (-1064.546) [-1067.919] (-1062.194) -- 0:00:44

      Average standard deviation of split frequencies: 0.015382

      330500 -- [-1066.445] (-1068.688) (-1062.032) (-1066.131) * (-1070.853) (-1063.070) [-1063.354] (-1063.937) -- 0:00:44
      331000 -- (-1064.755) (-1066.915) (-1065.911) [-1061.063] * (-1069.203) [-1063.590] (-1063.986) (-1065.801) -- 0:00:44
      331500 -- (-1066.577) (-1064.677) [-1066.023] (-1063.184) * (-1068.187) [-1069.906] (-1066.712) (-1063.413) -- 0:00:44
      332000 -- (-1064.219) [-1063.580] (-1064.555) (-1064.961) * (-1067.207) [-1062.743] (-1064.868) (-1068.960) -- 0:00:44
      332500 -- (-1065.972) [-1063.275] (-1063.299) (-1066.419) * (-1067.508) (-1066.525) [-1062.369] (-1065.250) -- 0:00:44
      333000 -- (-1061.137) (-1064.831) (-1062.766) [-1063.406] * (-1066.467) [-1067.064] (-1063.461) (-1065.230) -- 0:00:44
      333500 -- (-1064.461) [-1071.096] (-1063.654) (-1064.580) * (-1065.263) (-1064.951) [-1065.877] (-1064.753) -- 0:00:43
      334000 -- [-1066.266] (-1063.971) (-1062.768) (-1065.365) * (-1064.578) (-1065.544) [-1064.491] (-1065.776) -- 0:00:43
      334500 -- (-1063.626) (-1063.686) (-1063.100) [-1061.614] * (-1069.327) [-1065.497] (-1064.909) (-1064.326) -- 0:00:43
      335000 -- [-1063.067] (-1064.906) (-1064.427) (-1064.548) * (-1069.474) (-1064.476) [-1064.881] (-1065.180) -- 0:00:43

      Average standard deviation of split frequencies: 0.015211

      335500 -- (-1067.965) (-1065.885) [-1062.517] (-1064.636) * (-1070.932) (-1067.545) [-1063.808] (-1066.089) -- 0:00:43
      336000 -- (-1068.411) (-1068.653) (-1063.061) [-1064.383] * (-1068.456) [-1064.353] (-1064.390) (-1063.832) -- 0:00:43
      336500 -- (-1070.432) [-1065.167] (-1064.728) (-1066.136) * (-1068.154) [-1066.174] (-1064.267) (-1064.805) -- 0:00:45
      337000 -- [-1069.256] (-1067.832) (-1063.038) (-1063.051) * (-1062.434) (-1064.263) (-1062.494) [-1065.817] -- 0:00:45
      337500 -- (-1062.049) (-1065.365) [-1060.993] (-1064.198) * [-1063.800] (-1066.090) (-1062.869) (-1063.804) -- 0:00:45
      338000 -- (-1063.907) (-1062.567) (-1065.137) [-1064.904] * (-1065.532) (-1063.933) (-1063.438) [-1066.160] -- 0:00:45
      338500 -- (-1063.528) (-1064.630) [-1062.481] (-1067.620) * (-1066.086) [-1064.974] (-1062.925) (-1064.179) -- 0:00:44
      339000 -- (-1061.177) (-1068.448) (-1064.052) [-1063.096] * (-1067.203) (-1064.694) (-1062.313) [-1062.146] -- 0:00:44
      339500 -- (-1064.989) (-1066.140) (-1064.819) [-1063.630] * [-1069.671] (-1065.529) (-1062.930) (-1064.480) -- 0:00:44
      340000 -- (-1066.659) [-1066.037] (-1064.386) (-1063.823) * (-1064.917) (-1062.991) [-1065.714] (-1060.938) -- 0:00:44

      Average standard deviation of split frequencies: 0.015068

      340500 -- (-1064.855) [-1065.213] (-1066.117) (-1067.439) * (-1062.578) [-1061.829] (-1065.576) (-1063.276) -- 0:00:44
      341000 -- (-1067.867) (-1067.549) (-1065.310) [-1067.392] * [-1062.029] (-1064.628) (-1061.562) (-1070.255) -- 0:00:44
      341500 -- (-1067.452) [-1065.095] (-1065.090) (-1065.116) * [-1064.448] (-1065.811) (-1066.287) (-1065.420) -- 0:00:44
      342000 -- (-1066.499) (-1066.738) (-1066.739) [-1063.369] * [-1064.539] (-1064.241) (-1062.284) (-1063.617) -- 0:00:44
      342500 -- (-1062.740) [-1065.784] (-1064.744) (-1064.142) * (-1066.569) [-1063.713] (-1064.882) (-1063.545) -- 0:00:44
      343000 -- (-1061.679) (-1067.306) (-1062.864) [-1063.752] * (-1065.769) (-1064.453) (-1064.503) [-1064.409] -- 0:00:44
      343500 -- [-1063.686] (-1069.438) (-1063.129) (-1064.470) * (-1065.155) (-1067.004) (-1064.882) [-1063.457] -- 0:00:43
      344000 -- [-1064.946] (-1064.924) (-1062.421) (-1065.288) * (-1067.391) (-1065.518) [-1065.757] (-1064.547) -- 0:00:43
      344500 -- (-1070.604) (-1067.315) [-1066.961] (-1066.138) * (-1066.014) (-1062.742) (-1064.164) [-1063.695] -- 0:00:43
      345000 -- [-1063.282] (-1062.683) (-1063.786) (-1064.373) * (-1064.719) (-1064.425) [-1064.271] (-1061.438) -- 0:00:43

      Average standard deviation of split frequencies: 0.014772

      345500 -- (-1067.476) (-1061.994) (-1065.217) [-1064.783] * [-1064.866] (-1063.687) (-1065.559) (-1063.803) -- 0:00:43
      346000 -- [-1064.360] (-1063.195) (-1066.066) (-1067.252) * (-1065.618) (-1063.599) (-1065.796) [-1063.554] -- 0:00:43
      346500 -- (-1063.740) (-1067.119) (-1066.729) [-1065.367] * (-1068.910) (-1065.324) (-1063.388) [-1062.306] -- 0:00:43
      347000 -- (-1064.831) (-1064.473) [-1065.753] (-1065.526) * (-1062.546) (-1064.653) (-1062.992) [-1064.153] -- 0:00:43
      347500 -- [-1064.311] (-1062.132) (-1065.309) (-1066.199) * (-1069.027) (-1068.066) (-1062.616) [-1063.353] -- 0:00:43
      348000 -- (-1063.041) (-1064.069) (-1062.855) [-1064.727] * (-1068.703) (-1069.681) [-1064.561] (-1064.364) -- 0:00:43
      348500 -- (-1064.046) (-1064.645) (-1066.261) [-1063.546] * [-1064.264] (-1067.217) (-1061.527) (-1068.311) -- 0:00:42
      349000 -- [-1064.608] (-1063.621) (-1063.753) (-1064.901) * [-1062.361] (-1067.253) (-1063.561) (-1064.033) -- 0:00:42
      349500 -- (-1064.815) (-1065.253) [-1061.926] (-1068.562) * (-1061.675) [-1062.786] (-1061.849) (-1064.595) -- 0:00:42
      350000 -- [-1066.979] (-1064.603) (-1064.167) (-1065.339) * (-1067.277) [-1065.256] (-1065.088) (-1065.587) -- 0:00:42

      Average standard deviation of split frequencies: 0.015161

      350500 -- (-1067.942) (-1064.958) [-1064.955] (-1065.379) * (-1068.823) [-1061.818] (-1063.680) (-1062.137) -- 0:00:42
      351000 -- [-1065.893] (-1064.665) (-1063.988) (-1064.825) * (-1064.679) [-1062.068] (-1062.561) (-1063.159) -- 0:00:42
      351500 -- (-1062.751) [-1064.183] (-1066.035) (-1063.419) * (-1069.413) (-1062.894) (-1063.161) [-1065.040] -- 0:00:44
      352000 -- (-1066.160) (-1064.253) (-1065.298) [-1064.905] * (-1067.190) (-1064.809) [-1067.960] (-1065.571) -- 0:00:44
      352500 -- (-1063.282) (-1065.475) (-1066.454) [-1062.058] * (-1063.583) [-1063.213] (-1064.993) (-1064.343) -- 0:00:44
      353000 -- (-1063.348) (-1067.613) [-1062.611] (-1063.403) * (-1067.335) [-1063.032] (-1068.606) (-1063.617) -- 0:00:43
      353500 -- (-1069.044) (-1068.470) [-1063.773] (-1069.040) * (-1066.717) [-1063.153] (-1067.102) (-1065.563) -- 0:00:43
      354000 -- (-1065.528) (-1065.305) [-1062.500] (-1068.562) * (-1062.728) [-1063.428] (-1063.489) (-1066.023) -- 0:00:43
      354500 -- (-1069.410) (-1065.717) (-1065.574) [-1064.445] * [-1065.249] (-1061.434) (-1064.290) (-1065.032) -- 0:00:43
      355000 -- [-1064.097] (-1066.126) (-1063.018) (-1064.971) * (-1065.125) (-1069.016) [-1067.844] (-1064.384) -- 0:00:43

      Average standard deviation of split frequencies: 0.013943

      355500 -- (-1064.569) (-1063.614) (-1066.411) [-1068.749] * (-1061.416) [-1062.662] (-1063.929) (-1063.330) -- 0:00:43
      356000 -- [-1064.067] (-1065.136) (-1065.684) (-1065.878) * (-1063.161) (-1063.490) (-1065.070) [-1064.136] -- 0:00:43
      356500 -- (-1063.956) [-1064.426] (-1065.235) (-1066.827) * (-1065.680) [-1066.291] (-1065.742) (-1065.186) -- 0:00:43
      357000 -- (-1064.900) (-1066.224) [-1068.555] (-1063.972) * (-1065.628) (-1061.547) (-1065.669) [-1062.258] -- 0:00:43
      357500 -- (-1064.777) (-1062.496) [-1067.439] (-1066.691) * [-1063.980] (-1063.266) (-1064.892) (-1063.257) -- 0:00:43
      358000 -- [-1063.510] (-1061.809) (-1065.180) (-1066.712) * [-1061.824] (-1063.105) (-1063.941) (-1065.945) -- 0:00:43
      358500 -- (-1065.016) (-1069.275) [-1062.088] (-1063.937) * [-1064.894] (-1064.234) (-1066.890) (-1066.187) -- 0:00:42
      359000 -- (-1062.160) (-1066.732) [-1063.227] (-1064.248) * (-1063.667) (-1061.457) [-1065.596] (-1063.525) -- 0:00:42
      359500 -- (-1063.127) [-1064.269] (-1062.131) (-1063.937) * (-1063.657) (-1064.705) [-1065.264] (-1063.039) -- 0:00:42
      360000 -- (-1062.915) (-1061.768) (-1062.563) [-1067.375] * [-1063.803] (-1065.764) (-1065.126) (-1062.851) -- 0:00:42

      Average standard deviation of split frequencies: 0.013609

      360500 -- (-1068.870) [-1063.944] (-1063.929) (-1066.020) * (-1068.080) (-1069.657) [-1062.803] (-1072.040) -- 0:00:42
      361000 -- (-1067.193) (-1063.241) [-1063.685] (-1063.892) * (-1069.343) (-1065.052) (-1064.822) [-1066.628] -- 0:00:42
      361500 -- (-1065.003) [-1066.861] (-1062.275) (-1064.323) * (-1068.143) (-1064.247) [-1063.801] (-1064.897) -- 0:00:42
      362000 -- [-1064.222] (-1061.393) (-1061.802) (-1067.012) * (-1067.418) (-1064.342) (-1066.259) [-1067.858] -- 0:00:42
      362500 -- (-1062.983) (-1064.196) (-1063.069) [-1063.653] * (-1066.372) [-1063.931] (-1064.909) (-1071.672) -- 0:00:42
      363000 -- (-1063.419) (-1065.837) (-1063.774) [-1063.753] * (-1068.589) (-1065.658) (-1064.938) [-1064.355] -- 0:00:42
      363500 -- (-1064.664) (-1063.290) (-1062.207) [-1063.502] * (-1063.963) (-1064.235) (-1062.991) [-1064.409] -- 0:00:42
      364000 -- (-1063.818) (-1066.591) (-1063.046) [-1063.014] * (-1064.361) [-1063.726] (-1064.006) (-1067.481) -- 0:00:41
      364500 -- (-1064.119) [-1062.769] (-1064.741) (-1062.220) * (-1063.460) [-1061.349] (-1065.073) (-1064.188) -- 0:00:41
      365000 -- (-1065.026) (-1063.110) (-1064.451) [-1062.277] * (-1066.709) (-1064.811) (-1062.544) [-1067.119] -- 0:00:41

      Average standard deviation of split frequencies: 0.012594

      365500 -- (-1066.731) (-1068.215) (-1063.396) [-1062.130] * (-1066.816) [-1062.998] (-1068.203) (-1064.605) -- 0:00:41
      366000 -- (-1065.364) (-1068.532) (-1066.854) [-1061.384] * (-1065.696) [-1062.714] (-1066.731) (-1065.841) -- 0:00:41
      366500 -- (-1064.272) (-1066.164) (-1066.368) [-1065.981] * (-1064.060) (-1064.763) [-1064.733] (-1066.865) -- 0:00:41
      367000 -- (-1063.126) (-1064.626) [-1070.836] (-1069.136) * [-1064.101] (-1067.623) (-1067.655) (-1065.924) -- 0:00:43
      367500 -- (-1065.664) (-1064.477) [-1066.347] (-1064.036) * (-1065.382) [-1064.521] (-1066.445) (-1065.145) -- 0:00:43
      368000 -- (-1065.465) (-1063.733) (-1067.759) [-1064.819] * (-1064.386) (-1065.113) (-1071.442) [-1065.290] -- 0:00:42
      368500 -- (-1065.183) [-1063.907] (-1071.086) (-1064.802) * (-1064.085) (-1066.847) [-1067.027] (-1064.448) -- 0:00:42
      369000 -- (-1064.881) (-1065.261) (-1065.576) [-1061.633] * (-1064.285) (-1061.224) (-1064.473) [-1067.282] -- 0:00:42
      369500 -- (-1062.783) (-1064.947) (-1062.535) [-1062.321] * (-1064.467) [-1063.611] (-1065.498) (-1065.829) -- 0:00:42
      370000 -- [-1062.322] (-1064.850) (-1062.631) (-1062.650) * (-1064.400) [-1062.962] (-1069.746) (-1068.537) -- 0:00:42

      Average standard deviation of split frequencies: 0.011970

      370500 -- (-1065.080) (-1065.032) [-1063.676] (-1064.394) * [-1064.006] (-1065.423) (-1064.708) (-1064.838) -- 0:00:42
      371000 -- [-1064.536] (-1062.900) (-1062.965) (-1065.818) * (-1066.605) (-1065.937) [-1065.681] (-1063.781) -- 0:00:42
      371500 -- [-1061.136] (-1063.841) (-1061.981) (-1065.025) * (-1066.373) [-1062.381] (-1063.983) (-1065.020) -- 0:00:42
      372000 -- [-1062.943] (-1062.587) (-1062.862) (-1066.947) * (-1071.491) (-1061.877) [-1063.364] (-1067.855) -- 0:00:42
      372500 -- (-1064.952) [-1062.601] (-1067.625) (-1064.533) * [-1066.247] (-1064.880) (-1065.063) (-1064.747) -- 0:00:42
      373000 -- (-1064.396) (-1063.832) (-1070.385) [-1064.360] * (-1064.194) (-1062.332) [-1062.362] (-1071.665) -- 0:00:42
      373500 -- (-1065.536) [-1062.175] (-1067.190) (-1064.616) * [-1063.514] (-1062.426) (-1063.254) (-1068.823) -- 0:00:41
      374000 -- [-1068.618] (-1070.420) (-1063.472) (-1065.929) * (-1064.303) [-1063.413] (-1067.777) (-1065.406) -- 0:00:41
      374500 -- (-1064.362) (-1064.071) [-1062.203] (-1064.436) * (-1063.031) (-1065.405) [-1063.833] (-1067.545) -- 0:00:41
      375000 -- (-1063.467) (-1064.549) [-1063.254] (-1064.746) * (-1061.227) (-1066.236) (-1065.187) [-1062.649] -- 0:00:41

      Average standard deviation of split frequencies: 0.012242

      375500 -- (-1066.615) [-1063.593] (-1065.772) (-1064.915) * (-1063.118) [-1065.566] (-1061.770) (-1064.686) -- 0:00:41
      376000 -- [-1065.015] (-1065.634) (-1065.449) (-1068.288) * (-1063.907) (-1064.602) [-1063.879] (-1069.346) -- 0:00:41
      376500 -- [-1061.425] (-1064.842) (-1065.879) (-1066.767) * [-1064.261] (-1065.578) (-1064.319) (-1065.998) -- 0:00:41
      377000 -- (-1066.033) [-1064.276] (-1064.333) (-1064.900) * (-1063.734) (-1062.901) (-1064.010) [-1065.500] -- 0:00:41
      377500 -- (-1066.035) (-1064.590) (-1062.378) [-1063.858] * [-1065.947] (-1062.105) (-1069.190) (-1064.718) -- 0:00:41
      378000 -- (-1064.747) (-1068.326) [-1063.323] (-1062.624) * (-1069.576) (-1064.362) (-1065.219) [-1065.705] -- 0:00:41
      378500 -- (-1062.288) (-1066.797) (-1063.144) [-1065.190] * (-1064.709) (-1068.469) [-1064.437] (-1063.901) -- 0:00:41
      379000 -- (-1062.351) [-1064.732] (-1063.021) (-1063.927) * (-1064.858) (-1064.842) (-1065.214) [-1064.418] -- 0:00:40
      379500 -- [-1064.981] (-1064.904) (-1064.799) (-1064.041) * [-1064.880] (-1064.661) (-1063.312) (-1069.778) -- 0:00:40
      380000 -- (-1067.217) (-1063.133) [-1065.819] (-1067.838) * (-1063.584) [-1063.981] (-1064.910) (-1063.840) -- 0:00:40

      Average standard deviation of split frequencies: 0.011582

      380500 -- (-1062.996) (-1062.799) (-1062.912) [-1066.825] * (-1068.009) (-1062.743) [-1064.131] (-1064.565) -- 0:00:40
      381000 -- (-1069.370) (-1063.068) (-1064.406) [-1070.587] * (-1061.815) (-1061.246) (-1068.551) [-1065.376] -- 0:00:40
      381500 -- (-1064.946) [-1062.647] (-1064.211) (-1068.749) * [-1062.660] (-1064.762) (-1062.933) (-1065.526) -- 0:00:40
      382000 -- [-1066.690] (-1064.056) (-1066.524) (-1064.797) * (-1065.174) [-1062.126] (-1063.662) (-1063.808) -- 0:00:42
      382500 -- [-1063.211] (-1062.598) (-1064.680) (-1065.361) * [-1064.876] (-1067.624) (-1064.346) (-1064.460) -- 0:00:41
      383000 -- [-1065.914] (-1062.936) (-1063.513) (-1065.672) * (-1063.555) [-1063.823] (-1062.089) (-1065.004) -- 0:00:41
      383500 -- (-1062.134) (-1061.816) [-1062.953] (-1066.091) * (-1063.123) (-1062.320) (-1065.016) [-1063.669] -- 0:00:41
      384000 -- [-1063.127] (-1063.386) (-1065.056) (-1068.310) * (-1064.855) (-1068.198) (-1066.326) [-1066.743] -- 0:00:41
      384500 -- [-1061.837] (-1065.698) (-1065.072) (-1065.978) * (-1061.449) (-1065.135) (-1062.320) [-1065.380] -- 0:00:41
      385000 -- [-1062.393] (-1064.189) (-1063.795) (-1067.771) * [-1062.740] (-1064.570) (-1069.010) (-1063.951) -- 0:00:41

      Average standard deviation of split frequencies: 0.010533

      385500 -- (-1062.935) (-1064.040) (-1067.698) [-1066.979] * (-1063.602) [-1062.734] (-1063.726) (-1064.362) -- 0:00:41
      386000 -- [-1064.405] (-1064.254) (-1064.554) (-1066.513) * (-1065.882) [-1062.884] (-1065.337) (-1068.427) -- 0:00:41
      386500 -- (-1065.618) [-1061.719] (-1065.655) (-1068.606) * [-1065.938] (-1064.136) (-1063.113) (-1066.618) -- 0:00:41
      387000 -- (-1065.500) (-1066.085) [-1062.067] (-1065.094) * (-1068.166) (-1063.509) [-1061.950] (-1066.949) -- 0:00:41
      387500 -- [-1063.212] (-1063.457) (-1065.478) (-1065.661) * (-1064.184) (-1064.015) (-1062.241) [-1064.780] -- 0:00:41
      388000 -- [-1062.164] (-1064.047) (-1064.298) (-1069.078) * (-1066.581) (-1066.106) (-1060.403) [-1064.050] -- 0:00:41
      388500 -- (-1063.520) (-1062.878) (-1064.196) [-1063.524] * (-1063.691) (-1067.324) (-1063.493) [-1063.154] -- 0:00:40
      389000 -- (-1065.098) (-1065.775) (-1062.070) [-1066.908] * (-1066.656) [-1066.975] (-1063.962) (-1066.222) -- 0:00:40
      389500 -- (-1062.054) (-1067.651) [-1062.078] (-1065.110) * [-1064.396] (-1064.018) (-1064.120) (-1064.507) -- 0:00:40
      390000 -- [-1062.273] (-1065.727) (-1062.832) (-1065.163) * [-1066.103] (-1067.906) (-1061.782) (-1069.287) -- 0:00:40

      Average standard deviation of split frequencies: 0.010030

      390500 -- (-1063.919) (-1070.368) [-1061.926] (-1066.188) * (-1063.556) (-1065.961) (-1068.178) [-1062.076] -- 0:00:40
      391000 -- (-1063.232) (-1065.563) [-1061.553] (-1063.490) * (-1067.172) (-1065.847) (-1068.666) [-1066.142] -- 0:00:40
      391500 -- (-1065.042) [-1065.993] (-1065.291) (-1064.767) * (-1065.986) (-1065.150) [-1063.612] (-1067.534) -- 0:00:40
      392000 -- (-1065.678) (-1064.240) (-1062.946) [-1062.643] * (-1063.344) [-1062.339] (-1064.071) (-1065.222) -- 0:00:40
      392500 -- (-1063.744) (-1067.083) [-1062.087] (-1061.773) * (-1062.516) (-1064.677) [-1065.438] (-1063.830) -- 0:00:40
      393000 -- [-1065.442] (-1066.948) (-1062.499) (-1064.058) * (-1066.594) [-1065.360] (-1066.296) (-1064.242) -- 0:00:40
      393500 -- (-1064.509) (-1067.724) (-1061.636) [-1064.263] * (-1063.025) (-1063.374) [-1066.991] (-1064.497) -- 0:00:40
      394000 -- (-1063.001) (-1065.779) [-1064.722] (-1067.782) * [-1062.907] (-1065.338) (-1063.323) (-1064.752) -- 0:00:39
      394500 -- (-1064.113) (-1065.012) [-1064.376] (-1067.689) * [-1061.869] (-1065.353) (-1065.866) (-1064.206) -- 0:00:39
      395000 -- [-1063.083] (-1067.772) (-1063.916) (-1067.890) * (-1064.327) (-1066.892) [-1062.272] (-1065.831) -- 0:00:39

      Average standard deviation of split frequencies: 0.010193

      395500 -- (-1064.242) (-1064.578) [-1063.919] (-1064.205) * (-1062.419) (-1068.650) [-1067.635] (-1065.982) -- 0:00:39
      396000 -- (-1063.471) (-1062.263) (-1062.946) [-1064.431] * (-1063.156) (-1064.072) (-1064.502) [-1061.922] -- 0:00:39
      396500 -- (-1067.632) [-1063.865] (-1063.175) (-1063.806) * (-1064.516) [-1065.799] (-1064.540) (-1064.071) -- 0:00:39
      397000 -- (-1065.658) [-1064.378] (-1063.124) (-1066.023) * (-1062.628) (-1065.060) (-1063.993) [-1064.134] -- 0:00:41
      397500 -- (-1065.478) [-1064.728] (-1062.488) (-1067.059) * (-1063.732) (-1065.059) [-1063.212] (-1065.962) -- 0:00:40
      398000 -- (-1064.908) [-1065.400] (-1068.181) (-1069.339) * (-1065.945) (-1069.501) [-1063.506] (-1068.464) -- 0:00:40
      398500 -- [-1063.059] (-1066.847) (-1065.707) (-1075.141) * [-1062.383] (-1063.717) (-1064.471) (-1068.735) -- 0:00:40
      399000 -- (-1065.033) (-1066.213) (-1065.116) [-1061.747] * (-1063.765) [-1063.862] (-1062.995) (-1067.267) -- 0:00:40
      399500 -- [-1065.210] (-1065.325) (-1063.938) (-1063.471) * [-1064.377] (-1066.366) (-1065.577) (-1066.511) -- 0:00:40
      400000 -- (-1063.786) (-1066.115) [-1064.844] (-1064.317) * [-1065.147] (-1066.413) (-1064.237) (-1065.363) -- 0:00:40

      Average standard deviation of split frequencies: 0.011030

      400500 -- (-1066.582) [-1064.834] (-1064.217) (-1061.279) * (-1062.972) [-1063.964] (-1066.683) (-1064.808) -- 0:00:40
      401000 -- [-1066.123] (-1067.939) (-1064.824) (-1062.686) * (-1066.148) (-1064.280) (-1071.547) [-1067.214] -- 0:00:40
      401500 -- (-1071.921) (-1069.776) [-1066.426] (-1062.493) * (-1063.382) (-1064.280) [-1066.567] (-1064.338) -- 0:00:40
      402000 -- [-1065.498] (-1071.004) (-1065.420) (-1063.747) * (-1063.881) (-1062.486) (-1066.499) [-1065.633] -- 0:00:40
      402500 -- [-1063.430] (-1067.575) (-1065.033) (-1066.334) * [-1065.018] (-1067.070) (-1061.955) (-1063.836) -- 0:00:40
      403000 -- (-1063.732) (-1061.615) [-1063.493] (-1065.633) * (-1063.878) (-1066.701) [-1061.255] (-1064.523) -- 0:00:39
      403500 -- [-1064.781] (-1061.904) (-1064.654) (-1065.990) * (-1065.972) (-1065.418) [-1060.659] (-1066.534) -- 0:00:39
      404000 -- (-1064.350) [-1062.432] (-1063.926) (-1066.138) * [-1066.683] (-1064.943) (-1061.486) (-1066.243) -- 0:00:39
      404500 -- (-1063.970) [-1071.012] (-1066.192) (-1064.782) * (-1066.138) (-1062.723) (-1065.853) [-1065.019] -- 0:00:39
      405000 -- [-1065.807] (-1066.388) (-1068.289) (-1064.747) * (-1070.648) (-1065.056) [-1065.393] (-1065.093) -- 0:00:39

      Average standard deviation of split frequencies: 0.012021

      405500 -- (-1064.810) (-1067.221) (-1064.203) [-1064.106] * (-1064.939) (-1066.130) [-1064.496] (-1063.891) -- 0:00:39
      406000 -- (-1068.068) (-1065.780) [-1062.530] (-1061.907) * (-1065.288) (-1067.216) [-1065.330] (-1063.083) -- 0:00:39
      406500 -- (-1066.608) (-1064.733) [-1062.797] (-1061.806) * [-1064.237] (-1062.626) (-1068.040) (-1064.653) -- 0:00:39
      407000 -- (-1063.265) (-1067.616) [-1063.515] (-1066.680) * (-1065.001) (-1065.053) (-1064.460) [-1064.193] -- 0:00:39
      407500 -- (-1063.631) (-1065.472) [-1066.687] (-1064.875) * (-1062.553) (-1066.991) (-1064.960) [-1064.515] -- 0:00:39
      408000 -- (-1063.592) (-1064.672) [-1062.176] (-1065.077) * (-1065.237) [-1063.277] (-1066.785) (-1063.398) -- 0:00:39
      408500 -- [-1064.245] (-1065.054) (-1064.249) (-1065.219) * (-1065.708) (-1064.591) [-1064.813] (-1063.341) -- 0:00:39
      409000 -- [-1063.050] (-1068.108) (-1063.505) (-1064.278) * (-1063.786) (-1068.187) [-1062.000] (-1061.380) -- 0:00:39
      409500 -- (-1063.868) (-1067.983) (-1064.152) [-1065.656] * (-1063.564) [-1066.097] (-1063.173) (-1063.918) -- 0:00:38
      410000 -- [-1061.663] (-1067.205) (-1063.259) (-1064.969) * [-1067.734] (-1070.632) (-1065.506) (-1063.712) -- 0:00:38

      Average standard deviation of split frequencies: 0.010762

      410500 -- (-1065.208) (-1064.579) (-1067.479) [-1064.010] * (-1064.728) [-1065.820] (-1065.039) (-1064.780) -- 0:00:38
      411000 -- (-1067.262) (-1065.695) [-1064.252] (-1066.338) * (-1065.340) (-1068.009) (-1063.329) [-1063.346] -- 0:00:38
      411500 -- (-1065.001) (-1065.403) (-1065.637) [-1067.490] * (-1063.504) (-1068.294) (-1064.309) [-1061.458] -- 0:00:38
      412000 -- (-1067.948) (-1067.277) (-1063.179) [-1064.343] * (-1064.865) (-1066.532) (-1064.012) [-1062.303] -- 0:00:39
      412500 -- (-1068.002) (-1064.837) (-1067.633) [-1065.608] * (-1064.485) (-1063.431) (-1063.983) [-1065.490] -- 0:00:39
      413000 -- (-1068.189) (-1065.255) (-1063.082) [-1063.835] * (-1063.138) [-1064.117] (-1063.758) (-1068.061) -- 0:00:39
      413500 -- (-1066.611) (-1065.251) [-1066.694] (-1062.529) * (-1063.354) [-1061.504] (-1069.581) (-1073.463) -- 0:00:39
      414000 -- [-1065.162] (-1063.350) (-1064.755) (-1062.836) * [-1063.648] (-1063.393) (-1064.959) (-1065.803) -- 0:00:39
      414500 -- (-1065.148) (-1065.550) [-1065.888] (-1061.720) * [-1062.112] (-1063.526) (-1066.564) (-1065.434) -- 0:00:39
      415000 -- [-1062.857] (-1066.302) (-1066.609) (-1062.244) * (-1061.823) [-1064.557] (-1063.735) (-1063.185) -- 0:00:39

      Average standard deviation of split frequencies: 0.011598

      415500 -- (-1064.414) [-1062.398] (-1067.044) (-1060.466) * (-1063.130) (-1064.160) (-1064.511) [-1063.226] -- 0:00:39
      416000 -- (-1064.645) [-1062.936] (-1066.858) (-1065.297) * (-1065.163) (-1062.158) (-1063.993) [-1064.100] -- 0:00:39
      416500 -- (-1064.999) [-1065.535] (-1064.887) (-1064.875) * (-1063.406) [-1061.914] (-1067.727) (-1064.757) -- 0:00:39
      417000 -- (-1068.280) (-1063.812) [-1065.161] (-1062.740) * (-1060.601) (-1064.182) [-1065.960] (-1062.990) -- 0:00:39
      417500 -- (-1063.799) (-1063.414) (-1068.384) [-1065.211] * [-1061.131] (-1066.053) (-1067.314) (-1065.074) -- 0:00:39
      418000 -- (-1064.747) (-1068.223) (-1065.282) [-1067.786] * (-1066.075) [-1063.259] (-1063.990) (-1063.420) -- 0:00:38
      418500 -- [-1063.939] (-1064.575) (-1062.751) (-1065.218) * (-1064.074) (-1065.464) (-1064.173) [-1063.810] -- 0:00:38
      419000 -- (-1066.003) (-1066.515) (-1065.320) [-1063.555] * (-1063.733) (-1065.607) (-1063.925) [-1063.381] -- 0:00:38
      419500 -- (-1062.685) (-1063.744) (-1063.435) [-1062.449] * (-1064.404) (-1064.168) [-1064.194] (-1063.695) -- 0:00:38
      420000 -- (-1065.111) [-1064.924] (-1068.732) (-1061.744) * (-1062.742) (-1064.739) [-1065.411] (-1062.727) -- 0:00:38

      Average standard deviation of split frequencies: 0.011733

      420500 -- (-1063.994) [-1067.366] (-1064.693) (-1062.835) * [-1062.836] (-1067.223) (-1066.180) (-1065.240) -- 0:00:38
      421000 -- [-1062.698] (-1063.495) (-1063.503) (-1066.000) * (-1061.659) (-1066.213) [-1067.325] (-1066.214) -- 0:00:38
      421500 -- [-1062.711] (-1061.953) (-1063.921) (-1062.601) * (-1063.593) (-1065.566) [-1063.395] (-1067.688) -- 0:00:38
      422000 -- [-1062.823] (-1065.186) (-1062.156) (-1063.211) * (-1062.142) [-1062.803] (-1062.846) (-1063.241) -- 0:00:38
      422500 -- [-1061.251] (-1065.433) (-1062.701) (-1065.833) * [-1063.443] (-1066.637) (-1061.963) (-1064.451) -- 0:00:38
      423000 -- [-1063.813] (-1066.529) (-1064.733) (-1064.320) * [-1063.223] (-1063.593) (-1062.709) (-1063.775) -- 0:00:38
      423500 -- (-1063.128) [-1062.278] (-1064.119) (-1064.599) * [-1061.593] (-1061.758) (-1061.384) (-1064.122) -- 0:00:38
      424000 -- [-1063.655] (-1063.886) (-1066.943) (-1062.561) * [-1063.517] (-1066.805) (-1061.321) (-1062.415) -- 0:00:38
      424500 -- (-1063.614) (-1063.866) (-1064.054) [-1062.443] * [-1062.781] (-1062.795) (-1062.890) (-1065.624) -- 0:00:37
      425000 -- (-1065.601) [-1064.125] (-1062.615) (-1065.722) * (-1061.883) (-1063.672) (-1067.060) [-1062.552] -- 0:00:37

      Average standard deviation of split frequencies: 0.011131

      425500 -- (-1063.784) (-1069.406) [-1063.907] (-1066.244) * (-1063.118) (-1063.949) [-1061.972] (-1066.355) -- 0:00:37
      426000 -- (-1063.284) (-1067.215) (-1066.582) [-1062.222] * (-1066.069) [-1065.223] (-1064.146) (-1066.474) -- 0:00:37
      426500 -- (-1065.758) (-1065.617) [-1064.154] (-1067.692) * (-1064.184) (-1064.532) [-1064.753] (-1064.283) -- 0:00:37
      427000 -- (-1065.792) [-1064.731] (-1065.059) (-1067.809) * (-1062.887) [-1062.231] (-1062.484) (-1064.186) -- 0:00:38
      427500 -- (-1062.967) [-1066.315] (-1066.889) (-1065.300) * (-1063.765) (-1064.430) [-1061.956] (-1062.714) -- 0:00:38
      428000 -- (-1065.858) [-1066.435] (-1066.083) (-1065.151) * [-1065.350] (-1064.242) (-1063.038) (-1063.276) -- 0:00:38
      428500 -- [-1064.847] (-1066.474) (-1062.630) (-1065.868) * [-1065.020] (-1063.819) (-1069.918) (-1065.252) -- 0:00:38
      429000 -- (-1065.532) (-1064.174) (-1065.917) [-1064.899] * [-1064.245] (-1064.511) (-1066.306) (-1064.883) -- 0:00:38
      429500 -- (-1062.125) [-1068.495] (-1065.702) (-1065.048) * (-1063.711) [-1067.028] (-1063.308) (-1065.657) -- 0:00:38
      430000 -- (-1060.369) (-1065.434) [-1063.300] (-1065.093) * (-1064.337) [-1064.629] (-1066.759) (-1063.743) -- 0:00:38

      Average standard deviation of split frequencies: 0.011397

      430500 -- (-1061.984) [-1064.759] (-1065.026) (-1064.741) * [-1062.392] (-1062.399) (-1065.252) (-1064.727) -- 0:00:38
      431000 -- (-1066.465) (-1061.919) (-1063.563) [-1063.704] * (-1062.056) [-1065.135] (-1065.477) (-1064.568) -- 0:00:38
      431500 -- (-1066.532) (-1062.310) [-1065.492] (-1063.720) * (-1061.775) (-1065.621) (-1064.097) [-1063.549] -- 0:00:38
      432000 -- [-1064.012] (-1066.162) (-1065.440) (-1065.133) * [-1061.695] (-1063.950) (-1064.470) (-1065.431) -- 0:00:38
      432500 -- (-1067.955) (-1064.998) [-1066.076] (-1066.782) * (-1061.667) (-1065.377) (-1063.372) [-1062.897] -- 0:00:38
      433000 -- (-1064.457) (-1063.712) [-1066.454] (-1061.396) * [-1062.248] (-1066.966) (-1065.577) (-1067.282) -- 0:00:37
      433500 -- (-1064.307) (-1067.594) (-1068.093) [-1064.299] * (-1064.735) (-1064.533) [-1064.581] (-1065.920) -- 0:00:37
      434000 -- (-1065.778) [-1067.416] (-1067.295) (-1062.898) * (-1065.390) [-1062.637] (-1063.493) (-1065.385) -- 0:00:37
      434500 -- (-1065.377) (-1065.641) [-1066.112] (-1063.476) * (-1065.343) (-1062.792) [-1064.303] (-1066.371) -- 0:00:37
      435000 -- (-1066.951) (-1066.664) (-1066.788) [-1064.200] * (-1064.899) [-1063.739] (-1064.631) (-1062.757) -- 0:00:37

      Average standard deviation of split frequencies: 0.011413

      435500 -- (-1064.162) (-1065.374) [-1064.342] (-1063.888) * (-1067.755) (-1066.389) [-1062.208] (-1062.189) -- 0:00:37
      436000 -- (-1064.370) [-1066.968] (-1065.827) (-1064.782) * [-1069.025] (-1065.554) (-1063.337) (-1061.270) -- 0:00:37
      436500 -- (-1062.305) (-1068.895) [-1066.523] (-1067.001) * (-1064.820) (-1063.633) [-1065.246] (-1066.562) -- 0:00:37
      437000 -- (-1062.300) [-1068.080] (-1065.756) (-1069.818) * [-1062.500] (-1061.059) (-1063.363) (-1063.394) -- 0:00:37
      437500 -- [-1063.310] (-1066.101) (-1066.827) (-1067.445) * [-1062.215] (-1066.346) (-1065.385) (-1065.922) -- 0:00:37
      438000 -- (-1065.450) [-1063.797] (-1064.865) (-1068.177) * (-1069.460) (-1063.909) [-1064.279] (-1061.976) -- 0:00:37
      438500 -- (-1066.584) [-1062.978] (-1063.294) (-1067.812) * (-1063.867) (-1061.036) (-1067.049) [-1064.926] -- 0:00:37
      439000 -- [-1064.143] (-1063.231) (-1064.443) (-1066.096) * (-1067.937) (-1064.981) (-1066.791) [-1061.704] -- 0:00:37
      439500 -- [-1064.356] (-1064.243) (-1065.229) (-1064.781) * (-1066.435) [-1064.253] (-1062.122) (-1064.260) -- 0:00:36
      440000 -- [-1063.021] (-1063.942) (-1065.177) (-1067.240) * (-1063.830) (-1063.589) [-1065.484] (-1066.593) -- 0:00:36

      Average standard deviation of split frequencies: 0.010995

      440500 -- [-1061.854] (-1066.471) (-1064.422) (-1065.735) * (-1064.125) [-1063.063] (-1064.057) (-1066.550) -- 0:00:36
      441000 -- (-1066.055) (-1067.973) (-1070.615) [-1062.756] * [-1065.972] (-1065.601) (-1064.066) (-1065.819) -- 0:00:36
      441500 -- [-1062.808] (-1069.159) (-1072.781) (-1064.343) * [-1063.177] (-1062.268) (-1065.425) (-1068.722) -- 0:00:36
      442000 -- (-1063.964) [-1062.361] (-1067.643) (-1067.931) * (-1062.898) (-1065.800) (-1063.416) [-1068.759] -- 0:00:37
      442500 -- (-1064.886) [-1065.547] (-1067.448) (-1066.862) * (-1066.782) (-1065.317) [-1062.699] (-1064.028) -- 0:00:37
      443000 -- (-1063.054) [-1065.297] (-1064.796) (-1070.009) * (-1064.743) (-1062.221) [-1063.560] (-1065.148) -- 0:00:37
      443500 -- (-1063.814) (-1061.458) (-1070.664) [-1063.623] * (-1064.538) [-1064.547] (-1066.690) (-1068.287) -- 0:00:37
      444000 -- (-1063.829) [-1063.786] (-1066.890) (-1063.474) * [-1062.445] (-1066.244) (-1062.077) (-1064.620) -- 0:00:37
      444500 -- (-1062.385) (-1068.664) (-1066.626) [-1064.930] * (-1061.742) (-1064.232) (-1064.041) [-1065.861] -- 0:00:37
      445000 -- (-1062.599) [-1064.654] (-1066.061) (-1066.536) * (-1064.352) [-1063.044] (-1062.387) (-1064.248) -- 0:00:37

      Average standard deviation of split frequencies: 0.010393

      445500 -- (-1065.163) [-1063.799] (-1064.835) (-1066.290) * (-1062.511) (-1064.691) (-1061.135) [-1065.674] -- 0:00:37
      446000 -- (-1067.894) (-1062.831) [-1065.087] (-1062.546) * [-1064.640] (-1064.052) (-1063.246) (-1065.601) -- 0:00:37
      446500 -- (-1062.822) [-1063.196] (-1065.510) (-1061.239) * [-1065.440] (-1071.787) (-1063.953) (-1063.528) -- 0:00:37
      447000 -- (-1063.736) [-1067.708] (-1064.397) (-1063.272) * (-1065.581) (-1064.845) (-1065.085) [-1064.579] -- 0:00:37
      447500 -- [-1064.183] (-1065.375) (-1064.159) (-1065.702) * (-1062.383) (-1062.808) [-1067.208] (-1064.084) -- 0:00:37
      448000 -- [-1062.591] (-1065.985) (-1064.921) (-1065.231) * (-1061.221) [-1064.578] (-1068.544) (-1067.301) -- 0:00:36
      448500 -- [-1062.542] (-1066.213) (-1064.158) (-1064.565) * [-1063.201] (-1066.411) (-1067.093) (-1069.331) -- 0:00:36
      449000 -- [-1063.250] (-1066.573) (-1065.565) (-1066.155) * (-1066.555) [-1065.162] (-1064.965) (-1066.755) -- 0:00:36
      449500 -- (-1064.631) [-1066.703] (-1065.570) (-1064.113) * [-1062.803] (-1065.229) (-1065.263) (-1064.748) -- 0:00:36
      450000 -- (-1064.548) (-1065.495) (-1065.802) [-1065.862] * [-1061.294] (-1066.305) (-1061.642) (-1065.280) -- 0:00:36

      Average standard deviation of split frequencies: 0.010576

      450500 -- [-1066.024] (-1067.472) (-1070.908) (-1064.134) * (-1066.756) (-1068.001) (-1063.248) [-1065.626] -- 0:00:36
      451000 -- (-1072.118) [-1065.846] (-1064.647) (-1066.193) * (-1065.521) (-1066.222) [-1062.850] (-1064.971) -- 0:00:36
      451500 -- [-1065.283] (-1062.672) (-1066.157) (-1062.868) * (-1064.457) (-1065.284) (-1064.897) [-1065.267] -- 0:00:36
      452000 -- (-1067.436) (-1068.146) [-1066.026] (-1063.574) * (-1065.436) (-1068.256) [-1063.836] (-1064.902) -- 0:00:36
      452500 -- (-1065.099) (-1066.595) (-1064.336) [-1063.460] * (-1063.428) (-1067.161) [-1063.361] (-1065.123) -- 0:00:36
      453000 -- (-1068.549) (-1065.352) (-1067.082) [-1063.969] * (-1065.024) (-1064.844) (-1064.318) [-1061.843] -- 0:00:36
      453500 -- (-1064.580) (-1065.058) (-1062.338) [-1062.296] * (-1061.767) (-1064.679) [-1062.155] (-1062.865) -- 0:00:36
      454000 -- (-1064.473) (-1068.034) [-1062.625] (-1062.830) * (-1062.142) (-1067.187) [-1063.928] (-1065.899) -- 0:00:36
      454500 -- [-1061.905] (-1065.953) (-1067.813) (-1066.151) * (-1062.317) [-1065.355] (-1063.478) (-1067.076) -- 0:00:36
      455000 -- [-1061.894] (-1064.008) (-1069.387) (-1064.117) * [-1064.795] (-1066.292) (-1064.582) (-1064.086) -- 0:00:35

      Average standard deviation of split frequencies: 0.009365

      455500 -- (-1063.973) (-1065.067) (-1065.395) [-1061.779] * (-1062.086) (-1064.365) [-1060.941] (-1063.937) -- 0:00:35
      456000 -- (-1063.649) (-1064.855) (-1067.294) [-1064.336] * [-1068.987] (-1063.313) (-1062.705) (-1064.761) -- 0:00:35
      456500 -- (-1065.734) [-1067.595] (-1064.215) (-1065.264) * (-1065.373) [-1067.309] (-1061.576) (-1063.935) -- 0:00:35
      457000 -- (-1063.610) [-1066.232] (-1065.463) (-1064.579) * (-1066.653) (-1065.857) [-1063.262] (-1062.832) -- 0:00:35
      457500 -- (-1065.790) (-1067.385) [-1065.695] (-1062.446) * [-1064.860] (-1066.307) (-1064.236) (-1064.601) -- 0:00:36
      458000 -- (-1066.625) (-1065.710) (-1066.649) [-1063.681] * (-1064.455) (-1062.837) (-1062.449) [-1064.210] -- 0:00:36
      458500 -- (-1070.224) (-1067.410) (-1064.544) [-1063.196] * (-1064.381) (-1064.037) [-1064.345] (-1068.175) -- 0:00:36
      459000 -- (-1071.589) [-1065.397] (-1064.066) (-1065.683) * (-1063.439) (-1063.106) [-1061.844] (-1065.750) -- 0:00:36
      459500 -- (-1067.511) [-1062.558] (-1066.397) (-1065.514) * (-1066.171) (-1064.702) [-1062.725] (-1064.042) -- 0:00:36
      460000 -- [-1064.556] (-1063.521) (-1066.433) (-1068.236) * (-1062.067) [-1064.556] (-1067.934) (-1067.173) -- 0:00:36

      Average standard deviation of split frequencies: 0.008890

      460500 -- (-1065.367) [-1062.343] (-1067.014) (-1064.571) * (-1063.112) [-1065.215] (-1062.660) (-1064.938) -- 0:00:36
      461000 -- (-1068.796) (-1067.721) [-1064.170] (-1064.246) * [-1063.826] (-1063.818) (-1064.587) (-1067.546) -- 0:00:36
      461500 -- [-1063.380] (-1062.409) (-1062.791) (-1065.180) * (-1063.777) (-1067.695) (-1062.779) [-1064.437] -- 0:00:36
      462000 -- [-1064.773] (-1064.235) (-1064.069) (-1064.266) * [-1061.690] (-1063.950) (-1066.515) (-1063.344) -- 0:00:36
      462500 -- (-1064.972) [-1062.935] (-1062.271) (-1064.700) * (-1063.004) [-1064.294] (-1064.325) (-1063.730) -- 0:00:36
      463000 -- [-1063.487] (-1065.418) (-1063.395) (-1065.100) * (-1062.670) [-1063.442] (-1062.146) (-1064.709) -- 0:00:35
      463500 -- [-1063.902] (-1062.406) (-1061.180) (-1065.917) * (-1062.538) [-1065.692] (-1066.814) (-1066.644) -- 0:00:35
      464000 -- (-1063.290) (-1063.455) [-1062.060] (-1061.291) * (-1062.925) [-1062.851] (-1063.163) (-1064.802) -- 0:00:35
      464500 -- (-1065.507) [-1063.211] (-1063.909) (-1063.124) * (-1064.091) (-1067.451) (-1066.368) [-1070.589] -- 0:00:35
      465000 -- [-1066.311] (-1064.608) (-1062.838) (-1064.682) * (-1063.655) (-1064.187) [-1067.318] (-1066.382) -- 0:00:35

      Average standard deviation of split frequencies: 0.008030

      465500 -- (-1067.005) (-1069.120) [-1065.552] (-1066.014) * (-1064.423) (-1064.290) [-1068.531] (-1066.284) -- 0:00:35
      466000 -- (-1067.429) [-1064.583] (-1060.759) (-1063.737) * [-1061.515] (-1066.107) (-1063.955) (-1067.689) -- 0:00:35
      466500 -- (-1064.048) [-1061.225] (-1061.033) (-1063.227) * (-1061.535) (-1066.606) [-1064.801] (-1065.544) -- 0:00:35
      467000 -- (-1062.733) (-1065.491) (-1062.524) [-1069.091] * [-1062.284] (-1069.874) (-1064.929) (-1066.453) -- 0:00:35
      467500 -- (-1064.152) [-1061.305] (-1061.795) (-1064.281) * (-1068.054) (-1064.656) [-1062.876] (-1065.716) -- 0:00:35
      468000 -- (-1066.003) [-1064.067] (-1067.787) (-1063.491) * (-1065.719) (-1065.389) (-1067.142) [-1063.163] -- 0:00:35
      468500 -- (-1063.590) (-1061.877) (-1067.314) [-1067.232] * [-1066.071] (-1064.720) (-1062.149) (-1064.042) -- 0:00:35
      469000 -- (-1064.702) [-1062.459] (-1064.980) (-1064.409) * (-1064.172) [-1064.247] (-1061.910) (-1064.608) -- 0:00:35
      469500 -- [-1064.340] (-1062.592) (-1063.897) (-1064.879) * (-1067.687) (-1068.122) [-1064.701] (-1066.418) -- 0:00:35
      470000 -- (-1066.352) (-1062.800) [-1061.798] (-1062.734) * (-1065.744) (-1067.557) [-1065.302] (-1066.634) -- 0:00:34

      Average standard deviation of split frequencies: 0.008013

      470500 -- [-1067.396] (-1062.082) (-1066.988) (-1065.020) * (-1064.624) (-1064.965) (-1067.326) [-1064.783] -- 0:00:34
      471000 -- (-1061.047) [-1062.347] (-1063.186) (-1065.715) * (-1064.984) (-1064.157) [-1063.877] (-1064.899) -- 0:00:34
      471500 -- [-1062.210] (-1066.427) (-1068.374) (-1064.889) * (-1063.840) (-1064.670) [-1062.846] (-1067.020) -- 0:00:34
      472000 -- (-1068.011) (-1063.663) [-1066.278] (-1067.447) * (-1063.973) (-1065.113) [-1064.123] (-1064.033) -- 0:00:34
      472500 -- (-1064.317) (-1062.973) (-1062.738) [-1065.196] * (-1065.469) (-1063.538) [-1063.989] (-1064.938) -- 0:00:35
      473000 -- [-1067.027] (-1067.141) (-1065.612) (-1071.376) * (-1068.934) (-1069.113) [-1064.313] (-1064.626) -- 0:00:35
      473500 -- (-1062.878) [-1062.734] (-1063.026) (-1065.931) * (-1064.351) (-1068.735) (-1064.993) [-1068.132] -- 0:00:35
      474000 -- [-1065.248] (-1064.923) (-1066.087) (-1062.411) * [-1066.939] (-1068.049) (-1062.415) (-1062.988) -- 0:00:35
      474500 -- (-1061.782) [-1065.030] (-1063.253) (-1066.322) * (-1063.896) (-1066.603) [-1063.070] (-1064.684) -- 0:00:35
      475000 -- (-1066.828) (-1068.052) (-1061.612) [-1065.882] * [-1066.670] (-1066.162) (-1062.245) (-1065.382) -- 0:00:35

      Average standard deviation of split frequencies: 0.007737

      475500 -- [-1064.251] (-1070.389) (-1065.172) (-1064.823) * (-1069.543) (-1067.663) [-1060.839] (-1064.441) -- 0:00:35
      476000 -- (-1063.544) (-1064.038) [-1067.092] (-1066.369) * (-1065.096) (-1065.671) (-1062.526) [-1063.040] -- 0:00:35
      476500 -- (-1064.536) (-1066.331) [-1065.087] (-1064.304) * (-1066.940) (-1063.654) [-1061.094] (-1064.713) -- 0:00:35
      477000 -- [-1063.036] (-1064.604) (-1063.821) (-1065.558) * [-1066.567] (-1068.677) (-1062.216) (-1064.420) -- 0:00:35
      477500 -- (-1065.203) [-1064.439] (-1067.072) (-1065.268) * (-1062.653) (-1066.801) [-1062.524] (-1065.205) -- 0:00:35
      478000 -- (-1063.349) [-1064.175] (-1066.793) (-1067.786) * (-1067.333) (-1067.776) (-1062.162) [-1063.329] -- 0:00:34
      478500 -- (-1063.211) [-1064.068] (-1066.941) (-1065.383) * (-1062.174) (-1064.441) (-1064.546) [-1069.068] -- 0:00:34
      479000 -- (-1061.774) [-1063.747] (-1064.532) (-1064.030) * [-1064.725] (-1063.856) (-1063.874) (-1065.721) -- 0:00:34
      479500 -- (-1064.425) (-1064.039) [-1063.044] (-1065.430) * [-1064.354] (-1065.281) (-1069.354) (-1063.138) -- 0:00:34
      480000 -- [-1064.385] (-1064.571) (-1061.098) (-1064.837) * (-1066.871) (-1067.961) [-1063.350] (-1064.404) -- 0:00:34

      Average standard deviation of split frequencies: 0.007968

      480500 -- (-1065.772) [-1063.314] (-1060.456) (-1064.003) * (-1066.507) (-1066.025) [-1063.817] (-1065.946) -- 0:00:34
      481000 -- [-1064.582] (-1063.083) (-1064.858) (-1067.294) * (-1064.955) (-1065.029) [-1064.191] (-1069.536) -- 0:00:34
      481500 -- (-1066.167) (-1066.534) [-1062.045] (-1065.186) * (-1062.462) [-1066.627] (-1064.396) (-1066.331) -- 0:00:34
      482000 -- (-1065.795) [-1066.234] (-1066.139) (-1063.551) * (-1066.425) (-1065.744) (-1066.287) [-1064.075] -- 0:00:34
      482500 -- (-1064.783) (-1065.057) [-1065.766] (-1063.615) * (-1066.267) [-1066.963] (-1070.572) (-1066.042) -- 0:00:34
      483000 -- (-1065.202) (-1064.727) [-1060.779] (-1067.037) * [-1067.302] (-1069.779) (-1067.933) (-1065.051) -- 0:00:34
      483500 -- (-1065.221) (-1065.602) [-1062.563] (-1065.359) * (-1064.564) (-1068.075) [-1064.313] (-1066.645) -- 0:00:34
      484000 -- [-1065.523] (-1066.117) (-1062.060) (-1065.298) * [-1067.605] (-1068.855) (-1062.823) (-1066.074) -- 0:00:34
      484500 -- [-1064.052] (-1063.517) (-1061.303) (-1065.208) * (-1064.339) (-1066.503) (-1065.576) [-1064.541] -- 0:00:34
      485000 -- [-1065.291] (-1067.699) (-1063.123) (-1063.442) * (-1064.196) (-1065.864) (-1065.638) [-1064.839] -- 0:00:33

      Average standard deviation of split frequencies: 0.007881

      485500 -- [-1062.941] (-1065.301) (-1063.909) (-1062.740) * [-1062.769] (-1066.378) (-1069.110) (-1064.800) -- 0:00:33
      486000 -- (-1064.892) (-1067.882) (-1067.717) [-1062.705] * (-1065.004) (-1065.384) [-1062.355] (-1063.521) -- 0:00:33
      486500 -- (-1065.052) (-1067.489) (-1066.792) [-1061.738] * (-1062.728) [-1065.105] (-1063.552) (-1063.997) -- 0:00:33
      487000 -- (-1067.509) (-1067.620) [-1064.905] (-1063.008) * (-1065.772) (-1063.484) [-1063.704] (-1062.982) -- 0:00:33
      487500 -- [-1066.245] (-1067.437) (-1061.042) (-1063.304) * (-1065.247) (-1064.266) [-1061.157] (-1064.600) -- 0:00:34
      488000 -- (-1063.964) (-1064.690) (-1060.963) [-1063.171] * (-1061.942) [-1065.922] (-1063.088) (-1064.271) -- 0:00:34
      488500 -- [-1064.598] (-1066.074) (-1065.757) (-1063.956) * [-1061.355] (-1071.362) (-1062.382) (-1063.365) -- 0:00:34
      489000 -- (-1065.395) (-1065.007) [-1061.795] (-1063.813) * [-1062.624] (-1064.081) (-1061.759) (-1062.469) -- 0:00:34
      489500 -- (-1064.805) (-1065.997) [-1061.982] (-1062.343) * [-1062.347] (-1067.047) (-1061.925) (-1065.552) -- 0:00:34
      490000 -- (-1066.606) (-1062.672) [-1061.365] (-1064.089) * (-1065.635) (-1063.542) [-1062.394] (-1065.064) -- 0:00:34

      Average standard deviation of split frequencies: 0.008198

      490500 -- (-1065.558) (-1066.584) (-1062.259) [-1061.963] * [-1062.978] (-1066.020) (-1064.993) (-1063.935) -- 0:00:34
      491000 -- (-1065.116) (-1063.698) [-1061.720] (-1063.203) * (-1062.433) (-1061.678) [-1065.929] (-1064.896) -- 0:00:34
      491500 -- [-1063.962] (-1064.031) (-1062.680) (-1063.778) * (-1063.865) [-1064.157] (-1063.885) (-1065.482) -- 0:00:34
      492000 -- [-1065.771] (-1064.939) (-1067.785) (-1063.992) * (-1063.982) [-1064.596] (-1062.075) (-1065.518) -- 0:00:34
      492500 -- (-1066.623) (-1064.955) [-1065.425] (-1062.869) * (-1063.365) [-1064.112] (-1065.262) (-1064.777) -- 0:00:34
      493000 -- [-1067.035] (-1065.475) (-1071.425) (-1063.825) * (-1063.545) (-1067.795) (-1065.590) [-1064.864] -- 0:00:33
      493500 -- [-1067.859] (-1068.718) (-1069.359) (-1065.170) * [-1069.870] (-1065.068) (-1062.158) (-1066.642) -- 0:00:33
      494000 -- (-1065.379) (-1066.639) (-1067.139) [-1070.277] * (-1069.849) (-1065.718) (-1065.436) [-1064.724] -- 0:00:33
      494500 -- (-1065.533) (-1066.070) [-1065.304] (-1061.637) * (-1063.714) (-1068.429) [-1062.896] (-1063.951) -- 0:00:33
      495000 -- (-1065.319) (-1066.620) (-1064.925) [-1061.896] * (-1063.399) (-1064.565) [-1067.204] (-1064.710) -- 0:00:33

      Average standard deviation of split frequencies: 0.007160

      495500 -- (-1065.609) (-1065.613) [-1062.953] (-1062.042) * (-1065.610) [-1063.749] (-1066.403) (-1063.566) -- 0:00:33
      496000 -- (-1070.162) (-1065.674) [-1063.586] (-1064.635) * (-1064.857) [-1065.935] (-1063.639) (-1064.612) -- 0:00:33
      496500 -- (-1065.881) [-1068.680] (-1064.005) (-1066.326) * (-1066.295) (-1067.071) [-1063.801] (-1064.638) -- 0:00:33
      497000 -- [-1066.864] (-1065.370) (-1063.193) (-1067.252) * (-1063.163) [-1062.654] (-1064.791) (-1062.462) -- 0:00:33
      497500 -- (-1065.063) (-1067.321) [-1063.247] (-1065.179) * (-1061.947) (-1064.469) (-1062.057) [-1064.240] -- 0:00:33
      498000 -- (-1063.459) (-1062.942) [-1062.911] (-1063.939) * (-1063.643) [-1063.539] (-1063.155) (-1065.569) -- 0:00:33
      498500 -- (-1063.200) (-1064.632) [-1062.176] (-1063.870) * (-1065.568) (-1067.383) (-1063.769) [-1066.472] -- 0:00:33
      499000 -- (-1067.555) (-1065.072) (-1061.432) [-1065.400] * (-1066.889) (-1064.107) (-1064.048) [-1071.582] -- 0:00:33
      499500 -- (-1063.345) [-1065.413] (-1066.362) (-1064.591) * [-1064.570] (-1064.495) (-1065.647) (-1067.181) -- 0:00:33
      500000 -- (-1063.348) (-1065.574) (-1061.007) [-1063.097] * (-1066.255) [-1062.078] (-1065.305) (-1068.129) -- 0:00:33

      Average standard deviation of split frequencies: 0.007219

      500500 -- [-1063.413] (-1065.074) (-1064.004) (-1063.110) * (-1063.117) (-1063.295) (-1065.147) [-1063.487] -- 0:00:32
      501000 -- (-1066.164) (-1067.241) (-1063.372) [-1061.940] * (-1063.602) [-1064.162] (-1063.620) (-1065.955) -- 0:00:32
      501500 -- [-1064.361] (-1063.768) (-1063.168) (-1064.577) * (-1065.428) (-1064.145) [-1065.699] (-1064.840) -- 0:00:32
      502000 -- (-1063.106) (-1063.510) (-1062.511) [-1066.193] * (-1069.613) [-1066.728] (-1063.005) (-1063.084) -- 0:00:32
      502500 -- (-1063.786) (-1063.912) (-1063.019) [-1064.928] * (-1065.530) (-1066.849) [-1061.881] (-1063.869) -- 0:00:33
      503000 -- (-1063.121) (-1064.522) (-1062.750) [-1061.278] * (-1064.298) (-1064.397) (-1062.702) [-1064.650] -- 0:00:33
      503500 -- (-1064.768) [-1062.835] (-1061.425) (-1064.166) * [-1063.352] (-1063.866) (-1065.470) (-1067.723) -- 0:00:33
      504000 -- [-1062.216] (-1064.052) (-1064.579) (-1061.457) * (-1067.414) [-1065.793] (-1063.184) (-1063.503) -- 0:00:33
      504500 -- [-1061.581] (-1067.754) (-1065.593) (-1064.444) * (-1068.780) (-1066.520) (-1065.089) [-1065.295] -- 0:00:33
      505000 -- [-1062.078] (-1066.874) (-1062.831) (-1063.073) * (-1062.677) (-1065.206) (-1064.995) [-1063.697] -- 0:00:33

      Average standard deviation of split frequencies: 0.007701

      505500 -- [-1065.564] (-1067.623) (-1064.891) (-1061.900) * [-1063.935] (-1063.974) (-1062.181) (-1062.977) -- 0:00:33
      506000 -- [-1064.188] (-1065.524) (-1066.594) (-1063.512) * (-1068.483) [-1064.368] (-1066.894) (-1066.042) -- 0:00:33
      506500 -- (-1064.255) (-1068.758) (-1063.395) [-1061.017] * (-1064.799) (-1068.082) (-1066.841) [-1064.998] -- 0:00:33
      507000 -- [-1065.111] (-1064.413) (-1064.557) (-1064.284) * [-1063.979] (-1067.249) (-1067.263) (-1063.543) -- 0:00:33
      507500 -- (-1065.348) [-1063.869] (-1066.229) (-1064.310) * (-1064.082) (-1064.757) (-1063.809) [-1063.718] -- 0:00:32
      508000 -- (-1062.691) [-1064.451] (-1062.029) (-1068.033) * (-1069.411) [-1064.093] (-1064.339) (-1063.785) -- 0:00:32
      508500 -- (-1064.018) (-1062.598) [-1064.344] (-1065.742) * (-1065.109) (-1064.392) [-1061.044] (-1065.002) -- 0:00:32
      509000 -- (-1063.290) (-1063.485) (-1064.803) [-1067.676] * [-1063.788] (-1062.804) (-1063.929) (-1062.026) -- 0:00:32
      509500 -- (-1068.351) (-1065.539) [-1061.527] (-1066.180) * (-1064.902) [-1062.499] (-1064.908) (-1064.466) -- 0:00:32
      510000 -- [-1061.040] (-1065.967) (-1066.543) (-1063.809) * (-1063.088) (-1063.620) [-1063.436] (-1064.352) -- 0:00:32

      Average standard deviation of split frequencies: 0.007939

      510500 -- (-1066.613) [-1066.954] (-1064.576) (-1063.011) * (-1066.754) (-1065.449) (-1067.211) [-1064.921] -- 0:00:32
      511000 -- (-1063.625) [-1062.025] (-1062.890) (-1066.644) * (-1068.972) (-1062.350) [-1063.128] (-1063.726) -- 0:00:32
      511500 -- [-1063.020] (-1064.817) (-1065.284) (-1064.399) * (-1065.091) (-1064.527) [-1064.439] (-1063.918) -- 0:00:32
      512000 -- (-1063.354) (-1062.599) [-1066.638] (-1062.890) * [-1067.396] (-1068.429) (-1064.226) (-1062.248) -- 0:00:32
      512500 -- (-1064.638) [-1062.877] (-1065.826) (-1064.715) * [-1064.594] (-1067.841) (-1063.277) (-1065.116) -- 0:00:32
      513000 -- [-1062.897] (-1063.427) (-1064.527) (-1064.516) * (-1064.115) (-1063.261) (-1067.003) [-1064.204] -- 0:00:32
      513500 -- (-1063.011) (-1063.866) (-1064.921) [-1065.106] * (-1065.865) [-1060.982] (-1065.429) (-1063.135) -- 0:00:32
      514000 -- (-1061.047) (-1064.125) (-1061.693) [-1065.929] * (-1065.933) [-1061.697] (-1064.952) (-1061.935) -- 0:00:32
      514500 -- (-1062.170) (-1065.952) [-1062.755] (-1067.109) * (-1068.331) (-1065.808) (-1071.846) [-1060.911] -- 0:00:32
      515000 -- (-1062.742) [-1065.151] (-1068.477) (-1068.506) * (-1066.189) (-1063.355) (-1065.053) [-1061.372] -- 0:00:32

      Average standard deviation of split frequencies: 0.008588