--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:38:20 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0431/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1063.11 -1067.03
2 -1063.14 -1066.72
--------------------------------------
TOTAL -1063.13 -1066.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.878346 0.088669 0.378800 1.507150 0.847670 1393.81 1439.94 1.000
r(A<->C){all} 0.156776 0.019421 0.000363 0.443137 0.116882 41.34 101.49 1.004
r(A<->G){all} 0.218958 0.025211 0.000435 0.519815 0.188285 175.99 187.20 1.001
r(A<->T){all} 0.174259 0.021925 0.000064 0.472546 0.133424 146.81 201.71 1.000
r(C<->G){all} 0.136592 0.017124 0.000035 0.395176 0.096848 231.38 242.16 1.000
r(C<->T){all} 0.169695 0.021574 0.000008 0.465974 0.127628 200.44 205.20 1.000
r(G<->T){all} 0.143720 0.015791 0.000047 0.407148 0.110301 202.71 214.75 1.007
pi(A){all} 0.230657 0.000222 0.201243 0.259657 0.230381 1250.15 1326.53 1.000
pi(C){all} 0.351937 0.000278 0.319905 0.383715 0.352567 1199.07 1208.41 1.000
pi(G){all} 0.253172 0.000237 0.222745 0.282469 0.252933 1194.93 1204.82 1.000
pi(T){all} 0.164234 0.000177 0.138511 0.190658 0.163776 1300.60 1349.42 1.000
alpha{1,2} 0.278740 0.107735 0.000175 0.893726 0.178806 1416.34 1458.67 1.000
alpha{3} 0.418570 0.248528 0.000316 1.451539 0.230656 1057.19 1207.33 1.000
pinvar{all} 0.995450 0.000014 0.988286 0.999937 0.996431 959.91 1061.56 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1035.647153
Model 2: PositiveSelection -1035.277566
Model 0: one-ratio -1035.277732
Model 7: beta -1035.647156
Model 8: beta&w>1 -1035.277173
Model 0 vs 1 0.7388419999997495
Model 2 vs 1 0.7391739999998208
Model 8 vs 7 0.7399660000000949
>C1
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C2
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C3
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C4
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C5
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C6
MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=259
C1 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C2 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C3 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C4 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C5 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C6 MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
*************** **********************************
C1 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C2 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C3 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C4 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C5 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C6 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
**************************************************
C1 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C2 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C3 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C4 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C5 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C6 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
**************************************************
C1 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C2 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C3 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C4 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C5 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C6 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
**************************************************
C1 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C2 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C3 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C4 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C5 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C6 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
**************************************************
C1 GLTICDAPR
C2 GLTICDAPR
C3 GLTICDAPR
C4 GLTICDAPR
C5 GLTICDAPR
C6 GLTICDAPR
*********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 259 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 259 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7770]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7770]--->[7770]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.496 Mb, Max= 30.813 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C2 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C3 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C4 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C5 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
C6 MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
*************** **********************************
C1 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C2 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C3 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C4 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C5 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
C6 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
**************************************************
C1 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C2 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C3 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C4 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C5 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
C6 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
**************************************************
C1 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C2 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C3 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C4 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C5 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
C6 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
**************************************************
C1 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C2 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C3 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C4 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C5 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
C6 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
**************************************************
C1 GLTICDAPR
C2 GLTICDAPR
C3 GLTICDAPR
C4 GLTICDAPR
C5 GLTICDAPR
C6 GLTICDAPR
*********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.61 C1 C6 99.61
TOP 5 0 99.61 C6 C1 99.61
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.61 C2 C6 99.61
TOP 5 1 99.61 C6 C2 99.61
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.61 C3 C6 99.61
TOP 5 2 99.61 C6 C3 99.61
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.61 C4 C6 99.61
TOP 5 3 99.61 C6 C4 99.61
BOT 4 5 99.61 C5 C6 99.61
TOP 5 4 99.61 C6 C5 99.61
AVG 0 C1 * 99.92
AVG 1 C2 * 99.92
AVG 2 C3 * 99.92
AVG 3 C4 * 99.92
AVG 4 C5 * 99.92
AVG 5 C6 * 99.61
TOT TOT * 99.87
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C2 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C3 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C4 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C5 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
C6 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGAGTC
**********************************************.***
C1 TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C2 TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C3 TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C4 TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C5 TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
C6 TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
**************************************************
C1 CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C2 CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C3 CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C4 CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C5 CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
C6 CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
**************************************************
C1 CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C2 CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C3 CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C4 CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C5 CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
C6 CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
**************************************************
C1 AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C2 AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C3 AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C4 AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C5 AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
C6 AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
**************************************************
C1 CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C2 CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C3 CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C4 CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C5 CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
C6 CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
**************************************************
C1 GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C2 GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C3 GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C4 GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C5 GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
C6 GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
**************************************************
C1 CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C2 CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C3 CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C4 CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C5 CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
C6 CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
**************************************************
C1 AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C2 AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C3 AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C4 AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C5 AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
C6 AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
**************************************************
C1 ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C2 ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C3 ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C4 ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C5 ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
C6 ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
**************************************************
C1 TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C2 TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C3 TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C4 TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C5 TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
C6 TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
**************************************************
C1 GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C2 GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C3 GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C4 GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C5 GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
C6 GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
**************************************************
C1 GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C2 GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C3 GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C4 GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C5 GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
C6 GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
**************************************************
C1 AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C2 AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C3 AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C4 AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C5 AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
C6 AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
**************************************************
C1 CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C2 CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C3 CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C4 CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C5 CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
C6 CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
**************************************************
C1 GGCCTGACGATCTGCGATGCTCCCCGC
C2 GGCCTGACGATCTGCGATGCTCCCCGC
C3 GGCCTGACGATCTGCGATGCTCCCCGC
C4 GGCCTGACGATCTGCGATGCTCCCCGC
C5 GGCCTGACGATCTGCGATGCTCCCCGC
C6 GGCCTGACGATCTGCGATGCTCCCCGC
***************************
>C1
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C2
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C3
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C4
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C5
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C6
ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGAGTC
TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG
CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA
CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA
AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC
CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC
GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA
CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG
AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC
ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC
TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG
GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC
GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC
AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA
CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA
GGCCTGACGATCTGCGATGCTCCCCGC
>C1
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C2
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C3
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C4
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C5
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
>C6
MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
GLTICDAPR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 777 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579801007
Setting output file names to "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 688405482
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1182100392
Seed = 1214136522
Swapseed = 1579801007
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1742.366122 -- -24.965149
Chain 2 -- -1742.364572 -- -24.965149
Chain 3 -- -1742.366122 -- -24.965149
Chain 4 -- -1742.366023 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1742.365790 -- -24.965149
Chain 2 -- -1742.366122 -- -24.965149
Chain 3 -- -1742.366023 -- -24.965149
Chain 4 -- -1742.366023 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1742.366] (-1742.365) (-1742.366) (-1742.366) * [-1742.366] (-1742.366) (-1742.366) (-1742.366)
500 -- (-1074.739) (-1086.597) [-1068.458] (-1068.831) * (-1070.087) [-1072.355] (-1077.569) (-1075.692) -- 0:00:00
1000 -- (-1074.644) (-1076.588) (-1067.248) [-1072.828] * (-1069.004) (-1066.642) (-1065.780) [-1066.096] -- 0:00:00
1500 -- (-1066.883) [-1063.839] (-1070.597) (-1087.626) * (-1066.849) (-1071.073) (-1071.846) [-1067.071] -- 0:00:00
2000 -- (-1070.687) [-1064.508] (-1080.862) (-1077.654) * (-1067.782) (-1071.179) (-1066.158) [-1063.758] -- 0:00:00
2500 -- [-1067.164] (-1071.191) (-1066.972) (-1072.272) * [-1065.346] (-1070.315) (-1068.811) (-1067.103) -- 0:00:00
3000 -- (-1071.720) (-1070.893) (-1067.024) [-1070.883] * (-1071.163) (-1079.651) (-1067.103) [-1067.479] -- 0:00:00
3500 -- [-1066.961] (-1067.331) (-1068.481) (-1066.637) * (-1070.070) (-1067.090) [-1071.386] (-1080.277) -- 0:00:00
4000 -- (-1067.448) (-1065.621) [-1066.172] (-1070.314) * (-1067.612) [-1063.871] (-1080.288) (-1065.986) -- 0:00:00
4500 -- (-1068.256) (-1066.897) (-1066.814) [-1076.360] * (-1064.847) (-1074.163) (-1077.770) [-1065.716] -- 0:00:00
5000 -- (-1072.895) (-1072.666) (-1070.603) [-1071.622] * (-1069.910) [-1062.842] (-1068.324) (-1066.908) -- 0:00:00
Average standard deviation of split frequencies: 0.111304
5500 -- (-1068.158) [-1068.711] (-1067.698) (-1073.402) * (-1068.047) [-1066.686] (-1070.886) (-1069.641) -- 0:00:00
6000 -- (-1070.421) [-1069.227] (-1062.928) (-1076.891) * [-1067.172] (-1065.448) (-1070.447) (-1066.646) -- 0:00:00
6500 -- (-1084.717) (-1069.663) [-1069.799] (-1069.561) * (-1070.942) (-1066.304) (-1070.189) [-1072.574] -- 0:02:32
7000 -- (-1073.763) (-1069.920) [-1072.695] (-1067.911) * (-1065.878) (-1068.693) (-1064.312) [-1065.439] -- 0:02:21
7500 -- [-1066.234] (-1068.971) (-1077.625) (-1071.378) * (-1065.907) (-1071.617) [-1067.924] (-1062.577) -- 0:02:12
8000 -- (-1067.623) (-1070.699) (-1071.830) [-1064.938] * (-1066.233) (-1074.797) (-1065.281) [-1071.532] -- 0:02:04
8500 -- (-1070.328) (-1068.395) [-1071.217] (-1064.790) * [-1062.918] (-1079.187) (-1069.060) (-1070.320) -- 0:01:56
9000 -- [-1063.232] (-1066.590) (-1072.815) (-1065.872) * (-1068.630) (-1073.787) (-1064.243) [-1069.685] -- 0:01:50
9500 -- (-1061.677) [-1064.779] (-1062.681) (-1066.251) * (-1070.469) (-1074.715) (-1067.908) [-1072.487] -- 0:01:44
10000 -- (-1069.784) (-1068.177) [-1065.710] (-1064.693) * [-1074.489] (-1073.808) (-1079.328) (-1066.464) -- 0:01:39
Average standard deviation of split frequencies: 0.067344
10500 -- (-1068.262) (-1069.858) [-1068.934] (-1066.725) * (-1072.643) (-1071.672) [-1067.366] (-1069.517) -- 0:01:34
11000 -- (-1068.612) (-1069.752) (-1069.064) [-1062.326] * (-1064.910) [-1070.097] (-1070.197) (-1061.199) -- 0:01:29
11500 -- (-1072.411) (-1069.859) [-1066.205] (-1066.925) * (-1065.913) [-1064.387] (-1069.246) (-1073.169) -- 0:01:25
12000 -- (-1068.827) (-1070.112) [-1066.096] (-1065.211) * (-1069.213) (-1062.958) [-1066.172] (-1069.499) -- 0:01:22
12500 -- (-1075.234) [-1069.244] (-1068.963) (-1070.445) * (-1070.337) (-1071.334) (-1064.734) [-1070.108] -- 0:01:19
13000 -- (-1075.408) (-1076.222) [-1063.818] (-1063.228) * [-1064.805] (-1067.820) (-1068.151) (-1065.653) -- 0:01:15
13500 -- (-1063.521) (-1071.389) [-1067.765] (-1063.157) * (-1075.927) (-1065.573) [-1070.263] (-1068.624) -- 0:01:13
14000 -- (-1066.361) [-1066.745] (-1066.218) (-1065.152) * (-1069.753) (-1074.111) [-1066.353] (-1073.581) -- 0:01:10
14500 -- [-1062.832] (-1062.183) (-1066.325) (-1066.092) * (-1064.687) (-1064.932) (-1071.701) [-1073.898] -- 0:01:07
15000 -- (-1069.463) (-1069.203) (-1076.179) [-1069.757] * (-1071.633) (-1067.055) [-1068.737] (-1071.468) -- 0:01:05
Average standard deviation of split frequencies: 0.066679
15500 -- [-1064.541] (-1077.706) (-1067.454) (-1062.512) * (-1072.273) [-1064.844] (-1070.499) (-1075.299) -- 0:01:03
16000 -- [-1069.303] (-1066.288) (-1063.374) (-1064.702) * (-1072.843) (-1064.201) [-1068.990] (-1084.294) -- 0:01:01
16500 -- (-1077.701) (-1075.147) (-1070.017) [-1064.915] * (-1074.694) (-1067.911) (-1066.283) [-1062.902] -- 0:00:59
17000 -- (-1065.869) [-1072.010] (-1072.334) (-1063.136) * (-1078.702) [-1066.644] (-1065.782) (-1062.325) -- 0:00:57
17500 -- (-1076.914) [-1071.652] (-1071.845) (-1066.613) * (-1082.487) [-1064.328] (-1066.693) (-1064.015) -- 0:00:56
18000 -- [-1069.395] (-1067.164) (-1066.420) (-1066.681) * (-1071.503) [-1072.663] (-1066.844) (-1063.320) -- 0:00:54
18500 -- (-1069.653) [-1068.191] (-1070.472) (-1063.247) * (-1073.478) (-1066.504) [-1063.764] (-1063.342) -- 0:00:53
19000 -- (-1079.029) (-1066.262) [-1072.847] (-1064.347) * (-1071.557) [-1068.215] (-1071.668) (-1064.550) -- 0:00:51
19500 -- (-1088.219) [-1067.462] (-1068.719) (-1065.544) * (-1071.655) (-1069.236) [-1065.734] (-1063.862) -- 0:00:50
20000 -- (-1063.517) (-1066.561) (-1074.588) [-1063.734] * (-1073.309) [-1062.077] (-1064.374) (-1063.984) -- 0:00:49
Average standard deviation of split frequencies: 0.064628
20500 -- (-1063.528) (-1074.728) [-1066.472] (-1064.642) * (-1069.717) (-1064.600) [-1071.672] (-1066.315) -- 0:00:47
21000 -- [-1064.237] (-1071.574) (-1069.619) (-1069.062) * (-1074.470) [-1061.818] (-1074.506) (-1063.743) -- 0:00:46
21500 -- (-1061.133) (-1070.498) [-1063.124] (-1062.783) * (-1073.149) [-1070.469] (-1062.951) (-1063.558) -- 0:01:31
22000 -- (-1062.340) (-1071.280) [-1068.465] (-1063.698) * (-1069.652) [-1063.208] (-1064.626) (-1063.525) -- 0:01:28
22500 -- (-1067.710) [-1065.924] (-1064.841) (-1065.425) * (-1063.507) [-1065.383] (-1068.873) (-1067.881) -- 0:01:26
23000 -- (-1063.256) (-1078.274) (-1065.259) [-1065.076] * (-1068.536) (-1072.976) (-1067.677) [-1067.376] -- 0:01:24
23500 -- (-1062.306) (-1089.548) [-1063.692] (-1063.480) * (-1071.118) (-1074.254) [-1068.953] (-1064.874) -- 0:01:23
24000 -- (-1063.172) (-1069.087) [-1065.388] (-1073.092) * [-1064.473] (-1085.834) (-1066.761) (-1065.407) -- 0:01:21
24500 -- (-1062.412) [-1065.716] (-1065.558) (-1065.402) * (-1070.118) (-1069.950) (-1070.358) [-1061.250] -- 0:01:19
25000 -- [-1064.823] (-1064.768) (-1070.406) (-1066.242) * (-1063.492) [-1063.668] (-1066.452) (-1063.490) -- 0:01:18
Average standard deviation of split frequencies: 0.051371
25500 -- (-1064.642) (-1064.981) (-1067.565) [-1063.295] * (-1061.400) [-1062.577] (-1073.020) (-1061.764) -- 0:01:16
26000 -- [-1063.789] (-1071.848) (-1065.871) (-1062.931) * [-1071.362] (-1062.463) (-1068.469) (-1065.111) -- 0:01:14
26500 -- (-1067.292) (-1070.466) [-1064.258] (-1064.406) * (-1070.377) (-1062.697) [-1067.263] (-1063.848) -- 0:01:13
27000 -- (-1066.152) [-1063.568] (-1064.791) (-1062.647) * (-1065.679) (-1065.201) [-1069.156] (-1064.608) -- 0:01:12
27500 -- (-1067.338) (-1066.285) (-1068.875) [-1063.709] * (-1070.625) (-1062.174) [-1070.218] (-1064.034) -- 0:01:10
28000 -- (-1064.931) (-1064.655) [-1064.303] (-1063.078) * (-1074.143) (-1064.031) [-1066.238] (-1064.146) -- 0:01:09
28500 -- (-1063.350) (-1067.579) [-1069.441] (-1065.388) * [-1066.117] (-1063.467) (-1066.942) (-1065.488) -- 0:01:08
29000 -- (-1064.268) (-1064.245) [-1071.020] (-1062.842) * (-1067.301) (-1064.400) [-1067.358] (-1067.488) -- 0:01:06
29500 -- (-1067.139) [-1063.880] (-1073.587) (-1065.232) * (-1075.254) (-1066.041) (-1072.081) [-1064.388] -- 0:01:05
30000 -- (-1066.318) [-1063.161] (-1069.352) (-1063.890) * (-1067.399) (-1065.591) [-1070.866] (-1066.725) -- 0:01:04
Average standard deviation of split frequencies: 0.059391
30500 -- (-1065.756) (-1067.446) [-1066.205] (-1064.154) * (-1068.043) [-1064.923] (-1071.586) (-1065.518) -- 0:01:03
31000 -- (-1067.317) (-1066.024) [-1066.489] (-1064.266) * (-1067.383) (-1063.074) (-1063.749) [-1065.003] -- 0:01:02
31500 -- [-1063.398] (-1064.033) (-1066.271) (-1067.522) * [-1067.818] (-1061.164) (-1068.497) (-1066.695) -- 0:01:01
32000 -- (-1064.206) (-1067.032) [-1064.601] (-1065.367) * (-1065.512) (-1064.036) [-1064.467] (-1068.175) -- 0:01:00
32500 -- (-1063.188) (-1065.277) [-1066.188] (-1065.472) * (-1070.706) (-1064.959) [-1067.249] (-1064.237) -- 0:00:59
33000 -- (-1063.539) (-1062.869) (-1066.627) [-1064.374] * (-1073.847) (-1062.767) [-1069.463] (-1063.733) -- 0:00:58
33500 -- (-1065.123) (-1064.186) (-1070.720) [-1062.476] * (-1072.337) (-1060.926) [-1071.347] (-1063.590) -- 0:00:57
34000 -- (-1064.700) (-1063.214) [-1066.300] (-1064.040) * (-1073.096) (-1060.660) (-1065.136) [-1063.291] -- 0:00:56
34500 -- (-1069.754) (-1063.884) (-1069.085) [-1061.567] * (-1076.075) (-1062.923) [-1067.598] (-1065.862) -- 0:00:55
35000 -- [-1063.498] (-1063.798) (-1067.272) (-1061.440) * (-1076.551) (-1062.648) [-1064.904] (-1065.771) -- 0:00:55
Average standard deviation of split frequencies: 0.053625
35500 -- (-1068.044) (-1064.712) (-1064.518) [-1063.777] * [-1069.537] (-1062.033) (-1066.789) (-1061.853) -- 0:00:54
36000 -- [-1063.848] (-1066.992) (-1072.095) (-1066.242) * (-1067.342) (-1061.853) [-1070.450] (-1064.202) -- 0:00:53
36500 -- [-1063.711] (-1067.447) (-1066.488) (-1064.458) * [-1067.969] (-1062.252) (-1082.672) (-1062.561) -- 0:01:19
37000 -- (-1064.661) (-1066.284) [-1075.529] (-1067.149) * [-1068.937] (-1065.712) (-1076.883) (-1063.664) -- 0:01:18
37500 -- (-1065.583) (-1065.399) [-1066.538] (-1067.851) * (-1067.216) (-1063.253) [-1064.247] (-1065.579) -- 0:01:17
38000 -- (-1064.305) (-1065.385) [-1070.152] (-1068.166) * (-1072.122) (-1066.913) [-1063.529] (-1063.866) -- 0:01:15
38500 -- (-1064.864) [-1066.739] (-1074.220) (-1066.689) * (-1073.154) [-1065.300] (-1065.041) (-1062.558) -- 0:01:14
39000 -- (-1065.566) (-1062.453) [-1076.110] (-1063.339) * [-1066.886] (-1065.016) (-1062.950) (-1063.363) -- 0:01:13
39500 -- (-1063.535) (-1064.944) [-1067.635] (-1066.262) * (-1069.598) (-1064.583) [-1063.168] (-1063.582) -- 0:01:12
40000 -- (-1064.596) (-1063.119) [-1065.517] (-1066.278) * [-1068.415] (-1063.971) (-1064.567) (-1062.606) -- 0:01:12
Average standard deviation of split frequencies: 0.056129
40500 -- (-1065.983) (-1068.137) [-1061.835] (-1062.793) * (-1065.975) (-1065.769) [-1064.116] (-1062.424) -- 0:01:11
41000 -- (-1062.012) (-1065.828) [-1063.607] (-1063.251) * (-1083.588) [-1063.455] (-1064.527) (-1065.797) -- 0:01:10
41500 -- (-1067.068) (-1064.302) [-1064.040] (-1063.000) * (-1071.490) (-1062.628) (-1062.690) [-1065.294] -- 0:01:09
42000 -- (-1066.271) (-1066.869) [-1063.919] (-1069.947) * (-1069.072) (-1063.324) (-1063.755) [-1065.698] -- 0:01:08
42500 -- (-1065.537) (-1065.406) (-1063.832) [-1064.218] * (-1073.599) (-1064.652) [-1068.011] (-1062.712) -- 0:01:07
43000 -- [-1066.450] (-1063.341) (-1063.719) (-1063.668) * [-1069.444] (-1066.761) (-1064.279) (-1063.093) -- 0:01:06
43500 -- (-1064.319) (-1067.358) [-1063.610] (-1062.902) * (-1067.233) (-1068.565) [-1063.769] (-1063.266) -- 0:01:05
44000 -- (-1064.874) [-1067.647] (-1063.985) (-1063.510) * [-1071.079] (-1064.578) (-1062.490) (-1069.564) -- 0:01:05
44500 -- [-1064.659] (-1068.493) (-1062.778) (-1061.229) * [-1066.453] (-1064.565) (-1064.155) (-1065.018) -- 0:01:04
45000 -- (-1062.353) (-1069.176) [-1062.723] (-1065.596) * [-1067.855] (-1065.992) (-1062.965) (-1064.920) -- 0:01:03
Average standard deviation of split frequencies: 0.046581
45500 -- (-1061.322) [-1065.657] (-1063.365) (-1062.325) * (-1073.666) (-1064.256) [-1064.165] (-1063.618) -- 0:01:02
46000 -- (-1063.000) (-1065.392) (-1062.762) [-1062.737] * (-1073.728) (-1063.815) [-1063.567] (-1063.713) -- 0:01:02
46500 -- [-1063.125] (-1062.183) (-1063.653) (-1065.418) * [-1066.982] (-1062.375) (-1064.969) (-1065.523) -- 0:01:01
47000 -- (-1064.307) [-1065.677] (-1067.004) (-1063.951) * [-1068.595] (-1065.033) (-1069.175) (-1063.022) -- 0:01:00
47500 -- [-1063.883] (-1065.758) (-1065.817) (-1069.091) * (-1068.456) [-1062.659] (-1062.679) (-1065.024) -- 0:01:00
48000 -- [-1065.382] (-1062.352) (-1065.557) (-1065.341) * (-1077.241) [-1063.413] (-1062.972) (-1061.240) -- 0:00:59
48500 -- [-1064.534] (-1065.923) (-1065.590) (-1065.753) * [-1070.339] (-1063.853) (-1064.631) (-1065.223) -- 0:00:58
49000 -- [-1061.485] (-1065.697) (-1064.405) (-1063.797) * [-1070.755] (-1064.829) (-1063.521) (-1064.389) -- 0:00:58
49500 -- (-1063.783) (-1067.437) (-1065.007) [-1062.325] * (-1068.963) (-1061.518) (-1063.483) [-1062.609] -- 0:00:57
50000 -- (-1066.069) [-1066.320] (-1062.490) (-1063.403) * [-1072.611] (-1061.726) (-1064.046) (-1063.044) -- 0:00:57
Average standard deviation of split frequencies: 0.042976
50500 -- (-1063.237) (-1062.680) (-1065.765) [-1062.856] * (-1073.117) (-1063.752) [-1062.691] (-1064.083) -- 0:00:56
51000 -- (-1069.193) (-1066.474) (-1061.912) [-1063.467] * [-1071.993] (-1061.467) (-1065.048) (-1068.581) -- 0:00:55
51500 -- (-1071.352) [-1064.162] (-1064.028) (-1063.546) * (-1076.568) (-1062.296) [-1063.900] (-1067.493) -- 0:01:13
52000 -- (-1064.518) (-1063.145) (-1064.694) [-1066.199] * [-1074.966] (-1062.697) (-1061.910) (-1064.211) -- 0:01:12
52500 -- (-1064.688) (-1064.967) (-1066.333) [-1062.295] * [-1064.918] (-1063.323) (-1065.949) (-1064.306) -- 0:01:12
53000 -- (-1063.341) (-1066.993) (-1066.196) [-1063.911] * (-1077.127) (-1062.774) (-1065.132) [-1064.271] -- 0:01:11
53500 -- (-1063.567) (-1066.283) (-1067.916) [-1064.130] * (-1077.807) (-1063.148) [-1066.971] (-1063.873) -- 0:01:10
54000 -- [-1062.806] (-1067.098) (-1065.433) (-1063.306) * (-1072.352) (-1061.672) [-1065.540] (-1064.923) -- 0:01:10
54500 -- (-1065.765) [-1068.399] (-1071.139) (-1072.866) * (-1081.603) (-1063.302) [-1063.685] (-1064.259) -- 0:01:09
55000 -- (-1063.983) (-1061.643) (-1066.018) [-1062.030] * (-1074.913) (-1064.361) [-1062.943] (-1063.711) -- 0:01:08
Average standard deviation of split frequencies: 0.037881
55500 -- [-1063.188] (-1061.874) (-1066.223) (-1064.919) * (-1067.010) (-1063.477) (-1066.475) [-1063.341] -- 0:01:08
56000 -- (-1064.124) (-1067.324) [-1062.687] (-1062.310) * (-1094.677) (-1064.023) (-1062.140) [-1063.315] -- 0:01:07
56500 -- (-1066.178) (-1064.753) [-1065.102] (-1065.750) * (-1067.958) (-1064.607) (-1062.174) [-1062.836] -- 0:01:06
57000 -- (-1068.167) (-1062.645) (-1065.390) [-1064.552] * (-1064.988) [-1061.884] (-1062.792) (-1064.378) -- 0:01:06
57500 -- (-1064.718) [-1062.892] (-1064.560) (-1062.041) * [-1065.963] (-1063.807) (-1063.122) (-1064.247) -- 0:01:05
58000 -- (-1061.549) (-1062.032) (-1064.999) [-1065.627] * (-1064.698) (-1063.120) [-1064.481] (-1064.656) -- 0:01:04
58500 -- (-1062.887) [-1063.033] (-1063.765) (-1065.108) * (-1067.180) [-1061.642] (-1064.550) (-1064.084) -- 0:01:04
59000 -- [-1064.132] (-1062.045) (-1065.737) (-1063.383) * (-1066.175) (-1062.319) (-1063.564) [-1064.223] -- 0:01:03
59500 -- (-1065.981) (-1065.732) (-1065.739) [-1063.233] * (-1067.801) [-1063.726] (-1064.705) (-1073.213) -- 0:01:03
60000 -- (-1067.981) (-1066.584) [-1067.213] (-1063.598) * (-1063.858) [-1065.965] (-1066.279) (-1067.907) -- 0:01:02
Average standard deviation of split frequencies: 0.039629
60500 -- [-1067.267] (-1065.738) (-1063.985) (-1065.638) * (-1065.438) (-1064.326) [-1064.503] (-1067.466) -- 0:01:02
61000 -- (-1070.713) (-1062.398) (-1065.389) [-1063.080] * (-1066.236) (-1062.654) (-1066.454) [-1065.355] -- 0:01:01
61500 -- (-1068.078) [-1061.974] (-1064.599) (-1062.040) * (-1065.924) (-1062.459) (-1066.102) [-1063.898] -- 0:01:01
62000 -- (-1068.905) (-1063.014) [-1062.773] (-1064.042) * (-1074.955) [-1063.161] (-1063.153) (-1066.901) -- 0:01:00
62500 -- (-1063.983) [-1062.229] (-1064.861) (-1065.628) * (-1065.677) (-1066.479) (-1065.008) [-1066.117] -- 0:01:00
63000 -- (-1067.243) [-1064.526] (-1065.579) (-1064.402) * (-1065.537) [-1062.897] (-1061.892) (-1065.971) -- 0:00:59
63500 -- (-1066.406) (-1066.409) (-1064.747) [-1064.184] * [-1063.613] (-1062.000) (-1063.938) (-1064.356) -- 0:00:58
64000 -- (-1066.600) [-1066.365] (-1064.372) (-1063.759) * (-1067.343) [-1063.335] (-1061.897) (-1064.434) -- 0:00:58
64500 -- (-1064.241) (-1065.206) (-1064.909) [-1062.022] * [-1064.570] (-1071.269) (-1063.963) (-1065.234) -- 0:00:58
65000 -- (-1064.452) [-1063.240] (-1063.264) (-1064.383) * (-1066.117) (-1063.311) (-1064.114) [-1065.782] -- 0:00:57
Average standard deviation of split frequencies: 0.039454
65500 -- (-1062.344) (-1062.680) (-1063.646) [-1064.193] * [-1066.879] (-1064.123) (-1066.368) (-1065.597) -- 0:00:57
66000 -- (-1066.928) (-1061.260) (-1063.130) [-1064.492] * [-1065.452] (-1063.063) (-1065.061) (-1066.404) -- 0:00:56
66500 -- (-1067.579) [-1064.840] (-1064.986) (-1068.352) * (-1065.303) [-1065.276] (-1064.684) (-1062.189) -- 0:01:10
67000 -- [-1066.715] (-1063.869) (-1068.509) (-1064.518) * (-1067.599) (-1065.848) (-1063.477) [-1062.964] -- 0:01:09
67500 -- [-1063.072] (-1067.383) (-1065.377) (-1068.472) * (-1065.890) (-1067.725) [-1064.124] (-1065.299) -- 0:01:09
68000 -- (-1064.813) (-1066.301) (-1065.124) [-1064.898] * (-1063.946) [-1067.801] (-1064.936) (-1063.902) -- 0:01:08
68500 -- (-1062.212) (-1064.830) [-1061.720] (-1064.418) * [-1064.058] (-1064.322) (-1067.987) (-1070.629) -- 0:01:07
69000 -- (-1063.686) [-1064.513] (-1064.732) (-1064.442) * (-1062.770) [-1062.450] (-1066.929) (-1063.542) -- 0:01:07
69500 -- (-1062.374) (-1063.493) [-1063.610] (-1061.904) * (-1064.919) [-1061.706] (-1065.998) (-1065.689) -- 0:01:06
70000 -- (-1065.919) (-1064.399) [-1062.039] (-1064.683) * (-1063.336) [-1061.349] (-1068.946) (-1063.360) -- 0:01:06
Average standard deviation of split frequencies: 0.033672
70500 -- (-1065.607) (-1065.979) [-1064.347] (-1063.186) * (-1064.608) (-1062.823) [-1064.398] (-1064.259) -- 0:01:05
71000 -- (-1066.332) (-1068.333) (-1064.021) [-1063.443] * (-1066.030) (-1061.372) [-1068.549] (-1067.099) -- 0:01:05
71500 -- (-1066.804) [-1066.289] (-1064.861) (-1063.060) * [-1065.052] (-1065.746) (-1068.235) (-1067.140) -- 0:01:04
72000 -- [-1068.195] (-1064.145) (-1064.380) (-1062.019) * (-1063.173) (-1061.225) [-1064.788] (-1066.118) -- 0:01:04
72500 -- (-1066.159) (-1063.503) (-1065.051) [-1063.471] * [-1063.202] (-1060.902) (-1065.040) (-1064.545) -- 0:01:03
73000 -- [-1064.329] (-1065.046) (-1063.961) (-1061.749) * (-1062.603) (-1063.048) (-1067.617) [-1062.400] -- 0:01:03
73500 -- [-1062.846] (-1066.115) (-1066.371) (-1064.021) * (-1066.386) (-1065.776) (-1064.861) [-1064.294] -- 0:01:03
74000 -- (-1063.855) (-1065.167) [-1063.426] (-1061.883) * [-1062.654] (-1063.460) (-1064.720) (-1066.712) -- 0:01:02
74500 -- (-1062.243) (-1064.422) (-1063.350) [-1064.571] * (-1064.118) [-1062.370] (-1066.487) (-1063.938) -- 0:01:02
75000 -- [-1065.098] (-1068.627) (-1064.538) (-1062.408) * (-1063.266) (-1064.617) (-1065.904) [-1061.483] -- 0:01:01
Average standard deviation of split frequencies: 0.030393
75500 -- (-1066.077) (-1068.913) (-1063.693) [-1067.109] * (-1063.729) (-1065.520) [-1066.235] (-1062.563) -- 0:01:01
76000 -- (-1066.346) [-1065.724] (-1062.552) (-1063.993) * [-1064.798] (-1073.720) (-1066.267) (-1064.734) -- 0:01:00
76500 -- (-1065.946) (-1065.308) (-1067.653) [-1063.638] * (-1063.570) (-1064.208) (-1064.750) [-1062.230] -- 0:01:00
77000 -- (-1064.538) [-1063.630] (-1064.562) (-1065.619) * (-1064.799) [-1064.521] (-1064.419) (-1063.268) -- 0:00:59
77500 -- (-1067.522) (-1064.778) [-1065.332] (-1063.757) * (-1065.266) (-1065.099) (-1065.708) [-1067.327] -- 0:00:59
78000 -- [-1062.373] (-1064.534) (-1062.093) (-1064.694) * [-1062.839] (-1064.811) (-1067.819) (-1063.634) -- 0:00:59
78500 -- [-1065.319] (-1065.065) (-1063.962) (-1060.827) * (-1064.826) (-1064.367) (-1064.571) [-1062.801] -- 0:00:58
79000 -- [-1064.635] (-1060.961) (-1063.049) (-1064.753) * (-1063.430) (-1063.356) (-1064.195) [-1063.297] -- 0:00:58
79500 -- [-1064.737] (-1065.126) (-1066.382) (-1064.287) * (-1064.294) (-1066.084) [-1064.376] (-1062.645) -- 0:00:57
80000 -- (-1063.826) [-1063.264] (-1063.855) (-1066.807) * (-1064.033) [-1062.395] (-1064.819) (-1064.139) -- 0:00:57
Average standard deviation of split frequencies: 0.030757
80500 -- [-1064.291] (-1063.418) (-1066.173) (-1065.932) * (-1062.723) (-1065.325) [-1062.583] (-1065.542) -- 0:01:08
81000 -- (-1063.198) [-1062.847] (-1064.850) (-1062.908) * [-1061.339] (-1063.682) (-1063.670) (-1066.192) -- 0:01:08
81500 -- [-1065.016] (-1066.851) (-1066.577) (-1064.095) * (-1064.415) (-1064.928) [-1061.848] (-1063.371) -- 0:01:07
82000 -- (-1067.095) [-1061.693] (-1066.127) (-1064.367) * (-1064.148) (-1064.589) (-1062.835) [-1063.783] -- 0:01:07
82500 -- (-1066.327) [-1061.989] (-1072.435) (-1065.469) * (-1065.658) (-1064.287) (-1065.714) [-1062.608] -- 0:01:06
83000 -- (-1064.050) (-1063.161) (-1068.809) [-1069.320] * (-1062.989) (-1063.435) (-1065.068) [-1064.843] -- 0:01:06
83500 -- (-1063.663) [-1063.107] (-1069.846) (-1065.294) * (-1063.945) (-1063.925) [-1064.779] (-1063.033) -- 0:01:05
84000 -- [-1064.122] (-1064.385) (-1065.435) (-1068.220) * [-1061.879] (-1068.940) (-1063.791) (-1062.313) -- 0:01:05
84500 -- (-1065.457) (-1065.021) [-1068.729] (-1066.009) * [-1063.697] (-1069.400) (-1062.640) (-1067.303) -- 0:01:05
85000 -- (-1065.237) (-1064.791) (-1062.902) [-1060.957] * (-1065.938) (-1065.939) (-1063.052) [-1063.252] -- 0:01:04
Average standard deviation of split frequencies: 0.027696
85500 -- (-1068.193) (-1061.504) [-1064.022] (-1062.955) * (-1066.577) [-1063.981] (-1064.265) (-1063.253) -- 0:01:04
86000 -- (-1066.390) [-1062.719] (-1062.868) (-1064.771) * (-1063.395) (-1067.741) [-1062.648] (-1062.503) -- 0:01:03
86500 -- (-1065.507) (-1066.322) (-1064.857) [-1065.409] * (-1064.437) (-1065.513) [-1064.410] (-1064.985) -- 0:01:03
87000 -- (-1064.745) [-1065.523] (-1064.044) (-1066.833) * [-1062.793] (-1066.110) (-1069.401) (-1064.699) -- 0:01:02
87500 -- [-1063.523] (-1067.727) (-1065.420) (-1061.633) * [-1064.171] (-1063.997) (-1064.649) (-1063.379) -- 0:01:02
88000 -- (-1067.409) [-1064.916] (-1065.350) (-1066.728) * (-1063.951) [-1064.229] (-1062.161) (-1063.502) -- 0:01:02
88500 -- [-1064.658] (-1063.942) (-1062.108) (-1066.239) * (-1064.953) (-1063.761) (-1066.861) [-1064.129] -- 0:01:01
89000 -- (-1063.713) [-1065.818] (-1062.584) (-1064.151) * (-1068.047) [-1063.830] (-1061.353) (-1063.253) -- 0:01:01
89500 -- [-1063.744] (-1065.349) (-1062.981) (-1064.703) * [-1062.799] (-1062.031) (-1068.575) (-1066.152) -- 0:01:01
90000 -- (-1065.602) (-1063.863) (-1066.494) [-1062.289] * (-1062.991) [-1067.703] (-1062.626) (-1067.819) -- 0:01:00
Average standard deviation of split frequencies: 0.025419
90500 -- (-1074.389) (-1065.180) [-1063.560] (-1062.615) * [-1063.411] (-1064.636) (-1062.937) (-1064.668) -- 0:01:00
91000 -- (-1062.930) (-1064.868) [-1062.745] (-1062.108) * (-1063.124) (-1061.851) (-1063.023) [-1061.567] -- 0:00:59
91500 -- (-1063.691) (-1065.208) [-1064.047] (-1063.263) * (-1067.942) (-1063.715) (-1065.842) [-1064.496] -- 0:00:59
92000 -- [-1063.084] (-1065.109) (-1062.411) (-1064.158) * (-1065.209) (-1062.848) [-1067.514] (-1066.128) -- 0:00:59
92500 -- [-1062.793] (-1067.586) (-1067.040) (-1065.026) * [-1063.356] (-1065.259) (-1066.415) (-1068.393) -- 0:00:58
93000 -- [-1063.629] (-1066.067) (-1064.497) (-1062.539) * [-1061.884] (-1063.800) (-1065.952) (-1063.261) -- 0:00:58
93500 -- (-1063.653) (-1064.039) (-1066.958) [-1063.356] * [-1062.540] (-1062.627) (-1063.301) (-1066.547) -- 0:00:58
94000 -- (-1063.232) (-1065.865) [-1064.693] (-1060.137) * (-1063.223) [-1062.438] (-1062.798) (-1065.792) -- 0:00:57
94500 -- (-1065.690) [-1065.088] (-1064.833) (-1062.652) * (-1065.358) (-1063.479) [-1063.666] (-1064.808) -- 0:01:07
95000 -- (-1064.395) (-1064.312) (-1064.802) [-1063.170] * (-1064.435) (-1069.213) (-1066.408) [-1065.243] -- 0:01:06
Average standard deviation of split frequencies: 0.027280
95500 -- (-1067.132) [-1063.364] (-1065.873) (-1064.472) * (-1062.917) (-1070.604) (-1067.793) [-1065.497] -- 0:01:06
96000 -- (-1065.306) [-1064.176] (-1065.990) (-1065.148) * (-1064.114) (-1063.595) (-1065.287) [-1063.479] -- 0:01:05
96500 -- (-1068.155) (-1070.966) [-1063.649] (-1062.340) * (-1063.505) (-1065.753) [-1062.345] (-1064.903) -- 0:01:05
97000 -- (-1064.224) (-1071.172) [-1063.433] (-1064.710) * (-1062.876) (-1063.937) [-1067.366] (-1065.523) -- 0:01:05
97500 -- (-1064.625) [-1068.078] (-1062.094) (-1067.056) * [-1065.553] (-1064.208) (-1066.732) (-1065.460) -- 0:01:04
98000 -- (-1065.043) [-1063.377] (-1061.603) (-1065.188) * (-1064.247) (-1064.103) (-1063.292) [-1064.676] -- 0:01:04
98500 -- (-1066.017) (-1064.913) (-1063.300) [-1061.258] * (-1061.786) (-1067.765) [-1063.919] (-1065.233) -- 0:01:04
99000 -- (-1063.340) (-1066.898) (-1061.798) [-1063.835] * [-1066.572] (-1066.052) (-1065.379) (-1066.322) -- 0:01:03
99500 -- (-1062.514) (-1066.516) [-1063.450] (-1063.861) * (-1062.862) (-1064.627) (-1068.351) [-1064.797] -- 0:01:03
100000 -- [-1061.735] (-1066.860) (-1062.776) (-1065.985) * (-1069.913) (-1065.129) (-1069.443) [-1064.143] -- 0:01:02
Average standard deviation of split frequencies: 0.023674
100500 -- (-1062.828) (-1064.100) [-1065.336] (-1064.893) * (-1064.322) [-1063.403] (-1064.447) (-1064.356) -- 0:01:02
101000 -- [-1062.491] (-1065.778) (-1063.509) (-1066.132) * (-1063.507) (-1063.347) [-1065.410] (-1064.935) -- 0:01:02
101500 -- (-1063.031) (-1065.461) (-1065.602) [-1063.501] * [-1062.510] (-1063.362) (-1067.196) (-1063.181) -- 0:01:01
102000 -- (-1066.729) (-1067.963) [-1063.294] (-1062.502) * [-1063.892] (-1062.578) (-1064.445) (-1065.215) -- 0:01:01
102500 -- (-1063.656) [-1066.359] (-1063.336) (-1062.634) * (-1064.556) (-1063.913) (-1066.626) [-1064.941] -- 0:01:01
103000 -- [-1062.932] (-1066.195) (-1062.997) (-1063.232) * (-1063.944) (-1064.212) [-1064.040] (-1064.471) -- 0:01:00
103500 -- (-1063.646) (-1067.242) (-1062.302) [-1065.066] * (-1065.089) (-1064.112) (-1066.942) [-1064.312] -- 0:01:00
104000 -- (-1066.648) (-1066.677) (-1062.280) [-1061.950] * [-1062.033] (-1064.893) (-1065.482) (-1062.131) -- 0:01:00
104500 -- [-1070.220] (-1065.943) (-1064.117) (-1064.407) * (-1061.310) (-1065.060) (-1066.216) [-1067.426] -- 0:00:59
105000 -- (-1065.071) [-1065.962] (-1070.584) (-1060.644) * (-1063.578) [-1064.975] (-1065.169) (-1065.215) -- 0:00:59
Average standard deviation of split frequencies: 0.022483
105500 -- (-1063.454) (-1066.018) (-1065.794) [-1062.450] * [-1060.615] (-1061.277) (-1064.194) (-1066.434) -- 0:00:59
106000 -- (-1064.896) (-1065.589) (-1063.484) [-1062.943] * [-1062.369] (-1063.688) (-1065.806) (-1068.597) -- 0:00:59
106500 -- [-1065.724] (-1063.374) (-1064.444) (-1064.527) * [-1063.308] (-1064.641) (-1066.650) (-1063.750) -- 0:00:58
107000 -- [-1064.609] (-1062.245) (-1064.442) (-1062.780) * (-1064.210) (-1062.689) (-1064.959) [-1065.065] -- 0:00:58
107500 -- (-1065.346) (-1064.816) (-1064.616) [-1062.448] * [-1063.907] (-1064.969) (-1064.792) (-1063.595) -- 0:00:58
108000 -- (-1062.765) (-1066.081) (-1065.113) [-1064.998] * (-1063.150) (-1062.343) (-1065.377) [-1064.804] -- 0:00:57
108500 -- [-1063.887] (-1066.322) (-1066.635) (-1065.641) * (-1061.032) [-1061.280] (-1065.246) (-1063.729) -- 0:00:57
109000 -- (-1065.969) (-1069.266) (-1069.543) [-1065.534] * [-1063.437] (-1064.976) (-1069.993) (-1068.578) -- 0:00:57
109500 -- [-1065.339] (-1065.914) (-1066.692) (-1068.653) * (-1065.815) (-1064.063) (-1066.241) [-1062.842] -- 0:00:56
110000 -- (-1067.362) [-1064.657] (-1061.657) (-1062.162) * (-1065.326) (-1063.411) (-1065.244) [-1060.775] -- 0:01:04
Average standard deviation of split frequencies: 0.021074
110500 -- (-1067.616) [-1064.039] (-1062.517) (-1067.251) * (-1069.826) (-1066.821) [-1063.767] (-1066.166) -- 0:01:04
111000 -- (-1065.094) (-1065.807) [-1067.460] (-1064.267) * [-1064.558] (-1063.138) (-1064.674) (-1064.748) -- 0:01:04
111500 -- [-1063.902] (-1065.462) (-1062.404) (-1068.436) * [-1065.957] (-1064.482) (-1063.951) (-1065.890) -- 0:01:03
112000 -- (-1066.314) [-1065.089] (-1064.045) (-1063.847) * (-1065.271) (-1063.157) [-1063.633] (-1066.762) -- 0:01:03
112500 -- (-1066.504) (-1064.359) (-1064.870) [-1065.205] * (-1070.545) (-1065.519) (-1065.403) [-1062.958] -- 0:01:03
113000 -- (-1063.332) [-1066.560] (-1063.477) (-1063.992) * (-1071.464) [-1063.135] (-1075.917) (-1062.549) -- 0:01:02
113500 -- [-1064.282] (-1061.944) (-1062.243) (-1064.825) * (-1071.437) (-1063.647) [-1067.445] (-1063.885) -- 0:01:02
114000 -- (-1066.437) [-1064.252] (-1065.275) (-1064.347) * (-1063.392) [-1062.507] (-1064.736) (-1066.251) -- 0:01:02
114500 -- [-1065.476] (-1061.321) (-1065.651) (-1064.485) * (-1064.756) [-1063.900] (-1067.798) (-1061.628) -- 0:01:01
115000 -- (-1062.653) (-1062.350) (-1063.448) [-1066.718] * (-1063.470) (-1064.184) (-1064.678) [-1064.272] -- 0:01:01
Average standard deviation of split frequencies: 0.019891
115500 -- (-1063.969) (-1064.000) [-1066.390] (-1064.885) * (-1063.650) (-1068.662) [-1062.941] (-1066.342) -- 0:01:01
116000 -- (-1062.973) [-1062.195] (-1068.710) (-1066.984) * (-1062.895) (-1064.297) (-1064.396) [-1065.773] -- 0:01:00
116500 -- [-1064.952] (-1063.600) (-1066.617) (-1065.925) * (-1063.579) [-1063.120] (-1064.198) (-1067.596) -- 0:01:00
117000 -- [-1065.609] (-1062.226) (-1064.355) (-1064.388) * (-1062.348) [-1062.321] (-1065.203) (-1066.381) -- 0:01:00
117500 -- (-1064.547) (-1064.973) (-1064.714) [-1067.400] * (-1063.408) [-1063.953] (-1061.900) (-1064.265) -- 0:01:00
118000 -- [-1063.906] (-1063.214) (-1062.114) (-1068.923) * (-1065.555) (-1065.295) (-1063.804) [-1068.016] -- 0:00:59
118500 -- (-1064.497) (-1061.140) (-1065.924) [-1064.570] * (-1064.796) [-1062.656] (-1070.171) (-1064.339) -- 0:00:59
119000 -- (-1068.510) (-1061.258) [-1062.647] (-1064.821) * (-1064.124) [-1063.571] (-1065.131) (-1063.135) -- 0:00:59
119500 -- (-1066.295) (-1062.373) [-1065.832] (-1066.328) * [-1065.378] (-1066.535) (-1064.974) (-1062.293) -- 0:00:58
120000 -- (-1064.654) (-1062.460) (-1063.893) [-1066.134] * (-1065.276) (-1065.513) (-1066.215) [-1063.586] -- 0:00:58
Average standard deviation of split frequencies: 0.019750
120500 -- (-1065.353) [-1061.950] (-1062.938) (-1063.153) * (-1067.269) (-1063.735) (-1064.043) [-1066.687] -- 0:00:58
121000 -- [-1062.838] (-1062.069) (-1063.084) (-1063.366) * (-1064.608) [-1064.826] (-1066.529) (-1065.278) -- 0:00:58
121500 -- (-1064.967) [-1062.134] (-1067.891) (-1064.054) * [-1063.639] (-1065.477) (-1065.519) (-1065.869) -- 0:00:57
122000 -- (-1065.723) (-1065.144) [-1062.826] (-1063.798) * (-1062.188) [-1061.987] (-1064.626) (-1070.468) -- 0:00:57
122500 -- (-1065.667) (-1066.205) (-1068.062) [-1065.505] * [-1063.583] (-1065.118) (-1065.794) (-1066.594) -- 0:00:57
123000 -- [-1066.055] (-1065.021) (-1065.196) (-1063.973) * (-1064.483) (-1063.194) (-1064.199) [-1060.378] -- 0:00:57
123500 -- [-1066.593] (-1064.012) (-1064.636) (-1063.072) * (-1065.362) (-1064.251) [-1063.231] (-1066.893) -- 0:00:56
124000 -- (-1064.809) [-1063.852] (-1064.961) (-1067.196) * [-1064.010] (-1063.368) (-1065.698) (-1070.840) -- 0:00:56
124500 -- (-1065.615) [-1066.169] (-1064.836) (-1065.762) * (-1062.477) (-1062.914) (-1065.344) [-1063.093] -- 0:00:56
125000 -- [-1063.476] (-1068.871) (-1065.266) (-1065.288) * (-1069.825) (-1063.754) [-1065.673] (-1062.514) -- 0:01:03
Average standard deviation of split frequencies: 0.018083
125500 -- (-1063.254) [-1064.113] (-1067.009) (-1065.453) * [-1065.349] (-1066.597) (-1064.033) (-1062.062) -- 0:01:02
126000 -- [-1064.261] (-1064.342) (-1062.532) (-1063.715) * (-1065.590) [-1062.283] (-1065.886) (-1063.274) -- 0:01:02
126500 -- (-1065.025) (-1068.366) [-1063.649] (-1063.493) * (-1067.572) (-1066.613) (-1071.059) [-1062.219] -- 0:01:02
127000 -- [-1063.740] (-1065.095) (-1067.757) (-1066.384) * (-1064.630) (-1064.466) (-1063.996) [-1065.724] -- 0:01:01
127500 -- (-1067.725) (-1066.083) (-1067.059) [-1066.241] * (-1069.975) (-1064.610) (-1063.575) [-1062.405] -- 0:01:01
128000 -- (-1066.987) (-1066.780) [-1065.640] (-1068.304) * (-1065.308) (-1063.392) [-1062.878] (-1063.815) -- 0:01:01
128500 -- (-1069.847) (-1065.541) [-1065.231] (-1062.481) * (-1061.189) (-1065.334) (-1066.367) [-1063.021] -- 0:01:01
129000 -- (-1067.253) [-1067.131] (-1066.430) (-1061.645) * [-1061.080] (-1063.035) (-1065.790) (-1063.764) -- 0:01:00
129500 -- (-1066.027) [-1065.153] (-1064.621) (-1066.210) * (-1064.665) (-1063.772) (-1067.883) [-1062.100] -- 0:01:00
130000 -- (-1068.190) (-1065.374) [-1064.644] (-1062.517) * (-1063.012) (-1063.204) (-1064.245) [-1062.632] -- 0:01:00
Average standard deviation of split frequencies: 0.018760
130500 -- (-1065.039) (-1065.947) (-1066.583) [-1065.846] * (-1070.528) (-1067.014) [-1064.679] (-1063.100) -- 0:00:59
131000 -- (-1069.214) (-1063.555) [-1061.589] (-1064.707) * (-1068.363) [-1063.955] (-1063.538) (-1065.051) -- 0:00:59
131500 -- (-1065.085) [-1064.670] (-1062.405) (-1066.711) * (-1064.711) (-1065.918) (-1063.959) [-1064.204] -- 0:00:59
132000 -- [-1064.780] (-1065.778) (-1064.448) (-1066.136) * (-1063.797) [-1066.628] (-1063.415) (-1064.675) -- 0:00:59
132500 -- (-1067.653) [-1061.834] (-1065.791) (-1063.405) * (-1065.082) (-1066.799) (-1066.182) [-1063.041] -- 0:00:58
133000 -- (-1068.133) [-1063.105] (-1066.650) (-1061.335) * (-1063.596) (-1065.718) [-1066.163] (-1063.327) -- 0:00:58
133500 -- [-1066.181] (-1064.336) (-1064.193) (-1065.456) * (-1065.168) (-1064.231) [-1063.809] (-1064.757) -- 0:00:58
134000 -- (-1064.900) (-1063.254) [-1063.319] (-1063.343) * (-1063.070) (-1062.416) (-1065.682) [-1060.256] -- 0:00:58
134500 -- (-1063.399) [-1064.065] (-1064.521) (-1065.546) * (-1067.072) (-1063.308) [-1065.404] (-1062.405) -- 0:00:57
135000 -- (-1070.404) (-1065.449) [-1063.340] (-1065.168) * (-1064.193) (-1061.262) (-1067.847) [-1064.116] -- 0:00:57
Average standard deviation of split frequencies: 0.016368
135500 -- (-1063.842) [-1063.171] (-1063.603) (-1065.310) * (-1066.980) (-1065.154) [-1063.247] (-1066.671) -- 0:00:57
136000 -- [-1062.637] (-1065.759) (-1071.536) (-1065.129) * (-1066.640) [-1065.836] (-1064.442) (-1065.915) -- 0:00:57
136500 -- (-1064.578) [-1064.074] (-1063.990) (-1065.110) * (-1064.705) (-1063.875) (-1064.196) [-1064.361] -- 0:00:56
137000 -- (-1066.288) (-1070.423) (-1064.169) [-1062.207] * (-1065.148) (-1065.511) [-1065.526] (-1065.203) -- 0:00:56
137500 -- [-1066.003] (-1070.491) (-1062.799) (-1065.265) * (-1062.626) (-1066.137) (-1064.477) [-1062.810] -- 0:00:56
138000 -- (-1066.040) (-1065.083) [-1063.234] (-1062.138) * (-1063.819) (-1064.814) (-1065.802) [-1062.947] -- 0:00:56
138500 -- (-1062.672) (-1063.156) [-1063.814] (-1063.775) * [-1062.292] (-1064.627) (-1063.440) (-1065.787) -- 0:00:55
139000 -- (-1062.908) [-1061.420] (-1063.747) (-1066.167) * [-1064.251] (-1065.628) (-1066.126) (-1064.980) -- 0:00:55
139500 -- [-1064.351] (-1064.057) (-1063.204) (-1063.230) * (-1064.337) [-1063.294] (-1066.261) (-1068.762) -- 0:00:55
140000 -- (-1065.429) (-1061.728) [-1061.982] (-1068.720) * (-1063.168) (-1062.606) (-1067.032) [-1064.681] -- 0:00:55
Average standard deviation of split frequencies: 0.017991
140500 -- (-1064.230) (-1065.001) (-1065.361) [-1062.701] * [-1063.071] (-1062.402) (-1064.048) (-1062.701) -- 0:01:01
141000 -- (-1063.389) [-1062.051] (-1062.671) (-1066.407) * (-1062.130) (-1061.210) [-1063.915] (-1062.703) -- 0:01:00
141500 -- (-1063.356) (-1064.237) (-1062.882) [-1065.605] * [-1061.881] (-1062.939) (-1065.773) (-1068.821) -- 0:01:00
142000 -- (-1065.290) (-1066.287) [-1062.720] (-1063.191) * (-1063.522) (-1063.037) [-1063.526] (-1066.213) -- 0:01:00
142500 -- [-1064.976] (-1064.993) (-1062.540) (-1064.813) * (-1063.885) (-1063.157) [-1062.237] (-1064.758) -- 0:01:00
143000 -- (-1068.479) (-1062.716) (-1062.337) [-1060.927] * (-1066.585) (-1061.867) (-1063.041) [-1062.523] -- 0:00:59
143500 -- (-1064.781) [-1062.479] (-1063.300) (-1065.165) * (-1063.951) [-1064.593] (-1064.166) (-1064.842) -- 0:00:59
144000 -- (-1063.188) (-1064.471) (-1064.268) [-1060.737] * [-1062.061] (-1062.848) (-1063.928) (-1064.313) -- 0:00:59
144500 -- (-1065.506) [-1062.430] (-1064.186) (-1063.550) * [-1064.950] (-1064.103) (-1066.691) (-1065.192) -- 0:00:59
145000 -- (-1064.114) [-1062.557] (-1071.334) (-1064.453) * (-1064.715) (-1062.388) (-1064.823) [-1064.834] -- 0:00:58
Average standard deviation of split frequencies: 0.018404
145500 -- (-1063.821) [-1063.596] (-1065.702) (-1061.780) * (-1067.110) (-1062.418) (-1065.132) [-1066.918] -- 0:00:58
146000 -- [-1062.189] (-1065.591) (-1063.701) (-1063.587) * (-1063.714) (-1060.196) (-1063.051) [-1063.766] -- 0:00:58
146500 -- (-1064.262) (-1066.484) (-1062.398) [-1064.794] * [-1061.010] (-1063.285) (-1066.370) (-1067.672) -- 0:00:58
147000 -- (-1065.314) (-1062.224) (-1065.371) [-1061.904] * (-1064.516) (-1064.872) (-1071.036) [-1065.124] -- 0:00:58
147500 -- (-1065.774) [-1065.027] (-1061.666) (-1062.977) * (-1065.042) [-1065.165] (-1068.776) (-1063.293) -- 0:00:57
148000 -- [-1063.832] (-1064.459) (-1062.405) (-1064.897) * (-1065.723) [-1065.940] (-1064.531) (-1061.630) -- 0:00:57
148500 -- (-1065.107) [-1064.535] (-1062.799) (-1062.911) * [-1063.015] (-1064.245) (-1065.102) (-1063.798) -- 0:00:57
149000 -- (-1067.901) (-1066.585) [-1062.636] (-1062.221) * (-1061.968) (-1062.118) (-1063.662) [-1064.179] -- 0:00:57
149500 -- (-1063.672) (-1066.913) [-1062.592] (-1065.132) * (-1061.256) (-1064.735) (-1066.023) [-1067.501] -- 0:00:56
150000 -- [-1065.444] (-1064.375) (-1063.766) (-1064.945) * [-1063.519] (-1065.357) (-1064.654) (-1064.040) -- 0:00:56
Average standard deviation of split frequencies: 0.017291
150500 -- [-1065.407] (-1063.941) (-1067.526) (-1064.195) * (-1064.466) (-1067.928) [-1064.499] (-1064.011) -- 0:00:56
151000 -- (-1065.984) (-1064.208) [-1064.857] (-1068.456) * (-1070.702) (-1065.208) (-1067.817) [-1064.053] -- 0:00:56
151500 -- [-1065.393] (-1064.933) (-1064.687) (-1066.374) * (-1064.832) (-1064.940) (-1068.733) [-1062.426] -- 0:00:56
152000 -- [-1066.053] (-1064.628) (-1064.572) (-1064.525) * [-1066.354] (-1064.260) (-1067.918) (-1064.144) -- 0:00:55
152500 -- (-1064.712) [-1065.869] (-1066.101) (-1065.827) * (-1071.015) (-1063.357) (-1069.089) [-1064.436] -- 0:00:55
153000 -- (-1062.796) (-1065.907) (-1066.332) [-1060.860] * (-1070.624) (-1063.662) (-1064.582) [-1066.792] -- 0:00:55
153500 -- (-1066.755) (-1065.633) (-1062.749) [-1062.780] * (-1069.609) [-1062.877] (-1065.267) (-1065.240) -- 0:00:55
154000 -- (-1065.535) (-1066.560) [-1065.249] (-1064.116) * (-1066.306) (-1063.489) [-1064.181] (-1067.948) -- 0:00:54
154500 -- (-1063.344) (-1065.024) (-1067.056) [-1063.379] * [-1062.627] (-1061.891) (-1063.476) (-1069.483) -- 0:00:54
155000 -- (-1061.827) [-1062.948] (-1065.124) (-1062.785) * (-1062.155) (-1063.466) (-1065.285) [-1063.561] -- 0:00:54
Average standard deviation of split frequencies: 0.016381
155500 -- (-1064.335) (-1064.309) (-1065.690) [-1060.801] * (-1061.544) (-1064.035) (-1066.870) [-1064.803] -- 0:00:59
156000 -- (-1063.574) [-1065.357] (-1065.337) (-1062.246) * (-1064.553) (-1062.683) [-1066.491] (-1065.955) -- 0:00:59
156500 -- [-1064.771] (-1065.178) (-1064.991) (-1065.007) * (-1067.549) [-1062.405] (-1064.863) (-1070.649) -- 0:00:59
157000 -- (-1065.084) [-1064.485] (-1064.991) (-1063.316) * [-1063.660] (-1064.053) (-1065.678) (-1062.900) -- 0:00:59
157500 -- (-1061.633) [-1063.752] (-1064.978) (-1065.647) * (-1063.666) (-1064.432) (-1066.315) [-1064.281] -- 0:00:58
158000 -- (-1064.141) (-1066.424) [-1068.036] (-1063.280) * (-1062.990) (-1064.777) (-1066.097) [-1061.683] -- 0:00:58
158500 -- (-1066.109) (-1065.358) (-1066.164) [-1064.478] * (-1066.302) [-1067.172] (-1066.821) (-1061.997) -- 0:00:58
159000 -- (-1065.118) (-1065.576) (-1065.432) [-1065.883] * [-1064.095] (-1065.655) (-1067.304) (-1062.795) -- 0:00:58
159500 -- (-1070.324) (-1064.096) [-1063.872] (-1068.986) * (-1067.711) (-1066.258) [-1066.065] (-1061.289) -- 0:00:57
160000 -- (-1069.704) [-1065.002] (-1063.045) (-1066.168) * [-1066.262] (-1064.985) (-1062.563) (-1065.801) -- 0:00:57
Average standard deviation of split frequencies: 0.017141
160500 -- (-1063.886) (-1063.964) (-1066.770) [-1065.138] * [-1064.937] (-1062.873) (-1065.464) (-1064.953) -- 0:00:57
161000 -- (-1062.695) (-1064.735) [-1066.288] (-1066.379) * (-1065.136) [-1064.408] (-1066.206) (-1063.403) -- 0:00:57
161500 -- (-1066.138) [-1064.014] (-1072.267) (-1061.253) * (-1066.291) (-1064.849) [-1064.999] (-1067.744) -- 0:00:57
162000 -- [-1064.985] (-1066.510) (-1064.002) (-1064.750) * (-1064.515) (-1068.089) [-1064.655] (-1068.251) -- 0:00:56
162500 -- (-1064.166) [-1063.951] (-1065.549) (-1061.760) * [-1064.689] (-1067.280) (-1062.574) (-1066.892) -- 0:00:56
163000 -- (-1064.043) (-1065.055) (-1065.489) [-1063.380] * (-1062.996) (-1062.977) (-1068.688) [-1069.638] -- 0:00:56
163500 -- (-1063.482) (-1062.557) (-1065.039) [-1065.565] * (-1064.524) [-1064.373] (-1065.649) (-1067.444) -- 0:00:56
164000 -- (-1065.659) (-1064.155) [-1065.735] (-1065.217) * (-1065.320) [-1062.545] (-1066.797) (-1069.331) -- 0:00:56
164500 -- (-1066.408) (-1065.167) [-1064.722] (-1066.597) * (-1064.139) (-1063.459) (-1064.294) [-1067.157] -- 0:00:55
165000 -- [-1066.514] (-1064.769) (-1064.371) (-1069.312) * (-1063.974) (-1064.212) [-1064.996] (-1063.635) -- 0:00:55
Average standard deviation of split frequencies: 0.017487
165500 -- [-1065.223] (-1065.104) (-1065.730) (-1063.271) * (-1064.604) (-1063.466) [-1064.960] (-1063.783) -- 0:00:55
166000 -- (-1069.600) (-1065.441) (-1064.506) [-1064.044] * (-1064.829) [-1063.939] (-1064.214) (-1066.596) -- 0:00:55
166500 -- (-1067.499) [-1062.328] (-1064.078) (-1065.468) * [-1066.255] (-1064.480) (-1067.471) (-1064.655) -- 0:00:55
167000 -- [-1064.622] (-1063.695) (-1064.093) (-1064.583) * (-1066.393) (-1065.438) (-1064.677) [-1063.511] -- 0:00:54
167500 -- (-1064.027) [-1062.858] (-1069.712) (-1064.155) * (-1068.422) (-1064.858) (-1064.780) [-1065.820] -- 0:00:54
168000 -- (-1067.147) (-1062.600) (-1065.124) [-1063.872] * (-1071.394) (-1065.925) [-1064.593] (-1065.800) -- 0:00:54
168500 -- (-1067.670) (-1062.558) [-1064.682] (-1065.129) * (-1063.722) (-1066.554) (-1065.728) [-1063.489] -- 0:00:54
169000 -- (-1065.126) (-1064.910) (-1068.116) [-1063.543] * (-1067.473) [-1066.061] (-1067.968) (-1070.949) -- 0:00:54
169500 -- [-1064.651] (-1064.432) (-1065.559) (-1064.986) * (-1067.629) (-1067.923) (-1066.393) [-1066.879] -- 0:00:53
170000 -- [-1067.079] (-1063.018) (-1065.364) (-1065.774) * (-1067.704) [-1064.295] (-1070.496) (-1062.470) -- 0:00:53
Average standard deviation of split frequencies: 0.016718
170500 -- (-1063.612) (-1063.508) [-1063.371] (-1065.099) * (-1067.035) [-1063.101] (-1065.897) (-1066.208) -- 0:00:58
171000 -- (-1065.798) (-1064.823) [-1062.893] (-1063.292) * (-1066.356) (-1064.320) [-1066.125] (-1064.060) -- 0:00:58
171500 -- [-1065.261] (-1066.911) (-1066.614) (-1064.121) * (-1065.153) (-1062.471) [-1064.875] (-1063.765) -- 0:00:57
172000 -- [-1066.050] (-1068.117) (-1065.459) (-1064.045) * [-1064.292] (-1066.295) (-1065.221) (-1065.904) -- 0:00:57
172500 -- (-1064.283) [-1066.619] (-1068.555) (-1064.580) * (-1064.419) (-1065.366) [-1068.306] (-1064.308) -- 0:00:57
173000 -- (-1066.953) [-1065.015] (-1064.736) (-1065.238) * (-1062.942) (-1064.083) [-1064.862] (-1067.114) -- 0:00:57
173500 -- (-1067.006) (-1062.913) [-1064.325] (-1062.606) * (-1065.801) (-1066.686) [-1065.317] (-1067.170) -- 0:00:57
174000 -- (-1068.674) [-1066.452] (-1062.948) (-1063.883) * (-1062.236) (-1068.397) (-1063.113) [-1065.699] -- 0:00:56
174500 -- (-1064.363) [-1064.869] (-1062.869) (-1065.485) * (-1066.634) (-1066.467) (-1063.537) [-1064.987] -- 0:00:56
175000 -- (-1064.725) [-1063.606] (-1064.561) (-1067.260) * [-1063.798] (-1064.227) (-1064.426) (-1069.137) -- 0:00:56
Average standard deviation of split frequencies: 0.015803
175500 -- (-1064.572) [-1067.977] (-1064.268) (-1066.000) * (-1067.301) (-1069.359) (-1065.239) [-1067.613] -- 0:00:56
176000 -- (-1065.405) (-1065.946) [-1063.443] (-1070.783) * (-1064.603) (-1065.122) (-1064.863) [-1065.052] -- 0:00:56
176500 -- (-1064.867) [-1066.039] (-1062.683) (-1068.267) * (-1067.675) (-1064.916) [-1065.118] (-1063.853) -- 0:00:55
177000 -- (-1068.284) (-1067.616) (-1063.959) [-1063.466] * (-1064.974) (-1066.923) (-1067.551) [-1061.871] -- 0:00:55
177500 -- (-1070.224) [-1069.643] (-1065.905) (-1062.231) * (-1064.421) (-1063.727) (-1065.532) [-1063.530] -- 0:00:55
178000 -- (-1070.143) [-1066.632] (-1067.665) (-1064.996) * (-1065.100) [-1063.129] (-1065.582) (-1065.220) -- 0:00:55
178500 -- (-1066.159) [-1064.818] (-1065.382) (-1064.114) * (-1068.393) (-1062.202) [-1062.647] (-1063.223) -- 0:00:55
179000 -- (-1064.436) [-1067.786] (-1069.714) (-1067.713) * [-1066.509] (-1064.321) (-1064.606) (-1065.312) -- 0:00:55
179500 -- (-1064.303) (-1064.936) (-1063.469) [-1062.481] * (-1065.838) (-1065.339) [-1061.935] (-1063.913) -- 0:00:54
180000 -- (-1065.142) [-1063.170] (-1065.817) (-1064.495) * (-1066.423) (-1066.139) [-1066.136] (-1065.488) -- 0:00:54
Average standard deviation of split frequencies: 0.012032
180500 -- [-1068.146] (-1063.042) (-1067.294) (-1064.617) * (-1072.199) (-1063.882) [-1061.814] (-1069.164) -- 0:00:54
181000 -- (-1069.095) [-1064.155] (-1063.301) (-1065.862) * (-1069.511) (-1065.607) [-1064.278] (-1065.090) -- 0:00:54
181500 -- [-1066.043] (-1067.149) (-1062.096) (-1064.904) * [-1066.118] (-1062.497) (-1066.225) (-1062.928) -- 0:00:54
182000 -- (-1065.014) (-1063.315) (-1064.214) [-1064.481] * (-1063.030) (-1064.263) [-1064.112] (-1068.380) -- 0:00:53
182500 -- [-1066.153] (-1063.377) (-1066.472) (-1061.470) * [-1064.897] (-1065.549) (-1063.098) (-1067.300) -- 0:00:53
183000 -- (-1064.342) (-1064.842) [-1067.653] (-1063.562) * [-1065.055] (-1065.540) (-1065.887) (-1065.586) -- 0:00:53
183500 -- (-1063.641) (-1063.477) [-1066.499] (-1064.457) * [-1063.570] (-1066.966) (-1066.331) (-1064.550) -- 0:00:53
184000 -- (-1063.760) (-1064.933) (-1066.642) [-1063.571] * [-1066.435] (-1066.927) (-1070.304) (-1067.635) -- 0:00:53
184500 -- (-1065.137) (-1061.897) (-1064.164) [-1066.330] * (-1065.886) (-1070.614) (-1067.789) [-1066.429] -- 0:00:53
185000 -- (-1062.467) (-1062.745) (-1063.144) [-1064.021] * [-1063.899] (-1066.491) (-1063.688) (-1066.571) -- 0:00:52
Average standard deviation of split frequencies: 0.013716
185500 -- (-1064.769) (-1064.026) [-1064.530] (-1066.453) * (-1062.631) [-1064.978] (-1068.391) (-1063.165) -- 0:00:57
186000 -- (-1067.009) (-1067.608) (-1066.281) [-1065.083] * (-1063.577) (-1067.422) [-1063.444] (-1064.115) -- 0:00:56
186500 -- (-1065.828) (-1067.291) (-1067.483) [-1063.593] * (-1062.894) (-1064.415) [-1062.265] (-1070.540) -- 0:00:56
187000 -- [-1067.564] (-1061.945) (-1063.271) (-1068.902) * [-1065.502] (-1063.784) (-1063.901) (-1072.537) -- 0:00:56
187500 -- (-1067.527) (-1067.737) (-1063.362) [-1064.466] * [-1065.351] (-1062.081) (-1065.837) (-1072.568) -- 0:00:56
188000 -- (-1065.317) (-1064.655) (-1066.230) [-1062.823] * (-1066.348) [-1064.754] (-1067.320) (-1069.498) -- 0:00:56
188500 -- (-1065.089) (-1063.373) [-1061.222] (-1063.687) * (-1064.371) (-1065.934) [-1067.699] (-1067.797) -- 0:00:55
189000 -- (-1063.231) (-1063.411) [-1062.874] (-1069.525) * (-1062.911) [-1064.606] (-1063.764) (-1069.841) -- 0:00:55
189500 -- [-1065.094] (-1063.175) (-1063.577) (-1066.233) * (-1063.060) [-1063.883] (-1063.787) (-1071.852) -- 0:00:55
190000 -- (-1065.234) (-1064.346) [-1064.349] (-1068.078) * (-1066.377) [-1063.732] (-1064.584) (-1065.775) -- 0:00:55
Average standard deviation of split frequencies: 0.012225
190500 -- (-1066.006) (-1062.799) [-1063.739] (-1062.949) * (-1065.319) (-1064.632) [-1062.134] (-1066.335) -- 0:00:55
191000 -- (-1063.704) [-1063.120] (-1063.777) (-1064.648) * (-1061.658) (-1063.778) (-1066.861) [-1062.165] -- 0:00:55
191500 -- (-1066.761) [-1062.676] (-1065.950) (-1065.704) * (-1062.335) (-1068.168) [-1064.235] (-1062.282) -- 0:00:54
192000 -- (-1063.827) (-1064.432) [-1068.348] (-1064.462) * [-1062.199] (-1061.008) (-1068.262) (-1065.848) -- 0:00:54
192500 -- [-1065.010] (-1065.162) (-1063.739) (-1062.870) * (-1067.114) (-1067.095) [-1064.972] (-1065.018) -- 0:00:54
193000 -- (-1064.952) (-1064.896) (-1064.008) [-1063.740] * (-1066.622) [-1064.984] (-1066.233) (-1064.870) -- 0:00:54
193500 -- (-1063.619) (-1067.688) [-1067.507] (-1064.863) * [-1067.116] (-1066.011) (-1063.325) (-1064.342) -- 0:00:54
194000 -- (-1064.848) (-1067.845) [-1064.868] (-1065.995) * [-1061.359] (-1064.740) (-1067.044) (-1063.410) -- 0:00:54
194500 -- (-1062.538) (-1064.842) (-1068.642) [-1069.539] * (-1061.742) [-1062.334] (-1068.406) (-1063.070) -- 0:00:53
195000 -- [-1063.767] (-1065.087) (-1067.251) (-1063.342) * (-1062.285) (-1065.491) [-1066.611] (-1065.867) -- 0:00:53
Average standard deviation of split frequencies: 0.012159
195500 -- [-1063.277] (-1066.421) (-1070.236) (-1065.104) * [-1064.558] (-1064.626) (-1067.855) (-1066.130) -- 0:00:53
196000 -- (-1064.080) (-1065.526) [-1068.570] (-1065.084) * (-1063.476) (-1062.905) (-1066.007) [-1063.937] -- 0:00:53
196500 -- [-1063.281] (-1063.706) (-1068.296) (-1065.006) * (-1063.598) [-1065.097] (-1069.642) (-1064.205) -- 0:00:53
197000 -- [-1062.805] (-1065.298) (-1063.182) (-1062.529) * (-1064.573) (-1066.941) (-1064.834) [-1065.622] -- 0:00:52
197500 -- (-1064.453) [-1064.807] (-1065.368) (-1068.473) * (-1064.737) (-1066.534) [-1064.443] (-1067.205) -- 0:00:52
198000 -- [-1064.933] (-1067.013) (-1069.669) (-1066.183) * (-1068.187) (-1065.428) [-1064.333] (-1067.772) -- 0:00:52
198500 -- [-1065.485] (-1064.233) (-1067.230) (-1064.875) * (-1061.475) (-1069.094) [-1065.767] (-1064.047) -- 0:00:52
199000 -- (-1064.411) (-1064.539) (-1063.570) [-1063.663] * (-1065.775) (-1065.564) [-1064.697] (-1067.082) -- 0:00:52
199500 -- (-1063.442) (-1065.524) (-1063.425) [-1064.278] * (-1065.400) [-1061.296] (-1064.424) (-1066.181) -- 0:00:52
200000 -- (-1064.233) (-1065.498) [-1063.721] (-1063.877) * (-1064.875) [-1063.484] (-1063.251) (-1065.231) -- 0:00:51
Average standard deviation of split frequencies: 0.012161
200500 -- (-1065.676) [-1062.703] (-1067.793) (-1064.142) * (-1065.272) (-1063.457) [-1065.831] (-1063.073) -- 0:00:55
201000 -- (-1066.859) (-1064.420) [-1067.591] (-1064.287) * (-1069.051) [-1063.214] (-1064.917) (-1066.115) -- 0:00:55
201500 -- (-1066.611) (-1065.777) [-1063.385] (-1064.885) * (-1062.785) [-1061.315] (-1065.822) (-1064.142) -- 0:00:55
202000 -- (-1065.553) [-1065.727] (-1062.675) (-1065.349) * (-1062.103) (-1063.127) (-1066.622) [-1068.683] -- 0:00:55
202500 -- [-1067.338] (-1066.513) (-1067.283) (-1067.409) * [-1062.784] (-1066.075) (-1064.755) (-1064.501) -- 0:00:55
203000 -- (-1064.604) [-1066.705] (-1064.438) (-1065.225) * (-1062.959) (-1065.460) (-1063.128) [-1064.447] -- 0:00:54
203500 -- [-1064.554] (-1065.942) (-1065.214) (-1063.319) * (-1061.937) (-1064.783) (-1067.964) [-1065.405] -- 0:00:54
204000 -- (-1064.517) (-1066.907) [-1063.753] (-1065.919) * [-1063.602] (-1063.783) (-1063.502) (-1065.233) -- 0:00:54
204500 -- (-1065.945) (-1065.155) [-1063.978] (-1064.100) * [-1065.075] (-1065.315) (-1065.642) (-1064.329) -- 0:00:54
205000 -- [-1067.123] (-1065.410) (-1064.372) (-1064.492) * (-1063.353) (-1068.020) [-1062.441] (-1065.353) -- 0:00:54
Average standard deviation of split frequencies: 0.013095
205500 -- (-1063.404) [-1065.586] (-1069.561) (-1070.684) * (-1063.027) (-1067.792) [-1063.907] (-1063.019) -- 0:00:54
206000 -- [-1063.724] (-1065.848) (-1074.800) (-1065.010) * [-1066.529] (-1070.668) (-1068.218) (-1063.962) -- 0:00:53
206500 -- (-1064.827) (-1065.623) [-1068.990] (-1064.438) * (-1063.196) (-1067.385) [-1067.285] (-1066.576) -- 0:00:53
207000 -- (-1063.653) (-1067.709) (-1067.496) [-1063.888] * [-1063.656] (-1064.515) (-1068.311) (-1064.436) -- 0:00:53
207500 -- (-1066.451) (-1067.187) (-1067.591) [-1063.034] * [-1061.416] (-1067.086) (-1064.457) (-1066.682) -- 0:00:53
208000 -- (-1060.983) [-1066.302] (-1067.813) (-1063.986) * (-1062.984) [-1065.099] (-1066.254) (-1065.172) -- 0:00:53
208500 -- (-1063.451) [-1064.585] (-1067.307) (-1063.979) * [-1062.094] (-1062.771) (-1065.249) (-1067.935) -- 0:00:53
209000 -- (-1065.477) [-1064.460] (-1068.373) (-1062.770) * (-1064.202) (-1061.918) (-1064.941) [-1067.022] -- 0:00:52
209500 -- (-1062.991) (-1065.257) [-1063.954] (-1063.016) * (-1063.292) (-1062.744) [-1065.244] (-1065.118) -- 0:00:52
210000 -- (-1063.771) (-1063.844) (-1068.095) [-1064.384] * [-1062.759] (-1066.477) (-1066.236) (-1064.096) -- 0:00:52
Average standard deviation of split frequencies: 0.011313
210500 -- (-1063.077) (-1064.612) (-1069.471) [-1064.070] * (-1063.635) (-1065.409) (-1066.523) [-1065.030] -- 0:00:52
211000 -- (-1063.011) (-1066.507) (-1065.388) [-1069.288] * (-1063.009) (-1063.839) (-1062.738) [-1063.754] -- 0:00:52
211500 -- (-1064.663) [-1067.687] (-1072.414) (-1063.829) * (-1063.379) [-1063.517] (-1068.588) (-1065.178) -- 0:00:52
212000 -- [-1062.175] (-1066.375) (-1065.149) (-1065.279) * (-1065.260) (-1063.593) (-1066.069) [-1063.724] -- 0:00:52
212500 -- [-1062.889] (-1063.810) (-1063.937) (-1063.010) * (-1066.322) [-1064.589] (-1067.849) (-1065.327) -- 0:00:51
213000 -- (-1066.286) (-1064.684) [-1064.482] (-1065.654) * (-1066.866) [-1062.898] (-1071.396) (-1063.535) -- 0:00:51
213500 -- (-1062.935) [-1065.088] (-1067.085) (-1063.412) * [-1063.714] (-1062.531) (-1067.801) (-1065.023) -- 0:00:51
214000 -- [-1061.600] (-1065.432) (-1067.093) (-1065.003) * (-1067.279) [-1063.526] (-1065.936) (-1063.022) -- 0:00:51
214500 -- (-1063.891) [-1065.952] (-1064.272) (-1063.179) * (-1065.949) [-1064.296] (-1065.338) (-1064.549) -- 0:00:51
215000 -- (-1064.554) (-1067.170) [-1064.441] (-1064.271) * (-1068.853) (-1065.098) (-1064.111) [-1064.243] -- 0:00:51
Average standard deviation of split frequencies: 0.008858
215500 -- (-1063.234) (-1066.137) (-1063.389) [-1063.095] * (-1066.255) [-1062.487] (-1063.331) (-1063.777) -- 0:00:54
216000 -- [-1063.661] (-1067.107) (-1062.501) (-1067.596) * (-1066.307) (-1063.110) [-1064.658] (-1066.317) -- 0:00:54
216500 -- (-1064.686) (-1063.221) [-1062.933] (-1066.626) * (-1066.511) (-1064.972) [-1062.642] (-1065.274) -- 0:00:54
217000 -- [-1067.864] (-1072.411) (-1063.844) (-1062.938) * (-1065.794) (-1062.947) (-1062.878) [-1065.555] -- 0:00:54
217500 -- (-1064.582) (-1066.762) [-1065.265] (-1064.337) * (-1070.329) (-1064.106) [-1061.638] (-1063.481) -- 0:00:53
218000 -- (-1065.274) (-1067.968) [-1063.217] (-1062.651) * [-1062.160] (-1063.123) (-1062.918) (-1069.700) -- 0:00:53
218500 -- (-1064.953) (-1066.231) (-1063.219) [-1065.453] * [-1066.720] (-1062.360) (-1067.216) (-1068.433) -- 0:00:53
219000 -- (-1063.282) (-1066.100) [-1064.460] (-1064.307) * (-1063.522) (-1064.564) [-1064.752] (-1063.923) -- 0:00:53
219500 -- (-1066.231) (-1064.947) [-1062.486] (-1066.163) * [-1062.092] (-1065.405) (-1065.001) (-1063.188) -- 0:00:53
220000 -- (-1064.640) (-1065.972) [-1064.773] (-1066.082) * (-1065.007) [-1062.892] (-1065.607) (-1067.150) -- 0:00:53
Average standard deviation of split frequencies: 0.009213
220500 -- (-1065.621) (-1064.712) [-1061.649] (-1063.473) * [-1064.322] (-1063.368) (-1064.311) (-1064.352) -- 0:00:53
221000 -- [-1063.710] (-1064.332) (-1065.034) (-1064.251) * [-1061.874] (-1064.262) (-1066.092) (-1065.576) -- 0:00:52
221500 -- (-1061.756) (-1064.859) [-1064.610] (-1064.528) * [-1062.731] (-1067.362) (-1063.550) (-1064.121) -- 0:00:52
222000 -- (-1065.583) (-1066.099) (-1062.512) [-1061.515] * (-1062.866) [-1065.475] (-1064.088) (-1064.647) -- 0:00:52
222500 -- (-1064.971) (-1067.643) [-1066.735] (-1064.919) * (-1063.661) (-1066.508) (-1063.953) [-1062.231] -- 0:00:52
223000 -- (-1068.294) (-1066.752) [-1065.124] (-1068.075) * (-1064.013) [-1063.518] (-1064.126) (-1065.376) -- 0:00:52
223500 -- (-1065.170) (-1063.745) [-1063.147] (-1066.597) * (-1064.970) (-1063.234) (-1066.867) [-1063.007] -- 0:00:52
224000 -- (-1064.944) (-1067.147) [-1064.645] (-1067.150) * [-1062.033] (-1064.970) (-1064.523) (-1065.864) -- 0:00:51
224500 -- [-1068.286] (-1065.031) (-1063.980) (-1065.101) * (-1063.269) (-1063.881) [-1063.453] (-1064.092) -- 0:00:51
225000 -- (-1066.927) [-1064.005] (-1066.870) (-1068.900) * (-1066.074) (-1064.072) (-1066.148) [-1062.911] -- 0:00:51
Average standard deviation of split frequencies: 0.009816
225500 -- [-1066.613] (-1064.349) (-1063.343) (-1067.291) * (-1064.974) (-1068.138) [-1065.293] (-1064.029) -- 0:00:51
226000 -- (-1066.857) [-1066.499] (-1063.466) (-1065.087) * [-1062.935] (-1065.065) (-1064.301) (-1064.188) -- 0:00:51
226500 -- [-1065.922] (-1065.678) (-1065.538) (-1065.442) * [-1063.102] (-1065.819) (-1065.892) (-1063.265) -- 0:00:51
227000 -- (-1064.379) [-1065.664] (-1065.854) (-1065.991) * (-1064.426) (-1063.435) (-1064.786) [-1065.657] -- 0:00:51
227500 -- [-1063.515] (-1069.906) (-1065.002) (-1067.669) * (-1065.828) (-1065.562) (-1066.114) [-1063.889] -- 0:00:50
228000 -- (-1066.673) [-1066.476] (-1063.516) (-1066.875) * (-1061.586) (-1065.468) [-1067.089] (-1064.954) -- 0:00:50
228500 -- (-1063.398) (-1066.955) [-1063.150] (-1063.136) * (-1064.618) (-1063.903) (-1065.100) [-1065.150] -- 0:00:50
229000 -- (-1067.914) (-1065.673) (-1061.181) [-1064.779] * (-1061.958) (-1070.236) [-1066.519] (-1065.334) -- 0:00:50
229500 -- (-1065.120) (-1063.183) (-1062.959) [-1067.651] * [-1067.520] (-1065.234) (-1066.120) (-1065.942) -- 0:00:50
230000 -- (-1066.819) (-1063.674) [-1061.594] (-1066.861) * (-1063.742) (-1062.023) [-1066.061] (-1067.250) -- 0:00:50
Average standard deviation of split frequencies: 0.009497
230500 -- (-1065.425) (-1062.847) (-1062.955) [-1067.436] * (-1064.982) (-1066.840) (-1068.605) [-1065.381] -- 0:00:53
231000 -- [-1065.083] (-1066.551) (-1063.941) (-1066.539) * [-1062.382] (-1069.350) (-1063.334) (-1064.062) -- 0:00:53
231500 -- (-1065.841) [-1065.600] (-1066.014) (-1070.144) * (-1064.600) (-1068.551) [-1062.599] (-1067.347) -- 0:00:53
232000 -- [-1064.663] (-1063.707) (-1069.310) (-1064.578) * [-1063.875] (-1066.042) (-1062.244) (-1065.472) -- 0:00:52
232500 -- (-1063.889) (-1063.011) (-1064.151) [-1065.661] * (-1065.637) [-1064.893] (-1064.575) (-1069.845) -- 0:00:52
233000 -- (-1065.182) (-1062.636) [-1062.764] (-1071.989) * (-1065.377) [-1064.413] (-1063.581) (-1070.852) -- 0:00:52
233500 -- (-1066.732) [-1062.568] (-1068.502) (-1069.368) * (-1066.246) (-1062.095) (-1064.116) [-1065.541] -- 0:00:52
234000 -- (-1066.303) [-1066.887] (-1067.165) (-1065.301) * (-1064.724) [-1064.031] (-1064.147) (-1068.056) -- 0:00:52
234500 -- (-1063.121) (-1067.351) (-1064.984) [-1064.328] * [-1063.004] (-1065.110) (-1064.577) (-1061.893) -- 0:00:52
235000 -- (-1070.989) (-1066.113) [-1065.700] (-1063.398) * [-1064.187] (-1066.910) (-1062.736) (-1064.071) -- 0:00:52
Average standard deviation of split frequencies: 0.010237
235500 -- (-1066.288) (-1065.089) (-1066.819) [-1064.355] * (-1065.788) (-1063.472) [-1065.722] (-1063.100) -- 0:00:51
236000 -- [-1063.184] (-1063.966) (-1064.882) (-1065.775) * [-1065.253] (-1064.716) (-1063.249) (-1066.545) -- 0:00:51
236500 -- (-1067.584) (-1063.304) [-1065.055] (-1064.925) * (-1065.807) (-1066.892) (-1068.724) [-1069.827] -- 0:00:51
237000 -- (-1064.223) (-1064.290) (-1064.149) [-1064.547] * [-1067.042] (-1063.812) (-1064.917) (-1062.876) -- 0:00:51
237500 -- (-1065.347) [-1064.625] (-1063.420) (-1069.625) * (-1061.737) (-1065.854) [-1061.969] (-1063.071) -- 0:00:51
238000 -- (-1065.848) [-1063.754] (-1064.249) (-1064.618) * (-1065.205) [-1063.895] (-1062.423) (-1061.847) -- 0:00:51
238500 -- (-1062.942) (-1063.744) (-1066.351) [-1064.746] * (-1063.113) [-1064.014] (-1065.597) (-1064.096) -- 0:00:51
239000 -- (-1064.148) (-1064.601) (-1063.998) [-1062.896] * (-1066.925) (-1067.527) (-1063.863) [-1062.968] -- 0:00:50
239500 -- (-1064.829) (-1065.865) (-1067.475) [-1065.868] * [-1063.281] (-1065.899) (-1064.190) (-1065.580) -- 0:00:50
240000 -- [-1065.213] (-1065.725) (-1064.017) (-1065.396) * (-1066.106) [-1064.782] (-1064.310) (-1063.346) -- 0:00:50
Average standard deviation of split frequencies: 0.008987
240500 -- (-1063.014) [-1065.896] (-1067.187) (-1064.552) * [-1063.614] (-1064.660) (-1066.539) (-1067.339) -- 0:00:50
241000 -- (-1063.146) (-1063.855) [-1066.059] (-1063.030) * (-1064.508) (-1065.367) [-1065.731] (-1067.297) -- 0:00:50
241500 -- (-1066.432) (-1062.450) [-1063.989] (-1066.006) * [-1062.899] (-1063.561) (-1066.647) (-1065.816) -- 0:00:50
242000 -- (-1068.386) [-1066.431] (-1065.750) (-1066.701) * [-1062.112] (-1063.081) (-1065.719) (-1063.828) -- 0:00:50
242500 -- (-1074.035) [-1063.936] (-1065.916) (-1065.786) * (-1063.544) (-1066.101) [-1063.652] (-1063.327) -- 0:00:49
243000 -- (-1064.330) (-1063.426) (-1070.285) [-1065.068] * (-1061.824) [-1064.432] (-1064.436) (-1064.728) -- 0:00:49
243500 -- (-1065.792) (-1064.579) (-1066.867) [-1064.732] * (-1065.119) (-1066.536) [-1064.231] (-1066.496) -- 0:00:49
244000 -- (-1066.061) (-1064.804) [-1067.061] (-1064.924) * [-1061.497] (-1065.975) (-1066.095) (-1065.217) -- 0:00:49
244500 -- [-1067.224] (-1062.597) (-1067.018) (-1065.000) * (-1065.008) (-1064.767) (-1064.864) [-1063.112] -- 0:00:49
245000 -- (-1066.736) [-1063.248] (-1065.934) (-1067.527) * (-1063.565) (-1065.209) (-1064.329) [-1064.482] -- 0:00:49
Average standard deviation of split frequencies: 0.011817
245500 -- (-1067.735) (-1065.429) [-1064.259] (-1065.415) * [-1062.985] (-1064.534) (-1064.774) (-1063.043) -- 0:00:49
246000 -- (-1064.181) (-1068.254) (-1064.311) [-1063.578] * [-1062.176] (-1066.654) (-1062.318) (-1064.280) -- 0:00:52
246500 -- [-1064.181] (-1068.388) (-1068.558) (-1065.612) * [-1063.568] (-1065.541) (-1065.660) (-1066.657) -- 0:00:51
247000 -- (-1064.849) [-1062.001] (-1067.383) (-1064.452) * [-1063.134] (-1062.376) (-1066.477) (-1062.795) -- 0:00:51
247500 -- (-1065.143) (-1063.091) [-1069.036] (-1063.747) * (-1062.859) [-1061.094] (-1070.387) (-1064.162) -- 0:00:51
248000 -- (-1066.356) (-1063.112) [-1064.667] (-1064.308) * (-1066.289) [-1062.743] (-1064.230) (-1066.031) -- 0:00:51
248500 -- (-1066.151) (-1064.094) [-1061.857] (-1069.796) * (-1060.861) [-1061.744] (-1066.184) (-1064.981) -- 0:00:51
249000 -- (-1063.083) [-1063.651] (-1063.739) (-1067.928) * (-1066.184) (-1065.401) [-1068.848] (-1066.855) -- 0:00:51
249500 -- (-1062.930) (-1067.523) (-1065.340) [-1064.441] * (-1063.162) [-1063.236] (-1065.283) (-1066.076) -- 0:00:51
250000 -- [-1060.352] (-1064.626) (-1066.002) (-1065.538) * (-1065.014) (-1064.844) (-1066.913) [-1066.282] -- 0:00:51
Average standard deviation of split frequencies: 0.012867
250500 -- [-1068.884] (-1062.559) (-1063.194) (-1064.678) * (-1065.951) [-1064.437] (-1062.862) (-1065.855) -- 0:00:50
251000 -- [-1063.000] (-1064.690) (-1064.541) (-1067.599) * (-1061.566) (-1066.463) (-1066.967) [-1064.809] -- 0:00:50
251500 -- (-1060.697) (-1063.981) (-1062.564) [-1065.184] * [-1062.795] (-1064.232) (-1063.822) (-1067.630) -- 0:00:50
252000 -- (-1061.111) [-1065.932] (-1065.226) (-1066.094) * (-1062.817) (-1066.400) [-1064.980] (-1066.529) -- 0:00:50
252500 -- (-1061.517) (-1068.224) [-1061.052] (-1064.817) * (-1062.326) (-1064.435) [-1066.870] (-1066.595) -- 0:00:50
253000 -- (-1060.917) (-1067.415) [-1062.193] (-1066.927) * (-1063.149) (-1066.410) [-1064.794] (-1067.564) -- 0:00:50
253500 -- [-1062.268] (-1065.994) (-1071.906) (-1066.070) * [-1064.264] (-1065.954) (-1063.786) (-1067.261) -- 0:00:50
254000 -- [-1062.988] (-1070.506) (-1062.750) (-1064.932) * (-1064.877) (-1064.587) [-1063.580] (-1063.675) -- 0:00:49
254500 -- (-1062.622) (-1067.507) [-1061.631] (-1065.074) * [-1069.278] (-1066.136) (-1063.190) (-1061.500) -- 0:00:49
255000 -- (-1063.440) (-1064.019) (-1065.715) [-1065.705] * (-1062.193) (-1063.797) [-1064.494] (-1065.448) -- 0:00:49
Average standard deviation of split frequencies: 0.012788
255500 -- [-1062.457] (-1063.364) (-1061.130) (-1065.904) * (-1063.496) (-1067.171) [-1065.487] (-1065.167) -- 0:00:49
256000 -- (-1074.100) [-1062.587] (-1062.694) (-1067.315) * [-1061.330] (-1066.111) (-1066.862) (-1065.091) -- 0:00:49
256500 -- (-1066.198) (-1063.453) [-1061.309] (-1066.137) * [-1061.338] (-1064.419) (-1068.526) (-1064.649) -- 0:00:49
257000 -- (-1063.629) (-1065.747) (-1065.165) [-1069.725] * (-1062.757) (-1064.838) [-1065.698] (-1064.969) -- 0:00:49
257500 -- (-1065.459) (-1064.802) [-1063.004] (-1065.477) * (-1068.289) (-1064.339) [-1065.435] (-1067.967) -- 0:00:49
258000 -- (-1063.767) (-1067.232) (-1063.939) [-1067.355] * (-1062.097) (-1064.228) [-1066.091] (-1066.064) -- 0:00:48
258500 -- (-1062.550) (-1065.930) [-1063.215] (-1062.344) * (-1064.323) [-1064.166] (-1067.048) (-1065.578) -- 0:00:48
259000 -- (-1066.112) [-1065.626] (-1069.297) (-1066.196) * (-1062.512) [-1066.903] (-1061.964) (-1062.430) -- 0:00:48
259500 -- [-1062.260] (-1067.858) (-1064.300) (-1065.746) * (-1062.576) (-1065.315) (-1067.002) [-1064.963] -- 0:00:48
260000 -- (-1063.259) (-1066.396) [-1063.858] (-1066.330) * (-1063.414) (-1062.381) (-1065.718) [-1068.808] -- 0:00:48
Average standard deviation of split frequencies: 0.013262
260500 -- (-1063.163) (-1063.905) (-1064.081) [-1065.880] * (-1066.279) (-1065.253) [-1066.162] (-1065.249) -- 0:00:48
261000 -- (-1065.151) (-1065.263) (-1066.392) [-1063.656] * (-1063.813) [-1065.711] (-1064.616) (-1063.712) -- 0:00:50
261500 -- [-1064.286] (-1064.639) (-1063.731) (-1070.358) * (-1066.805) (-1069.947) (-1065.241) [-1064.800] -- 0:00:50
262000 -- (-1064.142) (-1065.689) (-1066.639) [-1064.292] * (-1064.863) (-1065.072) [-1065.325] (-1063.665) -- 0:00:50
262500 -- (-1066.677) (-1063.648) (-1066.610) [-1065.316] * (-1066.057) (-1068.396) [-1067.207] (-1070.102) -- 0:00:50
263000 -- (-1066.245) (-1063.689) (-1063.670) [-1066.214] * (-1063.091) (-1067.262) (-1065.399) [-1063.992] -- 0:00:50
263500 -- (-1065.238) (-1063.378) [-1066.191] (-1066.316) * (-1068.652) (-1063.771) (-1065.419) [-1061.902] -- 0:00:50
264000 -- (-1065.770) [-1068.132] (-1062.796) (-1066.156) * [-1062.952] (-1063.220) (-1063.335) (-1065.376) -- 0:00:50
264500 -- (-1065.628) [-1062.961] (-1067.210) (-1065.114) * (-1066.254) [-1064.273] (-1064.949) (-1065.047) -- 0:00:50
265000 -- [-1062.624] (-1067.432) (-1062.259) (-1065.334) * (-1067.074) (-1067.943) [-1068.973] (-1065.326) -- 0:00:49
Average standard deviation of split frequencies: 0.012701
265500 -- [-1064.350] (-1064.002) (-1063.518) (-1067.146) * (-1064.157) [-1068.348] (-1069.399) (-1064.460) -- 0:00:49
266000 -- (-1068.668) (-1063.993) [-1063.397] (-1064.542) * (-1066.227) (-1064.650) [-1066.414] (-1065.457) -- 0:00:49
266500 -- [-1062.099] (-1063.695) (-1067.932) (-1064.013) * [-1063.591] (-1065.562) (-1064.315) (-1064.381) -- 0:00:49
267000 -- (-1065.847) [-1063.634] (-1063.314) (-1064.534) * (-1062.444) [-1064.174] (-1062.513) (-1065.740) -- 0:00:49
267500 -- (-1064.180) (-1066.261) (-1063.946) [-1064.933] * (-1062.770) [-1069.193] (-1064.489) (-1068.356) -- 0:00:49
268000 -- (-1062.421) (-1066.857) [-1062.512] (-1065.749) * (-1061.101) (-1066.628) [-1066.303] (-1064.124) -- 0:00:49
268500 -- [-1068.061] (-1070.268) (-1071.604) (-1064.333) * (-1063.877) [-1064.327] (-1064.592) (-1064.267) -- 0:00:49
269000 -- (-1062.319) (-1068.460) (-1065.738) [-1065.366] * (-1064.014) (-1064.811) (-1067.895) [-1066.403] -- 0:00:48
269500 -- (-1063.776) [-1067.964] (-1065.373) (-1074.023) * (-1065.080) [-1063.635] (-1062.479) (-1067.916) -- 0:00:48
270000 -- (-1064.614) (-1063.964) [-1065.526] (-1066.526) * [-1064.413] (-1069.289) (-1061.912) (-1064.259) -- 0:00:48
Average standard deviation of split frequencies: 0.010552
270500 -- [-1063.562] (-1064.369) (-1066.396) (-1065.039) * (-1062.553) (-1065.948) (-1064.767) [-1064.554] -- 0:00:48
271000 -- [-1065.195] (-1065.579) (-1066.901) (-1066.942) * (-1068.686) [-1062.178] (-1063.546) (-1065.178) -- 0:00:48
271500 -- (-1064.721) [-1066.565] (-1068.746) (-1067.937) * (-1065.585) (-1067.725) [-1063.535] (-1063.325) -- 0:00:48
272000 -- (-1062.716) [-1064.307] (-1065.900) (-1065.628) * (-1066.524) [-1063.479] (-1061.938) (-1066.127) -- 0:00:48
272500 -- (-1061.752) (-1061.474) (-1065.646) [-1064.814] * (-1065.775) (-1065.005) [-1063.483] (-1070.947) -- 0:00:48
273000 -- (-1066.473) (-1063.777) (-1065.169) [-1064.990] * (-1065.932) (-1063.892) [-1062.255] (-1063.386) -- 0:00:47
273500 -- [-1064.992] (-1065.743) (-1064.798) (-1065.302) * (-1062.863) (-1063.112) [-1064.553] (-1063.316) -- 0:00:47
274000 -- [-1063.826] (-1069.571) (-1064.740) (-1068.738) * [-1062.507] (-1065.504) (-1061.176) (-1063.460) -- 0:00:47
274500 -- (-1064.576) (-1064.353) [-1062.637] (-1065.081) * (-1065.759) (-1069.136) (-1063.897) [-1062.646] -- 0:00:47
275000 -- (-1063.706) (-1070.561) (-1063.356) [-1064.123] * (-1065.007) (-1064.779) (-1067.102) [-1065.980] -- 0:00:47
Average standard deviation of split frequencies: 0.010549
275500 -- (-1063.565) (-1063.931) [-1064.362] (-1063.292) * [-1063.361] (-1069.372) (-1069.431) (-1065.815) -- 0:00:47
276000 -- (-1062.655) [-1063.919] (-1063.990) (-1065.168) * (-1065.592) (-1068.590) (-1066.461) [-1063.329] -- 0:00:47
276500 -- (-1065.766) (-1063.320) [-1066.787] (-1064.353) * (-1066.827) (-1068.810) [-1064.303] (-1063.901) -- 0:00:49
277000 -- (-1063.270) (-1064.897) [-1062.285] (-1066.282) * (-1070.242) [-1064.500] (-1065.627) (-1067.228) -- 0:00:49
277500 -- [-1062.444] (-1064.407) (-1064.058) (-1064.472) * (-1065.905) (-1068.679) (-1067.851) [-1064.682] -- 0:00:49
278000 -- (-1062.013) (-1066.245) (-1068.121) [-1064.660] * (-1066.110) (-1063.526) (-1063.752) [-1063.271] -- 0:00:49
278500 -- [-1064.388] (-1062.558) (-1067.153) (-1063.920) * (-1062.318) (-1065.169) (-1065.479) [-1062.152] -- 0:00:49
279000 -- (-1063.940) (-1068.642) (-1064.058) [-1066.198] * (-1064.276) (-1064.540) (-1065.923) [-1065.400] -- 0:00:49
279500 -- (-1065.094) (-1065.420) [-1065.905] (-1066.687) * [-1062.835] (-1065.700) (-1065.283) (-1064.760) -- 0:00:48
280000 -- (-1064.869) (-1068.237) [-1065.014] (-1069.622) * (-1066.104) [-1065.454] (-1067.495) (-1063.086) -- 0:00:48
Average standard deviation of split frequencies: 0.012912
280500 -- [-1062.387] (-1065.026) (-1062.534) (-1063.788) * (-1064.709) (-1066.280) (-1066.209) [-1062.948] -- 0:00:48
281000 -- (-1065.721) (-1063.630) [-1062.679] (-1069.080) * (-1064.674) (-1067.251) [-1067.857] (-1067.162) -- 0:00:48
281500 -- (-1063.300) [-1066.752] (-1071.126) (-1067.901) * (-1064.179) (-1067.878) [-1065.220] (-1062.709) -- 0:00:48
282000 -- (-1066.725) [-1063.248] (-1064.872) (-1063.572) * (-1065.647) (-1063.879) (-1066.068) [-1061.393] -- 0:00:48
282500 -- (-1063.234) [-1061.002] (-1064.905) (-1063.901) * [-1064.567] (-1069.497) (-1064.352) (-1062.164) -- 0:00:48
283000 -- (-1062.398) [-1062.306] (-1062.751) (-1064.988) * (-1064.309) (-1066.022) (-1063.795) [-1065.439] -- 0:00:48
283500 -- [-1065.762] (-1067.472) (-1064.428) (-1065.008) * [-1065.372] (-1066.785) (-1068.236) (-1063.367) -- 0:00:48
284000 -- (-1065.407) [-1063.018] (-1063.571) (-1069.691) * [-1070.536] (-1065.201) (-1065.961) (-1063.327) -- 0:00:47
284500 -- (-1068.292) [-1062.465] (-1065.597) (-1062.777) * (-1064.297) (-1065.922) [-1064.716] (-1063.033) -- 0:00:47
285000 -- (-1061.627) (-1064.094) (-1066.901) [-1063.946] * (-1065.282) (-1068.735) [-1065.790] (-1064.125) -- 0:00:47
Average standard deviation of split frequencies: 0.012798
285500 -- [-1063.545] (-1065.021) (-1066.289) (-1063.884) * (-1065.164) (-1063.369) (-1064.509) [-1069.748] -- 0:00:47
286000 -- [-1065.308] (-1069.169) (-1067.258) (-1064.274) * (-1063.859) (-1066.046) [-1066.639] (-1064.617) -- 0:00:47
286500 -- [-1064.008] (-1066.555) (-1068.895) (-1066.456) * (-1064.942) [-1067.023] (-1063.852) (-1065.148) -- 0:00:47
287000 -- (-1064.298) (-1064.986) (-1063.571) [-1069.149] * (-1067.638) (-1067.860) [-1062.879] (-1063.103) -- 0:00:47
287500 -- [-1063.675] (-1066.343) (-1065.940) (-1065.691) * (-1064.848) [-1066.134] (-1064.699) (-1063.967) -- 0:00:47
288000 -- (-1063.137) (-1064.835) [-1065.413] (-1065.297) * (-1066.543) (-1063.446) (-1065.683) [-1061.181] -- 0:00:46
288500 -- (-1064.899) [-1062.135] (-1063.646) (-1065.604) * [-1066.543] (-1066.484) (-1063.745) (-1064.796) -- 0:00:46
289000 -- (-1063.863) (-1065.540) [-1060.237] (-1062.679) * (-1062.927) (-1062.147) [-1062.795] (-1064.271) -- 0:00:46
289500 -- (-1063.061) [-1066.263] (-1063.771) (-1064.209) * (-1061.821) (-1062.268) [-1066.068] (-1067.001) -- 0:00:46
290000 -- [-1062.502] (-1065.158) (-1063.534) (-1067.239) * (-1061.921) (-1065.779) [-1066.233] (-1065.010) -- 0:00:46
Average standard deviation of split frequencies: 0.012497
290500 -- [-1061.249] (-1063.649) (-1064.078) (-1065.861) * (-1065.866) [-1064.487] (-1065.617) (-1065.849) -- 0:00:46
291000 -- (-1065.229) (-1063.698) [-1063.740] (-1065.479) * (-1064.055) (-1068.418) [-1065.479] (-1067.567) -- 0:00:46
291500 -- (-1063.123) (-1066.301) (-1063.430) [-1064.706] * (-1066.382) [-1065.215] (-1068.385) (-1063.022) -- 0:00:48
292000 -- (-1064.574) (-1064.441) [-1065.862] (-1065.799) * (-1062.659) [-1063.315] (-1063.000) (-1064.402) -- 0:00:48
292500 -- (-1072.307) (-1065.072) [-1064.266] (-1065.710) * [-1062.522] (-1065.540) (-1065.349) (-1066.680) -- 0:00:48
293000 -- (-1063.947) (-1063.076) [-1063.559] (-1068.014) * [-1061.551] (-1065.676) (-1070.661) (-1062.029) -- 0:00:48
293500 -- (-1070.459) [-1062.920] (-1063.700) (-1065.501) * [-1065.365] (-1064.383) (-1064.635) (-1064.092) -- 0:00:48
294000 -- (-1063.911) (-1063.692) [-1066.117] (-1070.144) * [-1064.432] (-1065.114) (-1065.189) (-1061.992) -- 0:00:48
294500 -- [-1063.427] (-1064.358) (-1066.350) (-1065.751) * (-1063.842) (-1066.685) (-1065.616) [-1062.347] -- 0:00:47
295000 -- (-1064.804) (-1065.559) [-1060.735] (-1065.216) * (-1062.474) (-1069.819) (-1066.517) [-1062.554] -- 0:00:47
Average standard deviation of split frequencies: 0.012840
295500 -- (-1061.400) [-1062.042] (-1063.251) (-1064.298) * [-1062.035] (-1064.356) (-1069.788) (-1062.902) -- 0:00:47
296000 -- (-1063.845) [-1064.643] (-1072.223) (-1070.756) * (-1062.198) (-1063.673) (-1063.263) [-1062.553] -- 0:00:47
296500 -- (-1066.374) [-1065.096] (-1065.306) (-1065.104) * (-1062.819) (-1065.020) (-1066.007) [-1064.099] -- 0:00:47
297000 -- (-1062.845) [-1063.117] (-1065.520) (-1066.138) * [-1062.298] (-1063.831) (-1064.884) (-1061.730) -- 0:00:47
297500 -- (-1063.669) (-1065.117) [-1067.263] (-1064.565) * (-1065.750) (-1064.639) [-1065.797] (-1063.537) -- 0:00:47
298000 -- (-1065.807) (-1064.345) [-1062.079] (-1064.710) * [-1061.380] (-1062.432) (-1065.731) (-1064.565) -- 0:00:47
298500 -- (-1065.018) [-1062.059] (-1063.314) (-1065.606) * (-1065.825) [-1063.803] (-1065.199) (-1064.310) -- 0:00:47
299000 -- (-1066.548) (-1066.194) [-1065.239] (-1065.792) * [-1062.243] (-1066.360) (-1064.511) (-1065.023) -- 0:00:46
299500 -- (-1065.645) [-1064.578] (-1064.071) (-1065.985) * [-1062.929] (-1063.985) (-1065.532) (-1064.498) -- 0:00:46
300000 -- (-1064.929) (-1066.996) (-1066.062) [-1064.162] * (-1066.050) (-1065.148) (-1066.636) [-1063.501] -- 0:00:46
Average standard deviation of split frequencies: 0.015033
300500 -- [-1063.010] (-1069.980) (-1065.911) (-1064.965) * (-1065.459) (-1066.464) (-1065.905) [-1063.531] -- 0:00:46
301000 -- (-1066.763) (-1062.488) (-1064.851) [-1064.714] * (-1066.126) [-1071.135] (-1063.582) (-1068.068) -- 0:00:46
301500 -- [-1061.533] (-1066.204) (-1064.840) (-1064.342) * (-1062.814) [-1066.347] (-1063.772) (-1064.551) -- 0:00:46
302000 -- (-1064.381) (-1066.917) [-1065.191] (-1066.743) * [-1064.034] (-1065.819) (-1066.127) (-1064.891) -- 0:00:46
302500 -- (-1066.387) [-1061.084] (-1067.670) (-1064.986) * (-1063.523) (-1068.542) [-1067.622] (-1063.136) -- 0:00:46
303000 -- (-1065.902) (-1065.477) (-1069.829) [-1067.604] * [-1062.455] (-1066.900) (-1067.114) (-1065.039) -- 0:00:46
303500 -- (-1064.431) (-1061.490) [-1065.857] (-1065.104) * (-1064.673) (-1063.543) [-1067.200] (-1069.130) -- 0:00:45
304000 -- (-1062.158) (-1062.467) (-1065.272) [-1065.620] * (-1061.710) [-1065.663] (-1066.866) (-1067.019) -- 0:00:45
304500 -- (-1063.508) [-1064.435] (-1064.567) (-1062.742) * (-1068.728) (-1065.501) [-1061.001] (-1065.126) -- 0:00:45
305000 -- (-1066.923) [-1063.198] (-1063.188) (-1064.467) * (-1070.065) (-1066.068) (-1063.518) [-1064.544] -- 0:00:45
Average standard deviation of split frequencies: 0.014838
305500 -- (-1067.375) [-1063.694] (-1064.329) (-1063.759) * (-1070.197) (-1065.443) [-1067.964] (-1063.844) -- 0:00:45
306000 -- [-1064.507] (-1064.148) (-1065.193) (-1065.764) * (-1071.705) [-1070.406] (-1067.003) (-1064.775) -- 0:00:45
306500 -- [-1063.520] (-1063.853) (-1065.034) (-1063.229) * (-1064.406) (-1064.348) (-1062.793) [-1065.147] -- 0:00:47
307000 -- (-1061.146) [-1064.123] (-1067.667) (-1066.294) * [-1064.307] (-1064.026) (-1064.662) (-1062.956) -- 0:00:47
307500 -- (-1061.703) (-1067.520) (-1068.941) [-1062.285] * (-1061.763) (-1064.021) (-1064.143) [-1063.870] -- 0:00:47
308000 -- (-1063.841) [-1065.144] (-1064.779) (-1063.962) * (-1062.563) (-1069.003) (-1067.326) [-1065.567] -- 0:00:47
308500 -- [-1062.578] (-1066.280) (-1069.154) (-1065.379) * [-1062.601] (-1069.230) (-1066.104) (-1062.689) -- 0:00:47
309000 -- [-1062.970] (-1066.269) (-1068.620) (-1070.685) * (-1067.319) (-1066.511) [-1063.809] (-1064.202) -- 0:00:46
309500 -- (-1063.834) (-1069.474) (-1066.283) [-1062.622] * (-1064.611) [-1064.762] (-1064.615) (-1064.875) -- 0:00:46
310000 -- [-1066.839] (-1065.175) (-1067.464) (-1065.541) * (-1064.963) (-1062.872) [-1062.812] (-1063.234) -- 0:00:46
Average standard deviation of split frequencies: 0.013235
310500 -- (-1065.187) (-1066.449) [-1061.556] (-1064.320) * (-1068.286) (-1064.797) [-1064.736] (-1065.273) -- 0:00:46
311000 -- (-1063.170) (-1062.730) (-1062.714) [-1061.661] * [-1065.580] (-1064.528) (-1065.956) (-1063.517) -- 0:00:46
311500 -- (-1061.656) [-1063.278] (-1063.992) (-1063.456) * (-1069.101) (-1062.598) [-1063.719] (-1062.873) -- 0:00:46
312000 -- [-1062.180] (-1063.866) (-1063.224) (-1064.695) * (-1070.181) [-1067.521] (-1066.986) (-1066.698) -- 0:00:46
312500 -- (-1061.601) [-1066.414] (-1060.822) (-1066.854) * (-1068.113) (-1064.886) [-1062.889] (-1061.416) -- 0:00:46
313000 -- [-1062.942] (-1064.669) (-1063.653) (-1064.245) * (-1063.572) [-1060.972] (-1067.560) (-1066.764) -- 0:00:46
313500 -- [-1063.491] (-1062.465) (-1060.784) (-1062.955) * (-1065.806) (-1063.320) [-1066.707] (-1065.568) -- 0:00:45
314000 -- [-1063.205] (-1065.160) (-1063.547) (-1066.118) * (-1065.024) (-1066.995) [-1066.237] (-1062.445) -- 0:00:45
314500 -- (-1061.957) (-1063.195) [-1064.172] (-1064.851) * (-1063.302) (-1066.761) (-1067.207) [-1066.516] -- 0:00:45
315000 -- (-1062.456) (-1066.122) (-1066.280) [-1063.774] * (-1060.966) (-1065.423) [-1069.400] (-1072.116) -- 0:00:45
Average standard deviation of split frequencies: 0.013177
315500 -- (-1065.483) [-1064.507] (-1064.612) (-1064.596) * (-1065.390) (-1068.671) [-1063.549] (-1068.345) -- 0:00:45
316000 -- (-1066.625) (-1066.611) (-1064.262) [-1066.083] * (-1066.235) [-1068.280] (-1065.578) (-1065.015) -- 0:00:45
316500 -- (-1064.083) (-1063.734) [-1064.283] (-1066.029) * [-1062.465] (-1061.053) (-1063.405) (-1064.376) -- 0:00:45
317000 -- [-1060.971] (-1062.560) (-1063.652) (-1065.315) * (-1062.664) [-1063.440] (-1067.410) (-1062.393) -- 0:00:45
317500 -- [-1064.199] (-1063.263) (-1061.325) (-1064.001) * [-1064.101] (-1063.717) (-1061.888) (-1067.843) -- 0:00:45
318000 -- [-1065.924] (-1064.483) (-1060.749) (-1064.152) * (-1064.672) (-1065.195) [-1063.976] (-1066.053) -- 0:00:45
318500 -- (-1064.892) (-1063.522) (-1062.021) [-1065.450] * (-1062.726) [-1063.422] (-1064.426) (-1063.512) -- 0:00:44
319000 -- [-1063.731] (-1065.544) (-1062.391) (-1065.290) * [-1063.623] (-1064.032) (-1067.067) (-1066.636) -- 0:00:44
319500 -- (-1061.747) (-1065.593) [-1062.440] (-1062.587) * (-1065.367) (-1064.488) [-1066.508] (-1064.814) -- 0:00:44
320000 -- (-1063.534) (-1068.603) (-1061.719) [-1063.455] * [-1064.373] (-1060.648) (-1061.977) (-1067.509) -- 0:00:44
Average standard deviation of split frequencies: 0.014292
320500 -- (-1063.274) (-1066.051) (-1063.982) [-1065.631] * (-1064.786) (-1063.967) [-1062.706] (-1064.581) -- 0:00:44
321000 -- (-1062.270) (-1064.364) (-1064.367) [-1062.928] * (-1065.402) (-1063.456) [-1064.191] (-1064.276) -- 0:00:44
321500 -- (-1062.349) [-1064.212] (-1063.936) (-1067.132) * (-1065.196) (-1065.766) [-1064.651] (-1064.883) -- 0:00:46
322000 -- (-1062.611) (-1061.985) [-1062.058] (-1065.744) * (-1068.428) (-1069.423) (-1065.053) [-1065.664] -- 0:00:46
322500 -- (-1061.894) [-1063.647] (-1063.174) (-1065.071) * (-1065.705) (-1066.019) (-1064.146) [-1064.739] -- 0:00:46
323000 -- (-1068.452) [-1061.736] (-1063.477) (-1065.031) * (-1064.141) [-1065.914] (-1064.022) (-1063.923) -- 0:00:46
323500 -- (-1064.584) [-1062.011] (-1065.689) (-1066.316) * (-1067.918) (-1066.359) [-1063.058] (-1064.536) -- 0:00:46
324000 -- (-1064.626) (-1061.327) (-1068.713) [-1063.145] * (-1067.472) (-1067.505) [-1062.538] (-1064.838) -- 0:00:45
324500 -- (-1063.504) (-1062.567) (-1067.004) [-1063.803] * (-1067.089) (-1062.886) [-1064.875] (-1063.241) -- 0:00:45
325000 -- (-1064.055) (-1062.481) (-1065.434) [-1062.766] * (-1066.504) (-1067.137) [-1062.986] (-1061.451) -- 0:00:45
Average standard deviation of split frequencies: 0.014917
325500 -- [-1062.022] (-1064.385) (-1069.002) (-1063.998) * (-1063.834) (-1065.934) (-1065.810) [-1065.499] -- 0:00:45
326000 -- [-1064.565] (-1063.334) (-1069.890) (-1066.016) * (-1066.169) (-1073.716) [-1066.108] (-1062.975) -- 0:00:45
326500 -- [-1063.664] (-1062.701) (-1062.971) (-1063.161) * [-1064.301] (-1064.981) (-1063.993) (-1065.317) -- 0:00:45
327000 -- (-1062.314) (-1063.456) (-1064.123) [-1063.731] * (-1063.589) [-1064.360] (-1065.935) (-1067.394) -- 0:00:45
327500 -- [-1062.496] (-1063.717) (-1062.309) (-1063.259) * [-1064.554] (-1066.956) (-1064.696) (-1062.703) -- 0:00:45
328000 -- (-1063.868) (-1065.532) [-1064.241] (-1065.945) * (-1065.405) [-1064.867] (-1067.715) (-1061.446) -- 0:00:45
328500 -- (-1064.042) (-1063.565) (-1064.733) [-1063.827] * (-1066.511) (-1063.448) (-1065.727) [-1065.091] -- 0:00:44
329000 -- (-1062.540) [-1064.962] (-1066.112) (-1063.468) * (-1067.185) [-1062.810] (-1065.804) (-1065.178) -- 0:00:44
329500 -- (-1065.526) (-1064.825) [-1065.870] (-1063.603) * (-1063.231) [-1065.311] (-1065.962) (-1065.527) -- 0:00:44
330000 -- (-1064.226) (-1066.633) (-1062.201) [-1065.173] * (-1064.388) (-1064.546) [-1067.919] (-1062.194) -- 0:00:44
Average standard deviation of split frequencies: 0.015382
330500 -- [-1066.445] (-1068.688) (-1062.032) (-1066.131) * (-1070.853) (-1063.070) [-1063.354] (-1063.937) -- 0:00:44
331000 -- (-1064.755) (-1066.915) (-1065.911) [-1061.063] * (-1069.203) [-1063.590] (-1063.986) (-1065.801) -- 0:00:44
331500 -- (-1066.577) (-1064.677) [-1066.023] (-1063.184) * (-1068.187) [-1069.906] (-1066.712) (-1063.413) -- 0:00:44
332000 -- (-1064.219) [-1063.580] (-1064.555) (-1064.961) * (-1067.207) [-1062.743] (-1064.868) (-1068.960) -- 0:00:44
332500 -- (-1065.972) [-1063.275] (-1063.299) (-1066.419) * (-1067.508) (-1066.525) [-1062.369] (-1065.250) -- 0:00:44
333000 -- (-1061.137) (-1064.831) (-1062.766) [-1063.406] * (-1066.467) [-1067.064] (-1063.461) (-1065.230) -- 0:00:44
333500 -- (-1064.461) [-1071.096] (-1063.654) (-1064.580) * (-1065.263) (-1064.951) [-1065.877] (-1064.753) -- 0:00:43
334000 -- [-1066.266] (-1063.971) (-1062.768) (-1065.365) * (-1064.578) (-1065.544) [-1064.491] (-1065.776) -- 0:00:43
334500 -- (-1063.626) (-1063.686) (-1063.100) [-1061.614] * (-1069.327) [-1065.497] (-1064.909) (-1064.326) -- 0:00:43
335000 -- [-1063.067] (-1064.906) (-1064.427) (-1064.548) * (-1069.474) (-1064.476) [-1064.881] (-1065.180) -- 0:00:43
Average standard deviation of split frequencies: 0.015211
335500 -- (-1067.965) (-1065.885) [-1062.517] (-1064.636) * (-1070.932) (-1067.545) [-1063.808] (-1066.089) -- 0:00:43
336000 -- (-1068.411) (-1068.653) (-1063.061) [-1064.383] * (-1068.456) [-1064.353] (-1064.390) (-1063.832) -- 0:00:43
336500 -- (-1070.432) [-1065.167] (-1064.728) (-1066.136) * (-1068.154) [-1066.174] (-1064.267) (-1064.805) -- 0:00:45
337000 -- [-1069.256] (-1067.832) (-1063.038) (-1063.051) * (-1062.434) (-1064.263) (-1062.494) [-1065.817] -- 0:00:45
337500 -- (-1062.049) (-1065.365) [-1060.993] (-1064.198) * [-1063.800] (-1066.090) (-1062.869) (-1063.804) -- 0:00:45
338000 -- (-1063.907) (-1062.567) (-1065.137) [-1064.904] * (-1065.532) (-1063.933) (-1063.438) [-1066.160] -- 0:00:45
338500 -- (-1063.528) (-1064.630) [-1062.481] (-1067.620) * (-1066.086) [-1064.974] (-1062.925) (-1064.179) -- 0:00:44
339000 -- (-1061.177) (-1068.448) (-1064.052) [-1063.096] * (-1067.203) (-1064.694) (-1062.313) [-1062.146] -- 0:00:44
339500 -- (-1064.989) (-1066.140) (-1064.819) [-1063.630] * [-1069.671] (-1065.529) (-1062.930) (-1064.480) -- 0:00:44
340000 -- (-1066.659) [-1066.037] (-1064.386) (-1063.823) * (-1064.917) (-1062.991) [-1065.714] (-1060.938) -- 0:00:44
Average standard deviation of split frequencies: 0.015068
340500 -- (-1064.855) [-1065.213] (-1066.117) (-1067.439) * (-1062.578) [-1061.829] (-1065.576) (-1063.276) -- 0:00:44
341000 -- (-1067.867) (-1067.549) (-1065.310) [-1067.392] * [-1062.029] (-1064.628) (-1061.562) (-1070.255) -- 0:00:44
341500 -- (-1067.452) [-1065.095] (-1065.090) (-1065.116) * [-1064.448] (-1065.811) (-1066.287) (-1065.420) -- 0:00:44
342000 -- (-1066.499) (-1066.738) (-1066.739) [-1063.369] * [-1064.539] (-1064.241) (-1062.284) (-1063.617) -- 0:00:44
342500 -- (-1062.740) [-1065.784] (-1064.744) (-1064.142) * (-1066.569) [-1063.713] (-1064.882) (-1063.545) -- 0:00:44
343000 -- (-1061.679) (-1067.306) (-1062.864) [-1063.752] * (-1065.769) (-1064.453) (-1064.503) [-1064.409] -- 0:00:44
343500 -- [-1063.686] (-1069.438) (-1063.129) (-1064.470) * (-1065.155) (-1067.004) (-1064.882) [-1063.457] -- 0:00:43
344000 -- [-1064.946] (-1064.924) (-1062.421) (-1065.288) * (-1067.391) (-1065.518) [-1065.757] (-1064.547) -- 0:00:43
344500 -- (-1070.604) (-1067.315) [-1066.961] (-1066.138) * (-1066.014) (-1062.742) (-1064.164) [-1063.695] -- 0:00:43
345000 -- [-1063.282] (-1062.683) (-1063.786) (-1064.373) * (-1064.719) (-1064.425) [-1064.271] (-1061.438) -- 0:00:43
Average standard deviation of split frequencies: 0.014772
345500 -- (-1067.476) (-1061.994) (-1065.217) [-1064.783] * [-1064.866] (-1063.687) (-1065.559) (-1063.803) -- 0:00:43
346000 -- [-1064.360] (-1063.195) (-1066.066) (-1067.252) * (-1065.618) (-1063.599) (-1065.796) [-1063.554] -- 0:00:43
346500 -- (-1063.740) (-1067.119) (-1066.729) [-1065.367] * (-1068.910) (-1065.324) (-1063.388) [-1062.306] -- 0:00:43
347000 -- (-1064.831) (-1064.473) [-1065.753] (-1065.526) * (-1062.546) (-1064.653) (-1062.992) [-1064.153] -- 0:00:43
347500 -- [-1064.311] (-1062.132) (-1065.309) (-1066.199) * (-1069.027) (-1068.066) (-1062.616) [-1063.353] -- 0:00:43
348000 -- (-1063.041) (-1064.069) (-1062.855) [-1064.727] * (-1068.703) (-1069.681) [-1064.561] (-1064.364) -- 0:00:43
348500 -- (-1064.046) (-1064.645) (-1066.261) [-1063.546] * [-1064.264] (-1067.217) (-1061.527) (-1068.311) -- 0:00:42
349000 -- [-1064.608] (-1063.621) (-1063.753) (-1064.901) * [-1062.361] (-1067.253) (-1063.561) (-1064.033) -- 0:00:42
349500 -- (-1064.815) (-1065.253) [-1061.926] (-1068.562) * (-1061.675) [-1062.786] (-1061.849) (-1064.595) -- 0:00:42
350000 -- [-1066.979] (-1064.603) (-1064.167) (-1065.339) * (-1067.277) [-1065.256] (-1065.088) (-1065.587) -- 0:00:42
Average standard deviation of split frequencies: 0.015161
350500 -- (-1067.942) (-1064.958) [-1064.955] (-1065.379) * (-1068.823) [-1061.818] (-1063.680) (-1062.137) -- 0:00:42
351000 -- [-1065.893] (-1064.665) (-1063.988) (-1064.825) * (-1064.679) [-1062.068] (-1062.561) (-1063.159) -- 0:00:42
351500 -- (-1062.751) [-1064.183] (-1066.035) (-1063.419) * (-1069.413) (-1062.894) (-1063.161) [-1065.040] -- 0:00:44
352000 -- (-1066.160) (-1064.253) (-1065.298) [-1064.905] * (-1067.190) (-1064.809) [-1067.960] (-1065.571) -- 0:00:44
352500 -- (-1063.282) (-1065.475) (-1066.454) [-1062.058] * (-1063.583) [-1063.213] (-1064.993) (-1064.343) -- 0:00:44
353000 -- (-1063.348) (-1067.613) [-1062.611] (-1063.403) * (-1067.335) [-1063.032] (-1068.606) (-1063.617) -- 0:00:43
353500 -- (-1069.044) (-1068.470) [-1063.773] (-1069.040) * (-1066.717) [-1063.153] (-1067.102) (-1065.563) -- 0:00:43
354000 -- (-1065.528) (-1065.305) [-1062.500] (-1068.562) * (-1062.728) [-1063.428] (-1063.489) (-1066.023) -- 0:00:43
354500 -- (-1069.410) (-1065.717) (-1065.574) [-1064.445] * [-1065.249] (-1061.434) (-1064.290) (-1065.032) -- 0:00:43
355000 -- [-1064.097] (-1066.126) (-1063.018) (-1064.971) * (-1065.125) (-1069.016) [-1067.844] (-1064.384) -- 0:00:43
Average standard deviation of split frequencies: 0.013943
355500 -- (-1064.569) (-1063.614) (-1066.411) [-1068.749] * (-1061.416) [-1062.662] (-1063.929) (-1063.330) -- 0:00:43
356000 -- [-1064.067] (-1065.136) (-1065.684) (-1065.878) * (-1063.161) (-1063.490) (-1065.070) [-1064.136] -- 0:00:43
356500 -- (-1063.956) [-1064.426] (-1065.235) (-1066.827) * (-1065.680) [-1066.291] (-1065.742) (-1065.186) -- 0:00:43
357000 -- (-1064.900) (-1066.224) [-1068.555] (-1063.972) * (-1065.628) (-1061.547) (-1065.669) [-1062.258] -- 0:00:43
357500 -- (-1064.777) (-1062.496) [-1067.439] (-1066.691) * [-1063.980] (-1063.266) (-1064.892) (-1063.257) -- 0:00:43
358000 -- [-1063.510] (-1061.809) (-1065.180) (-1066.712) * [-1061.824] (-1063.105) (-1063.941) (-1065.945) -- 0:00:43
358500 -- (-1065.016) (-1069.275) [-1062.088] (-1063.937) * [-1064.894] (-1064.234) (-1066.890) (-1066.187) -- 0:00:42
359000 -- (-1062.160) (-1066.732) [-1063.227] (-1064.248) * (-1063.667) (-1061.457) [-1065.596] (-1063.525) -- 0:00:42
359500 -- (-1063.127) [-1064.269] (-1062.131) (-1063.937) * (-1063.657) (-1064.705) [-1065.264] (-1063.039) -- 0:00:42
360000 -- (-1062.915) (-1061.768) (-1062.563) [-1067.375] * [-1063.803] (-1065.764) (-1065.126) (-1062.851) -- 0:00:42
Average standard deviation of split frequencies: 0.013609
360500 -- (-1068.870) [-1063.944] (-1063.929) (-1066.020) * (-1068.080) (-1069.657) [-1062.803] (-1072.040) -- 0:00:42
361000 -- (-1067.193) (-1063.241) [-1063.685] (-1063.892) * (-1069.343) (-1065.052) (-1064.822) [-1066.628] -- 0:00:42
361500 -- (-1065.003) [-1066.861] (-1062.275) (-1064.323) * (-1068.143) (-1064.247) [-1063.801] (-1064.897) -- 0:00:42
362000 -- [-1064.222] (-1061.393) (-1061.802) (-1067.012) * (-1067.418) (-1064.342) (-1066.259) [-1067.858] -- 0:00:42
362500 -- (-1062.983) (-1064.196) (-1063.069) [-1063.653] * (-1066.372) [-1063.931] (-1064.909) (-1071.672) -- 0:00:42
363000 -- (-1063.419) (-1065.837) (-1063.774) [-1063.753] * (-1068.589) (-1065.658) (-1064.938) [-1064.355] -- 0:00:42
363500 -- (-1064.664) (-1063.290) (-1062.207) [-1063.502] * (-1063.963) (-1064.235) (-1062.991) [-1064.409] -- 0:00:42
364000 -- (-1063.818) (-1066.591) (-1063.046) [-1063.014] * (-1064.361) [-1063.726] (-1064.006) (-1067.481) -- 0:00:41
364500 -- (-1064.119) [-1062.769] (-1064.741) (-1062.220) * (-1063.460) [-1061.349] (-1065.073) (-1064.188) -- 0:00:41
365000 -- (-1065.026) (-1063.110) (-1064.451) [-1062.277] * (-1066.709) (-1064.811) (-1062.544) [-1067.119] -- 0:00:41
Average standard deviation of split frequencies: 0.012594
365500 -- (-1066.731) (-1068.215) (-1063.396) [-1062.130] * (-1066.816) [-1062.998] (-1068.203) (-1064.605) -- 0:00:41
366000 -- (-1065.364) (-1068.532) (-1066.854) [-1061.384] * (-1065.696) [-1062.714] (-1066.731) (-1065.841) -- 0:00:41
366500 -- (-1064.272) (-1066.164) (-1066.368) [-1065.981] * (-1064.060) (-1064.763) [-1064.733] (-1066.865) -- 0:00:41
367000 -- (-1063.126) (-1064.626) [-1070.836] (-1069.136) * [-1064.101] (-1067.623) (-1067.655) (-1065.924) -- 0:00:43
367500 -- (-1065.664) (-1064.477) [-1066.347] (-1064.036) * (-1065.382) [-1064.521] (-1066.445) (-1065.145) -- 0:00:43
368000 -- (-1065.465) (-1063.733) (-1067.759) [-1064.819] * (-1064.386) (-1065.113) (-1071.442) [-1065.290] -- 0:00:42
368500 -- (-1065.183) [-1063.907] (-1071.086) (-1064.802) * (-1064.085) (-1066.847) [-1067.027] (-1064.448) -- 0:00:42
369000 -- (-1064.881) (-1065.261) (-1065.576) [-1061.633] * (-1064.285) (-1061.224) (-1064.473) [-1067.282] -- 0:00:42
369500 -- (-1062.783) (-1064.947) (-1062.535) [-1062.321] * (-1064.467) [-1063.611] (-1065.498) (-1065.829) -- 0:00:42
370000 -- [-1062.322] (-1064.850) (-1062.631) (-1062.650) * (-1064.400) [-1062.962] (-1069.746) (-1068.537) -- 0:00:42
Average standard deviation of split frequencies: 0.011970
370500 -- (-1065.080) (-1065.032) [-1063.676] (-1064.394) * [-1064.006] (-1065.423) (-1064.708) (-1064.838) -- 0:00:42
371000 -- [-1064.536] (-1062.900) (-1062.965) (-1065.818) * (-1066.605) (-1065.937) [-1065.681] (-1063.781) -- 0:00:42
371500 -- [-1061.136] (-1063.841) (-1061.981) (-1065.025) * (-1066.373) [-1062.381] (-1063.983) (-1065.020) -- 0:00:42
372000 -- [-1062.943] (-1062.587) (-1062.862) (-1066.947) * (-1071.491) (-1061.877) [-1063.364] (-1067.855) -- 0:00:42
372500 -- (-1064.952) [-1062.601] (-1067.625) (-1064.533) * [-1066.247] (-1064.880) (-1065.063) (-1064.747) -- 0:00:42
373000 -- (-1064.396) (-1063.832) (-1070.385) [-1064.360] * (-1064.194) (-1062.332) [-1062.362] (-1071.665) -- 0:00:42
373500 -- (-1065.536) [-1062.175] (-1067.190) (-1064.616) * [-1063.514] (-1062.426) (-1063.254) (-1068.823) -- 0:00:41
374000 -- [-1068.618] (-1070.420) (-1063.472) (-1065.929) * (-1064.303) [-1063.413] (-1067.777) (-1065.406) -- 0:00:41
374500 -- (-1064.362) (-1064.071) [-1062.203] (-1064.436) * (-1063.031) (-1065.405) [-1063.833] (-1067.545) -- 0:00:41
375000 -- (-1063.467) (-1064.549) [-1063.254] (-1064.746) * (-1061.227) (-1066.236) (-1065.187) [-1062.649] -- 0:00:41
Average standard deviation of split frequencies: 0.012242
375500 -- (-1066.615) [-1063.593] (-1065.772) (-1064.915) * (-1063.118) [-1065.566] (-1061.770) (-1064.686) -- 0:00:41
376000 -- [-1065.015] (-1065.634) (-1065.449) (-1068.288) * (-1063.907) (-1064.602) [-1063.879] (-1069.346) -- 0:00:41
376500 -- [-1061.425] (-1064.842) (-1065.879) (-1066.767) * [-1064.261] (-1065.578) (-1064.319) (-1065.998) -- 0:00:41
377000 -- (-1066.033) [-1064.276] (-1064.333) (-1064.900) * (-1063.734) (-1062.901) (-1064.010) [-1065.500] -- 0:00:41
377500 -- (-1066.035) (-1064.590) (-1062.378) [-1063.858] * [-1065.947] (-1062.105) (-1069.190) (-1064.718) -- 0:00:41
378000 -- (-1064.747) (-1068.326) [-1063.323] (-1062.624) * (-1069.576) (-1064.362) (-1065.219) [-1065.705] -- 0:00:41
378500 -- (-1062.288) (-1066.797) (-1063.144) [-1065.190] * (-1064.709) (-1068.469) [-1064.437] (-1063.901) -- 0:00:41
379000 -- (-1062.351) [-1064.732] (-1063.021) (-1063.927) * (-1064.858) (-1064.842) (-1065.214) [-1064.418] -- 0:00:40
379500 -- [-1064.981] (-1064.904) (-1064.799) (-1064.041) * [-1064.880] (-1064.661) (-1063.312) (-1069.778) -- 0:00:40
380000 -- (-1067.217) (-1063.133) [-1065.819] (-1067.838) * (-1063.584) [-1063.981] (-1064.910) (-1063.840) -- 0:00:40
Average standard deviation of split frequencies: 0.011582
380500 -- (-1062.996) (-1062.799) (-1062.912) [-1066.825] * (-1068.009) (-1062.743) [-1064.131] (-1064.565) -- 0:00:40
381000 -- (-1069.370) (-1063.068) (-1064.406) [-1070.587] * (-1061.815) (-1061.246) (-1068.551) [-1065.376] -- 0:00:40
381500 -- (-1064.946) [-1062.647] (-1064.211) (-1068.749) * [-1062.660] (-1064.762) (-1062.933) (-1065.526) -- 0:00:40
382000 -- [-1066.690] (-1064.056) (-1066.524) (-1064.797) * (-1065.174) [-1062.126] (-1063.662) (-1063.808) -- 0:00:42
382500 -- [-1063.211] (-1062.598) (-1064.680) (-1065.361) * [-1064.876] (-1067.624) (-1064.346) (-1064.460) -- 0:00:41
383000 -- [-1065.914] (-1062.936) (-1063.513) (-1065.672) * (-1063.555) [-1063.823] (-1062.089) (-1065.004) -- 0:00:41
383500 -- (-1062.134) (-1061.816) [-1062.953] (-1066.091) * (-1063.123) (-1062.320) (-1065.016) [-1063.669] -- 0:00:41
384000 -- [-1063.127] (-1063.386) (-1065.056) (-1068.310) * (-1064.855) (-1068.198) (-1066.326) [-1066.743] -- 0:00:41
384500 -- [-1061.837] (-1065.698) (-1065.072) (-1065.978) * (-1061.449) (-1065.135) (-1062.320) [-1065.380] -- 0:00:41
385000 -- [-1062.393] (-1064.189) (-1063.795) (-1067.771) * [-1062.740] (-1064.570) (-1069.010) (-1063.951) -- 0:00:41
Average standard deviation of split frequencies: 0.010533
385500 -- (-1062.935) (-1064.040) (-1067.698) [-1066.979] * (-1063.602) [-1062.734] (-1063.726) (-1064.362) -- 0:00:41
386000 -- [-1064.405] (-1064.254) (-1064.554) (-1066.513) * (-1065.882) [-1062.884] (-1065.337) (-1068.427) -- 0:00:41
386500 -- (-1065.618) [-1061.719] (-1065.655) (-1068.606) * [-1065.938] (-1064.136) (-1063.113) (-1066.618) -- 0:00:41
387000 -- (-1065.500) (-1066.085) [-1062.067] (-1065.094) * (-1068.166) (-1063.509) [-1061.950] (-1066.949) -- 0:00:41
387500 -- [-1063.212] (-1063.457) (-1065.478) (-1065.661) * (-1064.184) (-1064.015) (-1062.241) [-1064.780] -- 0:00:41
388000 -- [-1062.164] (-1064.047) (-1064.298) (-1069.078) * (-1066.581) (-1066.106) (-1060.403) [-1064.050] -- 0:00:41
388500 -- (-1063.520) (-1062.878) (-1064.196) [-1063.524] * (-1063.691) (-1067.324) (-1063.493) [-1063.154] -- 0:00:40
389000 -- (-1065.098) (-1065.775) (-1062.070) [-1066.908] * (-1066.656) [-1066.975] (-1063.962) (-1066.222) -- 0:00:40
389500 -- (-1062.054) (-1067.651) [-1062.078] (-1065.110) * [-1064.396] (-1064.018) (-1064.120) (-1064.507) -- 0:00:40
390000 -- [-1062.273] (-1065.727) (-1062.832) (-1065.163) * [-1066.103] (-1067.906) (-1061.782) (-1069.287) -- 0:00:40
Average standard deviation of split frequencies: 0.010030
390500 -- (-1063.919) (-1070.368) [-1061.926] (-1066.188) * (-1063.556) (-1065.961) (-1068.178) [-1062.076] -- 0:00:40
391000 -- (-1063.232) (-1065.563) [-1061.553] (-1063.490) * (-1067.172) (-1065.847) (-1068.666) [-1066.142] -- 0:00:40
391500 -- (-1065.042) [-1065.993] (-1065.291) (-1064.767) * (-1065.986) (-1065.150) [-1063.612] (-1067.534) -- 0:00:40
392000 -- (-1065.678) (-1064.240) (-1062.946) [-1062.643] * (-1063.344) [-1062.339] (-1064.071) (-1065.222) -- 0:00:40
392500 -- (-1063.744) (-1067.083) [-1062.087] (-1061.773) * (-1062.516) (-1064.677) [-1065.438] (-1063.830) -- 0:00:40
393000 -- [-1065.442] (-1066.948) (-1062.499) (-1064.058) * (-1066.594) [-1065.360] (-1066.296) (-1064.242) -- 0:00:40
393500 -- (-1064.509) (-1067.724) (-1061.636) [-1064.263] * (-1063.025) (-1063.374) [-1066.991] (-1064.497) -- 0:00:40
394000 -- (-1063.001) (-1065.779) [-1064.722] (-1067.782) * [-1062.907] (-1065.338) (-1063.323) (-1064.752) -- 0:00:39
394500 -- (-1064.113) (-1065.012) [-1064.376] (-1067.689) * [-1061.869] (-1065.353) (-1065.866) (-1064.206) -- 0:00:39
395000 -- [-1063.083] (-1067.772) (-1063.916) (-1067.890) * (-1064.327) (-1066.892) [-1062.272] (-1065.831) -- 0:00:39
Average standard deviation of split frequencies: 0.010193
395500 -- (-1064.242) (-1064.578) [-1063.919] (-1064.205) * (-1062.419) (-1068.650) [-1067.635] (-1065.982) -- 0:00:39
396000 -- (-1063.471) (-1062.263) (-1062.946) [-1064.431] * (-1063.156) (-1064.072) (-1064.502) [-1061.922] -- 0:00:39
396500 -- (-1067.632) [-1063.865] (-1063.175) (-1063.806) * (-1064.516) [-1065.799] (-1064.540) (-1064.071) -- 0:00:39
397000 -- (-1065.658) [-1064.378] (-1063.124) (-1066.023) * (-1062.628) (-1065.060) (-1063.993) [-1064.134] -- 0:00:41
397500 -- (-1065.478) [-1064.728] (-1062.488) (-1067.059) * (-1063.732) (-1065.059) [-1063.212] (-1065.962) -- 0:00:40
398000 -- (-1064.908) [-1065.400] (-1068.181) (-1069.339) * (-1065.945) (-1069.501) [-1063.506] (-1068.464) -- 0:00:40
398500 -- [-1063.059] (-1066.847) (-1065.707) (-1075.141) * [-1062.383] (-1063.717) (-1064.471) (-1068.735) -- 0:00:40
399000 -- (-1065.033) (-1066.213) (-1065.116) [-1061.747] * (-1063.765) [-1063.862] (-1062.995) (-1067.267) -- 0:00:40
399500 -- [-1065.210] (-1065.325) (-1063.938) (-1063.471) * [-1064.377] (-1066.366) (-1065.577) (-1066.511) -- 0:00:40
400000 -- (-1063.786) (-1066.115) [-1064.844] (-1064.317) * [-1065.147] (-1066.413) (-1064.237) (-1065.363) -- 0:00:40
Average standard deviation of split frequencies: 0.011030
400500 -- (-1066.582) [-1064.834] (-1064.217) (-1061.279) * (-1062.972) [-1063.964] (-1066.683) (-1064.808) -- 0:00:40
401000 -- [-1066.123] (-1067.939) (-1064.824) (-1062.686) * (-1066.148) (-1064.280) (-1071.547) [-1067.214] -- 0:00:40
401500 -- (-1071.921) (-1069.776) [-1066.426] (-1062.493) * (-1063.382) (-1064.280) [-1066.567] (-1064.338) -- 0:00:40
402000 -- [-1065.498] (-1071.004) (-1065.420) (-1063.747) * (-1063.881) (-1062.486) (-1066.499) [-1065.633] -- 0:00:40
402500 -- [-1063.430] (-1067.575) (-1065.033) (-1066.334) * [-1065.018] (-1067.070) (-1061.955) (-1063.836) -- 0:00:40
403000 -- (-1063.732) (-1061.615) [-1063.493] (-1065.633) * (-1063.878) (-1066.701) [-1061.255] (-1064.523) -- 0:00:39
403500 -- [-1064.781] (-1061.904) (-1064.654) (-1065.990) * (-1065.972) (-1065.418) [-1060.659] (-1066.534) -- 0:00:39
404000 -- (-1064.350) [-1062.432] (-1063.926) (-1066.138) * [-1066.683] (-1064.943) (-1061.486) (-1066.243) -- 0:00:39
404500 -- (-1063.970) [-1071.012] (-1066.192) (-1064.782) * (-1066.138) (-1062.723) (-1065.853) [-1065.019] -- 0:00:39
405000 -- [-1065.807] (-1066.388) (-1068.289) (-1064.747) * (-1070.648) (-1065.056) [-1065.393] (-1065.093) -- 0:00:39
Average standard deviation of split frequencies: 0.012021
405500 -- (-1064.810) (-1067.221) (-1064.203) [-1064.106] * (-1064.939) (-1066.130) [-1064.496] (-1063.891) -- 0:00:39
406000 -- (-1068.068) (-1065.780) [-1062.530] (-1061.907) * (-1065.288) (-1067.216) [-1065.330] (-1063.083) -- 0:00:39
406500 -- (-1066.608) (-1064.733) [-1062.797] (-1061.806) * [-1064.237] (-1062.626) (-1068.040) (-1064.653) -- 0:00:39
407000 -- (-1063.265) (-1067.616) [-1063.515] (-1066.680) * (-1065.001) (-1065.053) (-1064.460) [-1064.193] -- 0:00:39
407500 -- (-1063.631) (-1065.472) [-1066.687] (-1064.875) * (-1062.553) (-1066.991) (-1064.960) [-1064.515] -- 0:00:39
408000 -- (-1063.592) (-1064.672) [-1062.176] (-1065.077) * (-1065.237) [-1063.277] (-1066.785) (-1063.398) -- 0:00:39
408500 -- [-1064.245] (-1065.054) (-1064.249) (-1065.219) * (-1065.708) (-1064.591) [-1064.813] (-1063.341) -- 0:00:39
409000 -- [-1063.050] (-1068.108) (-1063.505) (-1064.278) * (-1063.786) (-1068.187) [-1062.000] (-1061.380) -- 0:00:39
409500 -- (-1063.868) (-1067.983) (-1064.152) [-1065.656] * (-1063.564) [-1066.097] (-1063.173) (-1063.918) -- 0:00:38
410000 -- [-1061.663] (-1067.205) (-1063.259) (-1064.969) * [-1067.734] (-1070.632) (-1065.506) (-1063.712) -- 0:00:38
Average standard deviation of split frequencies: 0.010762
410500 -- (-1065.208) (-1064.579) (-1067.479) [-1064.010] * (-1064.728) [-1065.820] (-1065.039) (-1064.780) -- 0:00:38
411000 -- (-1067.262) (-1065.695) [-1064.252] (-1066.338) * (-1065.340) (-1068.009) (-1063.329) [-1063.346] -- 0:00:38
411500 -- (-1065.001) (-1065.403) (-1065.637) [-1067.490] * (-1063.504) (-1068.294) (-1064.309) [-1061.458] -- 0:00:38
412000 -- (-1067.948) (-1067.277) (-1063.179) [-1064.343] * (-1064.865) (-1066.532) (-1064.012) [-1062.303] -- 0:00:39
412500 -- (-1068.002) (-1064.837) (-1067.633) [-1065.608] * (-1064.485) (-1063.431) (-1063.983) [-1065.490] -- 0:00:39
413000 -- (-1068.189) (-1065.255) (-1063.082) [-1063.835] * (-1063.138) [-1064.117] (-1063.758) (-1068.061) -- 0:00:39
413500 -- (-1066.611) (-1065.251) [-1066.694] (-1062.529) * (-1063.354) [-1061.504] (-1069.581) (-1073.463) -- 0:00:39
414000 -- [-1065.162] (-1063.350) (-1064.755) (-1062.836) * [-1063.648] (-1063.393) (-1064.959) (-1065.803) -- 0:00:39
414500 -- (-1065.148) (-1065.550) [-1065.888] (-1061.720) * [-1062.112] (-1063.526) (-1066.564) (-1065.434) -- 0:00:39
415000 -- [-1062.857] (-1066.302) (-1066.609) (-1062.244) * (-1061.823) [-1064.557] (-1063.735) (-1063.185) -- 0:00:39
Average standard deviation of split frequencies: 0.011598
415500 -- (-1064.414) [-1062.398] (-1067.044) (-1060.466) * (-1063.130) (-1064.160) (-1064.511) [-1063.226] -- 0:00:39
416000 -- (-1064.645) [-1062.936] (-1066.858) (-1065.297) * (-1065.163) (-1062.158) (-1063.993) [-1064.100] -- 0:00:39
416500 -- (-1064.999) [-1065.535] (-1064.887) (-1064.875) * (-1063.406) [-1061.914] (-1067.727) (-1064.757) -- 0:00:39
417000 -- (-1068.280) (-1063.812) [-1065.161] (-1062.740) * (-1060.601) (-1064.182) [-1065.960] (-1062.990) -- 0:00:39
417500 -- (-1063.799) (-1063.414) (-1068.384) [-1065.211] * [-1061.131] (-1066.053) (-1067.314) (-1065.074) -- 0:00:39
418000 -- (-1064.747) (-1068.223) (-1065.282) [-1067.786] * (-1066.075) [-1063.259] (-1063.990) (-1063.420) -- 0:00:38
418500 -- [-1063.939] (-1064.575) (-1062.751) (-1065.218) * (-1064.074) (-1065.464) (-1064.173) [-1063.810] -- 0:00:38
419000 -- (-1066.003) (-1066.515) (-1065.320) [-1063.555] * (-1063.733) (-1065.607) (-1063.925) [-1063.381] -- 0:00:38
419500 -- (-1062.685) (-1063.744) (-1063.435) [-1062.449] * (-1064.404) (-1064.168) [-1064.194] (-1063.695) -- 0:00:38
420000 -- (-1065.111) [-1064.924] (-1068.732) (-1061.744) * (-1062.742) (-1064.739) [-1065.411] (-1062.727) -- 0:00:38
Average standard deviation of split frequencies: 0.011733
420500 -- (-1063.994) [-1067.366] (-1064.693) (-1062.835) * [-1062.836] (-1067.223) (-1066.180) (-1065.240) -- 0:00:38
421000 -- [-1062.698] (-1063.495) (-1063.503) (-1066.000) * (-1061.659) (-1066.213) [-1067.325] (-1066.214) -- 0:00:38
421500 -- [-1062.711] (-1061.953) (-1063.921) (-1062.601) * (-1063.593) (-1065.566) [-1063.395] (-1067.688) -- 0:00:38
422000 -- [-1062.823] (-1065.186) (-1062.156) (-1063.211) * (-1062.142) [-1062.803] (-1062.846) (-1063.241) -- 0:00:38
422500 -- [-1061.251] (-1065.433) (-1062.701) (-1065.833) * [-1063.443] (-1066.637) (-1061.963) (-1064.451) -- 0:00:38
423000 -- [-1063.813] (-1066.529) (-1064.733) (-1064.320) * [-1063.223] (-1063.593) (-1062.709) (-1063.775) -- 0:00:38
423500 -- (-1063.128) [-1062.278] (-1064.119) (-1064.599) * [-1061.593] (-1061.758) (-1061.384) (-1064.122) -- 0:00:38
424000 -- [-1063.655] (-1063.886) (-1066.943) (-1062.561) * [-1063.517] (-1066.805) (-1061.321) (-1062.415) -- 0:00:38
424500 -- (-1063.614) (-1063.866) (-1064.054) [-1062.443] * [-1062.781] (-1062.795) (-1062.890) (-1065.624) -- 0:00:37
425000 -- (-1065.601) [-1064.125] (-1062.615) (-1065.722) * (-1061.883) (-1063.672) (-1067.060) [-1062.552] -- 0:00:37
Average standard deviation of split frequencies: 0.011131
425500 -- (-1063.784) (-1069.406) [-1063.907] (-1066.244) * (-1063.118) (-1063.949) [-1061.972] (-1066.355) -- 0:00:37
426000 -- (-1063.284) (-1067.215) (-1066.582) [-1062.222] * (-1066.069) [-1065.223] (-1064.146) (-1066.474) -- 0:00:37
426500 -- (-1065.758) (-1065.617) [-1064.154] (-1067.692) * (-1064.184) (-1064.532) [-1064.753] (-1064.283) -- 0:00:37
427000 -- (-1065.792) [-1064.731] (-1065.059) (-1067.809) * (-1062.887) [-1062.231] (-1062.484) (-1064.186) -- 0:00:38
427500 -- (-1062.967) [-1066.315] (-1066.889) (-1065.300) * (-1063.765) (-1064.430) [-1061.956] (-1062.714) -- 0:00:38
428000 -- (-1065.858) [-1066.435] (-1066.083) (-1065.151) * [-1065.350] (-1064.242) (-1063.038) (-1063.276) -- 0:00:38
428500 -- [-1064.847] (-1066.474) (-1062.630) (-1065.868) * [-1065.020] (-1063.819) (-1069.918) (-1065.252) -- 0:00:38
429000 -- (-1065.532) (-1064.174) (-1065.917) [-1064.899] * [-1064.245] (-1064.511) (-1066.306) (-1064.883) -- 0:00:38
429500 -- (-1062.125) [-1068.495] (-1065.702) (-1065.048) * (-1063.711) [-1067.028] (-1063.308) (-1065.657) -- 0:00:38
430000 -- (-1060.369) (-1065.434) [-1063.300] (-1065.093) * (-1064.337) [-1064.629] (-1066.759) (-1063.743) -- 0:00:38
Average standard deviation of split frequencies: 0.011397
430500 -- (-1061.984) [-1064.759] (-1065.026) (-1064.741) * [-1062.392] (-1062.399) (-1065.252) (-1064.727) -- 0:00:38
431000 -- (-1066.465) (-1061.919) (-1063.563) [-1063.704] * (-1062.056) [-1065.135] (-1065.477) (-1064.568) -- 0:00:38
431500 -- (-1066.532) (-1062.310) [-1065.492] (-1063.720) * (-1061.775) (-1065.621) (-1064.097) [-1063.549] -- 0:00:38
432000 -- [-1064.012] (-1066.162) (-1065.440) (-1065.133) * [-1061.695] (-1063.950) (-1064.470) (-1065.431) -- 0:00:38
432500 -- (-1067.955) (-1064.998) [-1066.076] (-1066.782) * (-1061.667) (-1065.377) (-1063.372) [-1062.897] -- 0:00:38
433000 -- (-1064.457) (-1063.712) [-1066.454] (-1061.396) * [-1062.248] (-1066.966) (-1065.577) (-1067.282) -- 0:00:37
433500 -- (-1064.307) (-1067.594) (-1068.093) [-1064.299] * (-1064.735) (-1064.533) [-1064.581] (-1065.920) -- 0:00:37
434000 -- (-1065.778) [-1067.416] (-1067.295) (-1062.898) * (-1065.390) [-1062.637] (-1063.493) (-1065.385) -- 0:00:37
434500 -- (-1065.377) (-1065.641) [-1066.112] (-1063.476) * (-1065.343) (-1062.792) [-1064.303] (-1066.371) -- 0:00:37
435000 -- (-1066.951) (-1066.664) (-1066.788) [-1064.200] * (-1064.899) [-1063.739] (-1064.631) (-1062.757) -- 0:00:37
Average standard deviation of split frequencies: 0.011413
435500 -- (-1064.162) (-1065.374) [-1064.342] (-1063.888) * (-1067.755) (-1066.389) [-1062.208] (-1062.189) -- 0:00:37
436000 -- (-1064.370) [-1066.968] (-1065.827) (-1064.782) * [-1069.025] (-1065.554) (-1063.337) (-1061.270) -- 0:00:37
436500 -- (-1062.305) (-1068.895) [-1066.523] (-1067.001) * (-1064.820) (-1063.633) [-1065.246] (-1066.562) -- 0:00:37
437000 -- (-1062.300) [-1068.080] (-1065.756) (-1069.818) * [-1062.500] (-1061.059) (-1063.363) (-1063.394) -- 0:00:37
437500 -- [-1063.310] (-1066.101) (-1066.827) (-1067.445) * [-1062.215] (-1066.346) (-1065.385) (-1065.922) -- 0:00:37
438000 -- (-1065.450) [-1063.797] (-1064.865) (-1068.177) * (-1069.460) (-1063.909) [-1064.279] (-1061.976) -- 0:00:37
438500 -- (-1066.584) [-1062.978] (-1063.294) (-1067.812) * (-1063.867) (-1061.036) (-1067.049) [-1064.926] -- 0:00:37
439000 -- [-1064.143] (-1063.231) (-1064.443) (-1066.096) * (-1067.937) (-1064.981) (-1066.791) [-1061.704] -- 0:00:37
439500 -- [-1064.356] (-1064.243) (-1065.229) (-1064.781) * (-1066.435) [-1064.253] (-1062.122) (-1064.260) -- 0:00:36
440000 -- [-1063.021] (-1063.942) (-1065.177) (-1067.240) * (-1063.830) (-1063.589) [-1065.484] (-1066.593) -- 0:00:36
Average standard deviation of split frequencies: 0.010995
440500 -- [-1061.854] (-1066.471) (-1064.422) (-1065.735) * (-1064.125) [-1063.063] (-1064.057) (-1066.550) -- 0:00:36
441000 -- (-1066.055) (-1067.973) (-1070.615) [-1062.756] * [-1065.972] (-1065.601) (-1064.066) (-1065.819) -- 0:00:36
441500 -- [-1062.808] (-1069.159) (-1072.781) (-1064.343) * [-1063.177] (-1062.268) (-1065.425) (-1068.722) -- 0:00:36
442000 -- (-1063.964) [-1062.361] (-1067.643) (-1067.931) * (-1062.898) (-1065.800) (-1063.416) [-1068.759] -- 0:00:37
442500 -- (-1064.886) [-1065.547] (-1067.448) (-1066.862) * (-1066.782) (-1065.317) [-1062.699] (-1064.028) -- 0:00:37
443000 -- (-1063.054) [-1065.297] (-1064.796) (-1070.009) * (-1064.743) (-1062.221) [-1063.560] (-1065.148) -- 0:00:37
443500 -- (-1063.814) (-1061.458) (-1070.664) [-1063.623] * (-1064.538) [-1064.547] (-1066.690) (-1068.287) -- 0:00:37
444000 -- (-1063.829) [-1063.786] (-1066.890) (-1063.474) * [-1062.445] (-1066.244) (-1062.077) (-1064.620) -- 0:00:37
444500 -- (-1062.385) (-1068.664) (-1066.626) [-1064.930] * (-1061.742) (-1064.232) (-1064.041) [-1065.861] -- 0:00:37
445000 -- (-1062.599) [-1064.654] (-1066.061) (-1066.536) * (-1064.352) [-1063.044] (-1062.387) (-1064.248) -- 0:00:37
Average standard deviation of split frequencies: 0.010393
445500 -- (-1065.163) [-1063.799] (-1064.835) (-1066.290) * (-1062.511) (-1064.691) (-1061.135) [-1065.674] -- 0:00:37
446000 -- (-1067.894) (-1062.831) [-1065.087] (-1062.546) * [-1064.640] (-1064.052) (-1063.246) (-1065.601) -- 0:00:37
446500 -- (-1062.822) [-1063.196] (-1065.510) (-1061.239) * [-1065.440] (-1071.787) (-1063.953) (-1063.528) -- 0:00:37
447000 -- (-1063.736) [-1067.708] (-1064.397) (-1063.272) * (-1065.581) (-1064.845) (-1065.085) [-1064.579] -- 0:00:37
447500 -- [-1064.183] (-1065.375) (-1064.159) (-1065.702) * (-1062.383) (-1062.808) [-1067.208] (-1064.084) -- 0:00:37
448000 -- [-1062.591] (-1065.985) (-1064.921) (-1065.231) * (-1061.221) [-1064.578] (-1068.544) (-1067.301) -- 0:00:36
448500 -- [-1062.542] (-1066.213) (-1064.158) (-1064.565) * [-1063.201] (-1066.411) (-1067.093) (-1069.331) -- 0:00:36
449000 -- [-1063.250] (-1066.573) (-1065.565) (-1066.155) * (-1066.555) [-1065.162] (-1064.965) (-1066.755) -- 0:00:36
449500 -- (-1064.631) [-1066.703] (-1065.570) (-1064.113) * [-1062.803] (-1065.229) (-1065.263) (-1064.748) -- 0:00:36
450000 -- (-1064.548) (-1065.495) (-1065.802) [-1065.862] * [-1061.294] (-1066.305) (-1061.642) (-1065.280) -- 0:00:36
Average standard deviation of split frequencies: 0.010576
450500 -- [-1066.024] (-1067.472) (-1070.908) (-1064.134) * (-1066.756) (-1068.001) (-1063.248) [-1065.626] -- 0:00:36
451000 -- (-1072.118) [-1065.846] (-1064.647) (-1066.193) * (-1065.521) (-1066.222) [-1062.850] (-1064.971) -- 0:00:36
451500 -- [-1065.283] (-1062.672) (-1066.157) (-1062.868) * (-1064.457) (-1065.284) (-1064.897) [-1065.267] -- 0:00:36
452000 -- (-1067.436) (-1068.146) [-1066.026] (-1063.574) * (-1065.436) (-1068.256) [-1063.836] (-1064.902) -- 0:00:36
452500 -- (-1065.099) (-1066.595) (-1064.336) [-1063.460] * (-1063.428) (-1067.161) [-1063.361] (-1065.123) -- 0:00:36
453000 -- (-1068.549) (-1065.352) (-1067.082) [-1063.969] * (-1065.024) (-1064.844) (-1064.318) [-1061.843] -- 0:00:36
453500 -- (-1064.580) (-1065.058) (-1062.338) [-1062.296] * (-1061.767) (-1064.679) [-1062.155] (-1062.865) -- 0:00:36
454000 -- (-1064.473) (-1068.034) [-1062.625] (-1062.830) * (-1062.142) (-1067.187) [-1063.928] (-1065.899) -- 0:00:36
454500 -- [-1061.905] (-1065.953) (-1067.813) (-1066.151) * (-1062.317) [-1065.355] (-1063.478) (-1067.076) -- 0:00:36
455000 -- [-1061.894] (-1064.008) (-1069.387) (-1064.117) * [-1064.795] (-1066.292) (-1064.582) (-1064.086) -- 0:00:35
Average standard deviation of split frequencies: 0.009365
455500 -- (-1063.973) (-1065.067) (-1065.395) [-1061.779] * (-1062.086) (-1064.365) [-1060.941] (-1063.937) -- 0:00:35
456000 -- (-1063.649) (-1064.855) (-1067.294) [-1064.336] * [-1068.987] (-1063.313) (-1062.705) (-1064.761) -- 0:00:35
456500 -- (-1065.734) [-1067.595] (-1064.215) (-1065.264) * (-1065.373) [-1067.309] (-1061.576) (-1063.935) -- 0:00:35
457000 -- (-1063.610) [-1066.232] (-1065.463) (-1064.579) * (-1066.653) (-1065.857) [-1063.262] (-1062.832) -- 0:00:35
457500 -- (-1065.790) (-1067.385) [-1065.695] (-1062.446) * [-1064.860] (-1066.307) (-1064.236) (-1064.601) -- 0:00:36
458000 -- (-1066.625) (-1065.710) (-1066.649) [-1063.681] * (-1064.455) (-1062.837) (-1062.449) [-1064.210] -- 0:00:36
458500 -- (-1070.224) (-1067.410) (-1064.544) [-1063.196] * (-1064.381) (-1064.037) [-1064.345] (-1068.175) -- 0:00:36
459000 -- (-1071.589) [-1065.397] (-1064.066) (-1065.683) * (-1063.439) (-1063.106) [-1061.844] (-1065.750) -- 0:00:36
459500 -- (-1067.511) [-1062.558] (-1066.397) (-1065.514) * (-1066.171) (-1064.702) [-1062.725] (-1064.042) -- 0:00:36
460000 -- [-1064.556] (-1063.521) (-1066.433) (-1068.236) * (-1062.067) [-1064.556] (-1067.934) (-1067.173) -- 0:00:36
Average standard deviation of split frequencies: 0.008890
460500 -- (-1065.367) [-1062.343] (-1067.014) (-1064.571) * (-1063.112) [-1065.215] (-1062.660) (-1064.938) -- 0:00:36
461000 -- (-1068.796) (-1067.721) [-1064.170] (-1064.246) * [-1063.826] (-1063.818) (-1064.587) (-1067.546) -- 0:00:36
461500 -- [-1063.380] (-1062.409) (-1062.791) (-1065.180) * (-1063.777) (-1067.695) (-1062.779) [-1064.437] -- 0:00:36
462000 -- [-1064.773] (-1064.235) (-1064.069) (-1064.266) * [-1061.690] (-1063.950) (-1066.515) (-1063.344) -- 0:00:36
462500 -- (-1064.972) [-1062.935] (-1062.271) (-1064.700) * (-1063.004) [-1064.294] (-1064.325) (-1063.730) -- 0:00:36
463000 -- [-1063.487] (-1065.418) (-1063.395) (-1065.100) * (-1062.670) [-1063.442] (-1062.146) (-1064.709) -- 0:00:35
463500 -- [-1063.902] (-1062.406) (-1061.180) (-1065.917) * (-1062.538) [-1065.692] (-1066.814) (-1066.644) -- 0:00:35
464000 -- (-1063.290) (-1063.455) [-1062.060] (-1061.291) * (-1062.925) [-1062.851] (-1063.163) (-1064.802) -- 0:00:35
464500 -- (-1065.507) [-1063.211] (-1063.909) (-1063.124) * (-1064.091) (-1067.451) (-1066.368) [-1070.589] -- 0:00:35
465000 -- [-1066.311] (-1064.608) (-1062.838) (-1064.682) * (-1063.655) (-1064.187) [-1067.318] (-1066.382) -- 0:00:35
Average standard deviation of split frequencies: 0.008030
465500 -- (-1067.005) (-1069.120) [-1065.552] (-1066.014) * (-1064.423) (-1064.290) [-1068.531] (-1066.284) -- 0:00:35
466000 -- (-1067.429) [-1064.583] (-1060.759) (-1063.737) * [-1061.515] (-1066.107) (-1063.955) (-1067.689) -- 0:00:35
466500 -- (-1064.048) [-1061.225] (-1061.033) (-1063.227) * (-1061.535) (-1066.606) [-1064.801] (-1065.544) -- 0:00:35
467000 -- (-1062.733) (-1065.491) (-1062.524) [-1069.091] * [-1062.284] (-1069.874) (-1064.929) (-1066.453) -- 0:00:35
467500 -- (-1064.152) [-1061.305] (-1061.795) (-1064.281) * (-1068.054) (-1064.656) [-1062.876] (-1065.716) -- 0:00:35
468000 -- (-1066.003) [-1064.067] (-1067.787) (-1063.491) * (-1065.719) (-1065.389) (-1067.142) [-1063.163] -- 0:00:35
468500 -- (-1063.590) (-1061.877) (-1067.314) [-1067.232] * [-1066.071] (-1064.720) (-1062.149) (-1064.042) -- 0:00:35
469000 -- (-1064.702) [-1062.459] (-1064.980) (-1064.409) * (-1064.172) [-1064.247] (-1061.910) (-1064.608) -- 0:00:35
469500 -- [-1064.340] (-1062.592) (-1063.897) (-1064.879) * (-1067.687) (-1068.122) [-1064.701] (-1066.418) -- 0:00:35
470000 -- (-1066.352) (-1062.800) [-1061.798] (-1062.734) * (-1065.744) (-1067.557) [-1065.302] (-1066.634) -- 0:00:34
Average standard deviation of split frequencies: 0.008013
470500 -- [-1067.396] (-1062.082) (-1066.988) (-1065.020) * (-1064.624) (-1064.965) (-1067.326) [-1064.783] -- 0:00:34
471000 -- (-1061.047) [-1062.347] (-1063.186) (-1065.715) * (-1064.984) (-1064.157) [-1063.877] (-1064.899) -- 0:00:34
471500 -- [-1062.210] (-1066.427) (-1068.374) (-1064.889) * (-1063.840) (-1064.670) [-1062.846] (-1067.020) -- 0:00:34
472000 -- (-1068.011) (-1063.663) [-1066.278] (-1067.447) * (-1063.973) (-1065.113) [-1064.123] (-1064.033) -- 0:00:34
472500 -- (-1064.317) (-1062.973) (-1062.738) [-1065.196] * (-1065.469) (-1063.538) [-1063.989] (-1064.938) -- 0:00:35
473000 -- [-1067.027] (-1067.141) (-1065.612) (-1071.376) * (-1068.934) (-1069.113) [-1064.313] (-1064.626) -- 0:00:35
473500 -- (-1062.878) [-1062.734] (-1063.026) (-1065.931) * (-1064.351) (-1068.735) (-1064.993) [-1068.132] -- 0:00:35
474000 -- [-1065.248] (-1064.923) (-1066.087) (-1062.411) * [-1066.939] (-1068.049) (-1062.415) (-1062.988) -- 0:00:35
474500 -- (-1061.782) [-1065.030] (-1063.253) (-1066.322) * (-1063.896) (-1066.603) [-1063.070] (-1064.684) -- 0:00:35
475000 -- (-1066.828) (-1068.052) (-1061.612) [-1065.882] * [-1066.670] (-1066.162) (-1062.245) (-1065.382) -- 0:00:35
Average standard deviation of split frequencies: 0.007737
475500 -- [-1064.251] (-1070.389) (-1065.172) (-1064.823) * (-1069.543) (-1067.663) [-1060.839] (-1064.441) -- 0:00:35
476000 -- (-1063.544) (-1064.038) [-1067.092] (-1066.369) * (-1065.096) (-1065.671) (-1062.526) [-1063.040] -- 0:00:35
476500 -- (-1064.536) (-1066.331) [-1065.087] (-1064.304) * (-1066.940) (-1063.654) [-1061.094] (-1064.713) -- 0:00:35
477000 -- [-1063.036] (-1064.604) (-1063.821) (-1065.558) * [-1066.567] (-1068.677) (-1062.216) (-1064.420) -- 0:00:35
477500 -- (-1065.203) [-1064.439] (-1067.072) (-1065.268) * (-1062.653) (-1066.801) [-1062.524] (-1065.205) -- 0:00:35
478000 -- (-1063.349) [-1064.175] (-1066.793) (-1067.786) * (-1067.333) (-1067.776) (-1062.162) [-1063.329] -- 0:00:34
478500 -- (-1063.211) [-1064.068] (-1066.941) (-1065.383) * (-1062.174) (-1064.441) (-1064.546) [-1069.068] -- 0:00:34
479000 -- (-1061.774) [-1063.747] (-1064.532) (-1064.030) * [-1064.725] (-1063.856) (-1063.874) (-1065.721) -- 0:00:34
479500 -- (-1064.425) (-1064.039) [-1063.044] (-1065.430) * [-1064.354] (-1065.281) (-1069.354) (-1063.138) -- 0:00:34
480000 -- [-1064.385] (-1064.571) (-1061.098) (-1064.837) * (-1066.871) (-1067.961) [-1063.350] (-1064.404) -- 0:00:34
Average standard deviation of split frequencies: 0.007968
480500 -- (-1065.772) [-1063.314] (-1060.456) (-1064.003) * (-1066.507) (-1066.025) [-1063.817] (-1065.946) -- 0:00:34
481000 -- [-1064.582] (-1063.083) (-1064.858) (-1067.294) * (-1064.955) (-1065.029) [-1064.191] (-1069.536) -- 0:00:34
481500 -- (-1066.167) (-1066.534) [-1062.045] (-1065.186) * (-1062.462) [-1066.627] (-1064.396) (-1066.331) -- 0:00:34
482000 -- (-1065.795) [-1066.234] (-1066.139) (-1063.551) * (-1066.425) (-1065.744) (-1066.287) [-1064.075] -- 0:00:34
482500 -- (-1064.783) (-1065.057) [-1065.766] (-1063.615) * (-1066.267) [-1066.963] (-1070.572) (-1066.042) -- 0:00:34
483000 -- (-1065.202) (-1064.727) [-1060.779] (-1067.037) * [-1067.302] (-1069.779) (-1067.933) (-1065.051) -- 0:00:34
483500 -- (-1065.221) (-1065.602) [-1062.563] (-1065.359) * (-1064.564) (-1068.075) [-1064.313] (-1066.645) -- 0:00:34
484000 -- [-1065.523] (-1066.117) (-1062.060) (-1065.298) * [-1067.605] (-1068.855) (-1062.823) (-1066.074) -- 0:00:34
484500 -- [-1064.052] (-1063.517) (-1061.303) (-1065.208) * (-1064.339) (-1066.503) (-1065.576) [-1064.541] -- 0:00:34
485000 -- [-1065.291] (-1067.699) (-1063.123) (-1063.442) * (-1064.196) (-1065.864) (-1065.638) [-1064.839] -- 0:00:33
Average standard deviation of split frequencies: 0.007881
485500 -- [-1062.941] (-1065.301) (-1063.909) (-1062.740) * [-1062.769] (-1066.378) (-1069.110) (-1064.800) -- 0:00:33
486000 -- (-1064.892) (-1067.882) (-1067.717) [-1062.705] * (-1065.004) (-1065.384) [-1062.355] (-1063.521) -- 0:00:33
486500 -- (-1065.052) (-1067.489) (-1066.792) [-1061.738] * (-1062.728) [-1065.105] (-1063.552) (-1063.997) -- 0:00:33
487000 -- (-1067.509) (-1067.620) [-1064.905] (-1063.008) * (-1065.772) (-1063.484) [-1063.704] (-1062.982) -- 0:00:33
487500 -- [-1066.245] (-1067.437) (-1061.042) (-1063.304) * (-1065.247) (-1064.266) [-1061.157] (-1064.600) -- 0:00:34
488000 -- (-1063.964) (-1064.690) (-1060.963) [-1063.171] * (-1061.942) [-1065.922] (-1063.088) (-1064.271) -- 0:00:34
488500 -- [-1064.598] (-1066.074) (-1065.757) (-1063.956) * [-1061.355] (-1071.362) (-1062.382) (-1063.365) -- 0:00:34
489000 -- (-1065.395) (-1065.007) [-1061.795] (-1063.813) * [-1062.624] (-1064.081) (-1061.759) (-1062.469) -- 0:00:34
489500 -- (-1064.805) (-1065.997) [-1061.982] (-1062.343) * [-1062.347] (-1067.047) (-1061.925) (-1065.552) -- 0:00:34
490000 -- (-1066.606) (-1062.672) [-1061.365] (-1064.089) * (-1065.635) (-1063.542) [-1062.394] (-1065.064) -- 0:00:34
Average standard deviation of split frequencies: 0.008198
490500 -- (-1065.558) (-1066.584) (-1062.259) [-1061.963] * [-1062.978] (-1066.020) (-1064.993) (-1063.935) -- 0:00:34
491000 -- (-1065.116) (-1063.698) [-1061.720] (-1063.203) * (-1062.433) (-1061.678) [-1065.929] (-1064.896) -- 0:00:34
491500 -- [-1063.962] (-1064.031) (-1062.680) (-1063.778) * (-1063.865) [-1064.157] (-1063.885) (-1065.482) -- 0:00:34
492000 -- [-1065.771] (-1064.939) (-1067.785) (-1063.992) * (-1063.982) [-1064.596] (-1062.075) (-1065.518) -- 0:00:34
492500 -- (-1066.623) (-1064.955) [-1065.425] (-1062.869) * (-1063.365) [-1064.112] (-1065.262) (-1064.777) -- 0:00:34
493000 -- [-1067.035] (-1065.475) (-1071.425) (-1063.825) * (-1063.545) (-1067.795) (-1065.590) [-1064.864] -- 0:00:33
493500 -- [-1067.859] (-1068.718) (-1069.359) (-1065.170) * [-1069.870] (-1065.068) (-1062.158) (-1066.642) -- 0:00:33
494000 -- (-1065.379) (-1066.639) (-1067.139) [-1070.277] * (-1069.849) (-1065.718) (-1065.436) [-1064.724] -- 0:00:33
494500 -- (-1065.533) (-1066.070) [-1065.304] (-1061.637) * (-1063.714) (-1068.429) [-1062.896] (-1063.951) -- 0:00:33
495000 -- (-1065.319) (-1066.620) (-1064.925) [-1061.896] * (-1063.399) (-1064.565) [-1067.204] (-1064.710) -- 0:00:33
Average standard deviation of split frequencies: 0.007160
495500 -- (-1065.609) (-1065.613) [-1062.953] (-1062.042) * (-1065.610) [-1063.749] (-1066.403) (-1063.566) -- 0:00:33
496000 -- (-1070.162) (-1065.674) [-1063.586] (-1064.635) * (-1064.857) [-1065.935] (-1063.639) (-1064.612) -- 0:00:33
496500 -- (-1065.881) [-1068.680] (-1064.005) (-1066.326) * (-1066.295) (-1067.071) [-1063.801] (-1064.638) -- 0:00:33
497000 -- [-1066.864] (-1065.370) (-1063.193) (-1067.252) * (-1063.163) [-1062.654] (-1064.791) (-1062.462) -- 0:00:33
497500 -- (-1065.063) (-1067.321) [-1063.247] (-1065.179) * (-1061.947) (-1064.469) (-1062.057) [-1064.240] -- 0:00:33
498000 -- (-1063.459) (-1062.942) [-1062.911] (-1063.939) * (-1063.643) [-1063.539] (-1063.155) (-1065.569) -- 0:00:33
498500 -- (-1063.200) (-1064.632) [-1062.176] (-1063.870) * (-1065.568) (-1067.383) (-1063.769) [-1066.472] -- 0:00:33
499000 -- (-1067.555) (-1065.072) (-1061.432) [-1065.400] * (-1066.889) (-1064.107) (-1064.048) [-1071.582] -- 0:00:33
499500 -- (-1063.345) [-1065.413] (-1066.362) (-1064.591) * [-1064.570] (-1064.495) (-1065.647) (-1067.181) -- 0:00:33
500000 -- (-1063.348) (-1065.574) (-1061.007) [-1063.097] * (-1066.255) [-1062.078] (-1065.305) (-1068.129) -- 0:00:33
Average standard deviation of split frequencies: 0.007219
500500 -- [-1063.413] (-1065.074) (-1064.004) (-1063.110) * (-1063.117) (-1063.295) (-1065.147) [-1063.487] -- 0:00:32
501000 -- (-1066.164) (-1067.241) (-1063.372) [-1061.940] * (-1063.602) [-1064.162] (-1063.620) (-1065.955) -- 0:00:32
501500 -- [-1064.361] (-1063.768) (-1063.168) (-1064.577) * (-1065.428) (-1064.145) [-1065.699] (-1064.840) -- 0:00:32
502000 -- (-1063.106) (-1063.510) (-1062.511) [-1066.193] * (-1069.613) [-1066.728] (-1063.005) (-1063.084) -- 0:00:32
502500 -- (-1063.786) (-1063.912) (-1063.019) [-1064.928] * (-1065.530) (-1066.849) [-1061.881] (-1063.869) -- 0:00:33
503000 -- (-1063.121) (-1064.522) (-1062.750) [-1061.278] * (-1064.298) (-1064.397) (-1062.702) [-1064.650] -- 0:00:33
503500 -- (-1064.768) [-1062.835] (-1061.425) (-1064.166) * [-1063.352] (-1063.866) (-1065.470) (-1067.723) -- 0:00:33
504000 -- [-1062.216] (-1064.052) (-1064.579) (-1061.457) * (-1067.414) [-1065.793] (-1063.184) (-1063.503) -- 0:00:33
504500 -- [-1061.581] (-1067.754) (-1065.593) (-1064.444) * (-1068.780) (-1066.520) (-1065.089) [-1065.295] -- 0:00:33
505000 -- [-1062.078] (-1066.874) (-1062.831) (-1063.073) * (-1062.677) (-1065.206) (-1064.995) [-1063.697] -- 0:00:33
Average standard deviation of split frequencies: 0.007701
505500 -- [-1065.564] (-1067.623) (-1064.891) (-1061.900) * [-1063.935] (-1063.974) (-1062.181) (-1062.977) -- 0:00:33
506000 -- [-1064.188] (-1065.524) (-1066.594) (-1063.512) * (-1068.483) [-1064.368] (-1066.894) (-1066.042) -- 0:00:33
506500 -- (-1064.255) (-1068.758) (-1063.395) [-1061.017] * (-1064.799) (-1068.082) (-1066.841) [-1064.998] -- 0:00:33
507000 -- [-1065.111] (-1064.413) (-1064.557) (-1064.284) * [-1063.979] (-1067.249) (-1067.263) (-1063.543) -- 0:00:33
507500 -- (-1065.348) [-1063.869] (-1066.229) (-1064.310) * (-1064.082) (-1064.757) (-1063.809) [-1063.718] -- 0:00:32
508000 -- (-1062.691) [-1064.451] (-1062.029) (-1068.033) * (-1069.411) [-1064.093] (-1064.339) (-1063.785) -- 0:00:32
508500 -- (-1064.018) (-1062.598) [-1064.344] (-1065.742) * (-1065.109) (-1064.392) [-1061.044] (-1065.002) -- 0:00:32
509000 -- (-1063.290) (-1063.485) (-1064.803) [-1067.676] * [-1063.788] (-1062.804) (-1063.929) (-1062.026) -- 0:00:32
509500 -- (-1068.351) (-1065.539) [-1061.527] (-1066.180) * (-1064.902) [-1062.499] (-1064.908) (-1064.466) -- 0:00:32
510000 -- [-1061.040] (-1065.967) (-1066.543) (-1063.809) * (-1063.088) (-1063.620) [-1063.436] (-1064.352) -- 0:00:32
Average standard deviation of split frequencies: 0.007939
510500 -- (-1066.613) [-1066.954] (-1064.576) (-1063.011) * (-1066.754) (-1065.449) (-1067.211) [-1064.921] -- 0:00:32
511000 -- (-1063.625) [-1062.025] (-1062.890) (-1066.644) * (-1068.972) (-1062.350) [-1063.128] (-1063.726) -- 0:00:32
511500 -- [-1063.020] (-1064.817) (-1065.284) (-1064.399) * (-1065.091) (-1064.527) [-1064.439] (-1063.918) -- 0:00:32
512000 -- (-1063.354) (-1062.599) [-1066.638] (-1062.890) * [-1067.396] (-1068.429) (-1064.226) (-1062.248) -- 0:00:32
512500 -- (-1064.638) [-1062.877] (-1065.826) (-1064.715) * [-1064.594] (-1067.841) (-1063.277) (-1065.116) -- 0:00:32
513000 -- [-1062.897] (-1063.427) (-1064.527) (-1064.516) * (-1064.115) (-1063.261) (-1067.003) [-1064.204] -- 0:00:32
513500 -- (-1063.011) (-1063.866) (-1064.921) [-1065.106] * (-1065.865) [-1060.982] (-1065.429) (-1063.135) -- 0:00:32
514000 -- (-1061.047) (-1064.125) (-1061.693) [-1065.929] * (-1065.933) [-1061.697] (-1064.952) (-1061.935) -- 0:00:32
514500 -- (-1062.170) (-1065.952) [-1062.755] (-1067.109) * (-1068.331) (-1065.808) (-1071.846) [-1060.911] -- 0:00:32
515000 -- (-1062.742) [-1065.151] (-1068.477) (-1068.506) * (-1066.189) (-1063.355) (-1065.053) [-1061.372] -- 0:00:32
Average standard deviation of split frequencies: 0.008588
515500 -- (-1066.278) (-1064.695) (-1062.561) [-1064.795] * (-1064.821) (-1064.718) [-1064.369] (-1063.920) -- 0:00:31
516000 -- (-1063.840) (-1062.739) [-1062.590] (-1065.243) * [-1062.469] (-1065.526) (-1064.287) (-1062.112) -- 0:00:31
516500 -- (-1062.963) (-1062.823) [-1062.948] (-1063.079) * (-1066.442) [-1065.697] (-1066.259) (-1062.723) -- 0:00:31
517000 -- [-1064.976] (-1065.069) (-1064.963) (-1067.950) * (-1066.525) (-1064.517) (-1061.634) [-1063.932] -- 0:00:31
517500 -- (-1064.696) (-1061.140) (-1065.019) [-1062.796] * (-1068.039) (-1067.649) (-1064.465) [-1065.716] -- 0:00:32
518000 -- (-1065.654) (-1061.693) (-1062.604) [-1063.233] * (-1066.113) [-1064.092] (-1065.544) (-1068.941) -- 0:00:32
518500 -- (-1063.353) (-1061.418) [-1064.829] (-1061.810) * (-1065.403) (-1067.158) [-1065.126] (-1065.319) -- 0:00:32
519000 -- (-1066.508) (-1064.091) (-1063.048) [-1061.887] * (-1064.082) [-1065.404] (-1064.598) (-1061.883) -- 0:00:32
519500 -- (-1066.244) [-1064.641] (-1064.939) (-1061.810) * [-1067.640] (-1069.884) (-1066.803) (-1064.018) -- 0:00:32
520000 -- (-1064.142) (-1064.591) [-1062.504] (-1063.097) * (-1064.862) (-1062.911) (-1064.615) [-1063.047] -- 0:00:32
Average standard deviation of split frequencies: 0.007364
520500 -- [-1064.962] (-1065.717) (-1062.550) (-1065.576) * [-1063.290] (-1065.313) (-1068.452) (-1064.082) -- 0:00:32
521000 -- (-1066.070) (-1062.382) (-1065.687) [-1067.359] * (-1064.331) (-1064.392) (-1064.040) [-1063.204] -- 0:00:32
521500 -- [-1066.542] (-1065.949) (-1064.874) (-1068.774) * (-1065.948) (-1064.473) (-1062.610) [-1063.377] -- 0:00:32
522000 -- (-1067.589) [-1062.315] (-1062.645) (-1065.585) * (-1064.918) (-1064.418) [-1062.993] (-1073.087) -- 0:00:32
522500 -- [-1063.062] (-1063.852) (-1064.158) (-1064.266) * (-1064.765) (-1062.182) (-1065.441) [-1065.749] -- 0:00:31
523000 -- [-1065.124] (-1066.901) (-1065.010) (-1069.269) * (-1065.335) (-1062.443) (-1065.138) [-1066.071] -- 0:00:31
523500 -- (-1064.619) (-1066.032) (-1064.381) [-1064.830] * (-1065.598) (-1063.920) (-1062.947) [-1066.367] -- 0:00:31
524000 -- (-1066.746) (-1066.948) (-1060.977) [-1062.137] * [-1067.291] (-1061.945) (-1063.839) (-1064.477) -- 0:00:31
524500 -- (-1063.157) (-1063.388) [-1068.667] (-1063.409) * (-1065.990) [-1064.229] (-1061.777) (-1064.561) -- 0:00:31
525000 -- (-1065.091) [-1063.132] (-1064.254) (-1063.566) * (-1068.186) (-1066.366) [-1065.133] (-1065.360) -- 0:00:31
Average standard deviation of split frequencies: 0.007767
525500 -- (-1071.989) (-1064.343) (-1066.899) [-1065.065] * (-1065.906) (-1065.279) (-1064.659) [-1063.039] -- 0:00:31
526000 -- (-1070.992) (-1064.285) (-1062.530) [-1065.177] * (-1064.662) (-1067.460) [-1066.198] (-1066.632) -- 0:00:31
526500 -- [-1065.704] (-1062.994) (-1066.110) (-1068.165) * (-1064.481) (-1062.183) (-1064.216) [-1065.826] -- 0:00:31
527000 -- (-1063.343) [-1063.908] (-1061.995) (-1066.013) * (-1062.489) (-1063.682) (-1064.230) [-1062.626] -- 0:00:31
527500 -- [-1069.069] (-1065.656) (-1062.277) (-1064.248) * (-1064.651) (-1064.915) (-1063.015) [-1065.223] -- 0:00:31
528000 -- [-1067.125] (-1066.038) (-1062.735) (-1065.711) * (-1063.382) (-1065.500) (-1065.951) [-1064.025] -- 0:00:31
528500 -- (-1063.058) [-1065.219] (-1065.839) (-1062.509) * [-1065.319] (-1067.127) (-1062.035) (-1064.262) -- 0:00:31
529000 -- [-1065.429] (-1068.495) (-1068.682) (-1063.303) * (-1064.075) (-1063.267) (-1062.815) [-1063.987] -- 0:00:31
529500 -- (-1065.276) (-1067.337) [-1065.934] (-1063.952) * [-1066.591] (-1064.013) (-1064.830) (-1063.368) -- 0:00:31
530000 -- (-1066.494) (-1067.384) (-1062.070) [-1063.574] * (-1066.403) [-1063.474] (-1065.885) (-1063.558) -- 0:00:31
Average standard deviation of split frequencies: 0.008273
530500 -- (-1066.027) [-1064.965] (-1062.650) (-1065.971) * [-1065.593] (-1062.165) (-1064.642) (-1068.955) -- 0:00:30
531000 -- (-1063.711) [-1064.634] (-1064.465) (-1064.518) * (-1065.541) (-1063.931) [-1063.447] (-1062.219) -- 0:00:30
531500 -- [-1063.261] (-1065.327) (-1066.601) (-1070.008) * (-1067.634) (-1064.634) [-1062.922] (-1065.580) -- 0:00:30
532000 -- [-1065.695] (-1064.912) (-1063.604) (-1065.912) * (-1064.809) (-1063.822) (-1063.105) [-1061.928] -- 0:00:30
532500 -- (-1062.575) (-1064.634) [-1064.005] (-1068.865) * (-1065.233) (-1063.238) (-1067.403) [-1064.241] -- 0:00:31
533000 -- (-1065.395) (-1064.345) [-1066.058] (-1065.655) * [-1064.734] (-1062.934) (-1064.497) (-1062.554) -- 0:00:31
533500 -- (-1063.987) (-1064.214) (-1064.644) [-1065.221] * (-1064.748) (-1064.260) [-1065.270] (-1061.407) -- 0:00:31
534000 -- [-1064.783] (-1065.290) (-1065.979) (-1065.105) * [-1063.183] (-1065.413) (-1066.451) (-1062.221) -- 0:00:31
534500 -- (-1064.442) (-1062.875) [-1066.733] (-1064.414) * (-1064.657) (-1063.567) (-1064.364) [-1062.293] -- 0:00:31
535000 -- (-1063.491) [-1064.073] (-1068.346) (-1061.431) * (-1063.029) (-1066.943) [-1062.442] (-1062.202) -- 0:00:31
Average standard deviation of split frequencies: 0.008355
535500 -- (-1063.126) (-1062.749) (-1067.119) [-1063.472] * (-1061.858) (-1066.246) [-1062.218] (-1064.565) -- 0:00:31
536000 -- (-1066.181) (-1062.433) [-1063.575] (-1063.971) * (-1064.373) [-1066.134] (-1064.839) (-1064.796) -- 0:00:31
536500 -- (-1064.827) [-1064.068] (-1064.723) (-1063.873) * [-1064.607] (-1061.730) (-1062.708) (-1063.686) -- 0:00:31
537000 -- (-1064.989) (-1062.910) [-1064.174] (-1066.330) * [-1065.688] (-1066.486) (-1062.254) (-1068.496) -- 0:00:31
537500 -- [-1062.628] (-1064.589) (-1065.250) (-1064.307) * (-1066.744) (-1064.622) [-1060.398] (-1060.888) -- 0:00:30
538000 -- [-1060.496] (-1065.237) (-1064.484) (-1064.919) * (-1066.542) (-1069.734) [-1061.199] (-1069.719) -- 0:00:30
538500 -- [-1064.432] (-1065.956) (-1066.589) (-1062.889) * (-1064.874) (-1066.707) [-1063.643] (-1071.612) -- 0:00:30
539000 -- (-1063.558) [-1065.368] (-1063.896) (-1062.110) * (-1066.205) [-1063.915] (-1063.643) (-1069.245) -- 0:00:30
539500 -- (-1062.692) (-1065.328) [-1061.953] (-1067.016) * [-1063.395] (-1063.785) (-1063.079) (-1066.601) -- 0:00:30
540000 -- (-1063.885) (-1064.844) [-1065.518] (-1065.765) * (-1064.773) [-1065.868] (-1062.651) (-1067.969) -- 0:00:30
Average standard deviation of split frequencies: 0.008283
540500 -- (-1062.237) (-1063.776) [-1065.882] (-1066.119) * (-1066.587) [-1067.353] (-1061.492) (-1066.371) -- 0:00:30
541000 -- (-1067.888) [-1063.713] (-1066.904) (-1066.301) * (-1064.633) [-1067.426] (-1062.905) (-1067.144) -- 0:00:30
541500 -- (-1065.496) (-1063.734) [-1067.221] (-1064.179) * (-1064.818) (-1066.439) (-1063.548) [-1063.627] -- 0:00:30
542000 -- (-1064.025) [-1064.252] (-1065.675) (-1063.329) * [-1064.297] (-1069.949) (-1064.465) (-1062.692) -- 0:00:30
542500 -- (-1064.306) [-1064.933] (-1070.246) (-1065.145) * (-1063.558) (-1063.441) [-1063.624] (-1062.738) -- 0:00:30
543000 -- (-1064.666) [-1063.973] (-1068.897) (-1061.762) * [-1063.182] (-1063.818) (-1064.824) (-1064.412) -- 0:00:30
543500 -- (-1065.654) (-1064.419) [-1067.843] (-1061.257) * [-1065.025] (-1067.212) (-1067.272) (-1065.894) -- 0:00:30
544000 -- (-1066.199) (-1065.787) [-1064.073] (-1064.711) * (-1063.423) (-1062.003) [-1065.679] (-1064.772) -- 0:00:30
544500 -- [-1063.702] (-1065.118) (-1066.038) (-1066.665) * (-1061.707) (-1061.857) [-1064.516] (-1065.483) -- 0:00:30
545000 -- (-1064.473) (-1065.257) [-1068.574] (-1065.777) * (-1062.098) [-1062.051] (-1062.456) (-1066.086) -- 0:00:30
Average standard deviation of split frequencies: 0.007932
545500 -- (-1062.825) (-1066.518) [-1064.233] (-1064.041) * [-1064.055] (-1062.251) (-1065.912) (-1065.847) -- 0:00:29
546000 -- (-1064.329) (-1068.778) [-1065.427] (-1067.433) * (-1067.947) [-1063.333] (-1063.944) (-1063.158) -- 0:00:29
546500 -- (-1063.401) (-1064.814) [-1064.916] (-1062.849) * (-1070.271) (-1069.515) [-1064.730] (-1064.388) -- 0:00:30
547000 -- (-1067.178) (-1066.302) [-1073.465] (-1063.024) * (-1063.180) (-1064.441) (-1064.167) [-1063.602] -- 0:00:30
547500 -- (-1066.773) [-1065.250] (-1062.974) (-1062.711) * (-1065.069) [-1063.765] (-1064.206) (-1063.591) -- 0:00:30
548000 -- (-1064.423) [-1066.086] (-1065.996) (-1065.730) * (-1061.085) [-1063.653] (-1070.435) (-1064.267) -- 0:00:30
548500 -- (-1067.170) (-1065.800) [-1063.321] (-1063.164) * (-1066.663) (-1063.293) [-1068.267] (-1067.338) -- 0:00:30
549000 -- (-1066.592) (-1071.034) [-1063.067] (-1064.763) * (-1068.700) (-1072.562) [-1065.057] (-1063.177) -- 0:00:30
549500 -- (-1064.075) [-1064.415] (-1065.936) (-1067.773) * [-1070.663] (-1064.919) (-1062.950) (-1063.477) -- 0:00:30
550000 -- (-1065.857) (-1064.508) (-1064.278) [-1063.915] * (-1075.591) (-1064.730) [-1064.122] (-1066.507) -- 0:00:30
Average standard deviation of split frequencies: 0.008454
550500 -- (-1066.910) [-1065.413] (-1065.632) (-1065.980) * [-1062.997] (-1063.890) (-1063.688) (-1067.318) -- 0:00:30
551000 -- (-1066.592) (-1071.847) [-1067.299] (-1066.089) * (-1063.447) [-1062.373] (-1065.818) (-1064.010) -- 0:00:30
551500 -- (-1065.958) (-1069.678) [-1065.607] (-1064.461) * (-1063.544) [-1063.417] (-1064.978) (-1064.805) -- 0:00:30
552000 -- [-1065.447] (-1064.095) (-1070.113) (-1062.070) * (-1065.475) [-1062.457] (-1063.638) (-1062.944) -- 0:00:30
552500 -- (-1065.764) (-1065.275) (-1062.528) [-1065.733] * (-1063.161) [-1062.673] (-1063.157) (-1066.601) -- 0:00:29
553000 -- [-1063.860] (-1065.160) (-1064.478) (-1063.281) * (-1065.800) [-1064.313] (-1065.123) (-1066.948) -- 0:00:29
553500 -- (-1064.600) (-1064.874) [-1063.442] (-1068.574) * [-1062.965] (-1063.904) (-1065.193) (-1066.597) -- 0:00:29
554000 -- (-1066.932) (-1066.432) [-1064.185] (-1067.415) * (-1068.635) (-1065.249) [-1062.909] (-1066.474) -- 0:00:29
554500 -- (-1062.858) [-1064.963] (-1060.905) (-1066.800) * (-1065.052) (-1064.574) [-1062.359] (-1068.404) -- 0:00:29
555000 -- (-1065.401) [-1064.616] (-1062.302) (-1066.006) * (-1062.697) (-1065.328) [-1062.283] (-1066.391) -- 0:00:29
Average standard deviation of split frequencies: 0.008108
555500 -- (-1065.693) [-1064.715] (-1061.503) (-1070.790) * [-1063.732] (-1062.769) (-1062.792) (-1064.237) -- 0:00:29
556000 -- (-1064.885) [-1067.757] (-1062.627) (-1063.042) * [-1065.743] (-1063.678) (-1067.640) (-1064.536) -- 0:00:29
556500 -- (-1065.815) (-1065.774) (-1063.797) [-1066.071] * (-1066.281) (-1064.012) [-1067.668] (-1064.751) -- 0:00:29
557000 -- (-1064.234) (-1072.904) (-1062.647) [-1063.297] * (-1063.312) [-1066.054] (-1065.697) (-1066.175) -- 0:00:29
557500 -- (-1064.804) (-1066.110) (-1065.346) [-1062.640] * (-1065.416) (-1067.205) [-1063.050] (-1062.599) -- 0:00:29
558000 -- (-1066.050) (-1064.631) [-1063.259] (-1061.779) * (-1064.256) (-1065.020) [-1065.301] (-1064.465) -- 0:00:29
558500 -- (-1066.125) (-1066.491) (-1063.789) [-1064.419] * (-1062.958) (-1065.611) (-1062.835) [-1067.784] -- 0:00:29
559000 -- (-1066.669) [-1065.249] (-1064.256) (-1067.067) * (-1065.462) [-1065.536] (-1063.114) (-1065.468) -- 0:00:29
559500 -- (-1064.464) (-1074.510) [-1066.635] (-1064.106) * [-1061.944] (-1061.098) (-1064.017) (-1065.876) -- 0:00:29
560000 -- (-1066.364) (-1067.022) (-1063.792) [-1062.085] * [-1062.897] (-1063.249) (-1062.015) (-1066.391) -- 0:00:29
Average standard deviation of split frequencies: 0.008464
560500 -- (-1067.867) (-1064.709) (-1066.610) [-1066.254] * (-1065.375) (-1062.453) (-1063.314) [-1070.102] -- 0:00:29
561000 -- (-1068.186) (-1066.107) [-1064.906] (-1067.229) * (-1063.383) (-1063.954) [-1065.903] (-1067.006) -- 0:00:29
561500 -- (-1065.048) [-1063.548] (-1066.272) (-1066.415) * [-1062.393] (-1061.841) (-1065.804) (-1064.080) -- 0:00:29
562000 -- [-1064.666] (-1065.159) (-1065.773) (-1065.007) * (-1064.455) [-1063.548] (-1064.403) (-1067.041) -- 0:00:29
562500 -- (-1064.080) [-1064.768] (-1067.068) (-1062.572) * (-1067.618) (-1061.666) (-1065.979) [-1067.572] -- 0:00:29
563000 -- (-1065.781) (-1064.580) [-1063.944] (-1067.637) * (-1068.943) [-1060.430] (-1065.713) (-1062.850) -- 0:00:29
563500 -- (-1066.238) (-1069.540) [-1067.231] (-1064.166) * [-1064.142] (-1063.265) (-1064.257) (-1065.177) -- 0:00:29
564000 -- (-1064.716) (-1066.857) (-1061.806) [-1066.924] * (-1063.162) (-1063.048) [-1067.303] (-1067.576) -- 0:00:29
564500 -- (-1063.414) (-1065.116) [-1064.563] (-1066.649) * (-1064.273) (-1062.564) [-1066.093] (-1064.346) -- 0:00:29
565000 -- [-1065.634] (-1068.143) (-1063.046) (-1062.369) * [-1063.719] (-1067.392) (-1066.677) (-1067.865) -- 0:00:29
Average standard deviation of split frequencies: 0.008162
565500 -- (-1066.404) (-1071.442) (-1065.323) [-1068.597] * (-1062.224) [-1062.263] (-1064.192) (-1068.699) -- 0:00:29
566000 -- (-1063.648) (-1068.602) (-1062.427) [-1067.411] * (-1063.943) (-1064.390) [-1065.942] (-1069.382) -- 0:00:29
566500 -- (-1061.875) [-1069.155] (-1063.261) (-1064.152) * [-1064.802] (-1066.773) (-1066.690) (-1067.812) -- 0:00:29
567000 -- (-1067.117) (-1064.639) [-1063.207] (-1062.207) * (-1065.608) (-1066.096) (-1063.861) [-1067.128] -- 0:00:29
567500 -- (-1065.479) [-1067.684] (-1063.796) (-1062.172) * [-1061.582] (-1067.008) (-1066.407) (-1064.704) -- 0:00:28
568000 -- (-1065.438) [-1068.058] (-1064.738) (-1062.584) * (-1062.338) (-1062.095) (-1065.534) [-1063.724] -- 0:00:28
568500 -- (-1064.459) [-1066.649] (-1061.990) (-1064.529) * (-1064.368) (-1062.211) (-1066.971) [-1064.140] -- 0:00:28
569000 -- (-1066.485) (-1068.423) [-1062.698] (-1060.774) * (-1067.286) [-1061.261] (-1065.965) (-1063.353) -- 0:00:28
569500 -- (-1064.319) [-1064.795] (-1061.238) (-1064.165) * (-1065.822) [-1062.307] (-1066.285) (-1065.600) -- 0:00:28
570000 -- [-1064.714] (-1064.508) (-1062.643) (-1064.726) * [-1064.759] (-1062.433) (-1066.201) (-1065.925) -- 0:00:28
Average standard deviation of split frequencies: 0.007951
570500 -- (-1062.712) [-1064.175] (-1063.733) (-1062.813) * (-1062.606) (-1063.224) [-1068.653] (-1065.653) -- 0:00:28
571000 -- (-1065.286) (-1065.254) (-1066.313) [-1063.190] * (-1064.361) [-1066.403] (-1066.306) (-1063.671) -- 0:00:28
571500 -- [-1065.439] (-1068.587) (-1065.518) (-1064.480) * (-1062.681) (-1060.024) [-1067.484] (-1065.625) -- 0:00:28
572000 -- (-1066.770) (-1067.061) (-1066.831) [-1064.464] * (-1068.095) (-1064.548) [-1062.884] (-1065.844) -- 0:00:28
572500 -- (-1064.923) (-1063.952) [-1063.976] (-1066.701) * (-1063.429) (-1062.668) (-1067.429) [-1065.694] -- 0:00:28
573000 -- (-1064.158) (-1063.134) (-1069.143) [-1062.367] * [-1068.071] (-1062.817) (-1065.238) (-1064.843) -- 0:00:28
573500 -- [-1065.311] (-1065.471) (-1066.292) (-1062.144) * [-1064.568] (-1065.108) (-1063.266) (-1067.843) -- 0:00:28
574000 -- [-1066.712] (-1066.525) (-1063.120) (-1065.592) * (-1068.149) (-1065.667) (-1064.174) [-1067.577] -- 0:00:28
574500 -- (-1066.536) (-1069.487) (-1064.547) [-1062.604] * (-1065.790) (-1064.893) (-1064.185) [-1063.455] -- 0:00:28
575000 -- [-1061.244] (-1066.749) (-1067.070) (-1061.737) * (-1064.813) (-1065.663) [-1062.984] (-1063.361) -- 0:00:28
Average standard deviation of split frequencies: 0.008075
575500 -- [-1061.259] (-1066.366) (-1064.309) (-1064.728) * (-1064.919) (-1064.591) (-1068.246) [-1065.962] -- 0:00:28
576000 -- [-1063.872] (-1064.894) (-1066.470) (-1061.673) * [-1067.161] (-1068.978) (-1065.798) (-1064.659) -- 0:00:28
576500 -- (-1064.913) [-1066.732] (-1064.792) (-1062.450) * (-1068.633) (-1065.062) (-1063.328) [-1067.342] -- 0:00:28
577000 -- (-1066.195) (-1064.531) (-1068.455) [-1062.124] * (-1067.379) (-1064.339) [-1066.545] (-1064.684) -- 0:00:28
577500 -- (-1063.408) (-1062.041) (-1067.756) [-1067.706] * (-1066.006) [-1063.854] (-1061.929) (-1064.552) -- 0:00:28
578000 -- (-1066.863) (-1069.405) [-1062.834] (-1064.780) * (-1066.637) (-1068.195) [-1062.687] (-1064.494) -- 0:00:28
578500 -- (-1066.726) [-1067.540] (-1063.038) (-1063.564) * (-1062.750) [-1062.150] (-1064.621) (-1063.231) -- 0:00:28
579000 -- (-1067.762) (-1065.695) (-1064.193) [-1061.182] * (-1063.857) [-1063.886] (-1064.322) (-1065.191) -- 0:00:28
579500 -- (-1062.891) (-1065.047) (-1065.651) [-1064.184] * [-1063.447] (-1062.680) (-1067.623) (-1064.548) -- 0:00:28
580000 -- (-1066.133) [-1065.987] (-1068.561) (-1065.322) * (-1065.286) (-1063.953) (-1069.604) [-1065.438] -- 0:00:28
Average standard deviation of split frequencies: 0.008220
580500 -- (-1065.856) (-1064.306) (-1062.117) [-1065.483] * (-1066.854) [-1064.201] (-1063.595) (-1070.107) -- 0:00:28
581000 -- (-1065.626) (-1065.454) [-1061.510] (-1067.561) * (-1064.679) (-1063.307) [-1062.520] (-1065.350) -- 0:00:28
581500 -- (-1063.997) (-1065.518) (-1062.355) [-1067.312] * [-1066.043] (-1063.565) (-1065.965) (-1066.597) -- 0:00:28
582000 -- [-1065.018] (-1065.107) (-1071.240) (-1064.247) * (-1062.900) [-1063.453] (-1063.536) (-1067.714) -- 0:00:28
582500 -- [-1065.285] (-1064.479) (-1062.927) (-1066.201) * (-1065.740) [-1064.897] (-1063.352) (-1068.025) -- 0:00:27
583000 -- (-1063.189) (-1064.855) [-1064.364] (-1067.686) * (-1062.372) (-1063.242) [-1065.250] (-1068.685) -- 0:00:27
583500 -- (-1065.802) (-1068.215) (-1064.819) [-1063.680] * (-1064.746) [-1065.593] (-1064.959) (-1072.004) -- 0:00:27
584000 -- [-1062.480] (-1065.584) (-1062.294) (-1063.385) * (-1064.702) (-1064.132) [-1066.063] (-1067.670) -- 0:00:27
584500 -- (-1063.035) [-1061.726] (-1062.059) (-1064.254) * (-1067.992) (-1062.760) [-1064.043] (-1069.145) -- 0:00:27
585000 -- (-1065.016) (-1062.405) [-1062.686] (-1068.225) * [-1063.729] (-1065.234) (-1065.583) (-1069.003) -- 0:00:27
Average standard deviation of split frequencies: 0.008396
585500 -- [-1064.531] (-1067.206) (-1064.493) (-1060.949) * [-1064.226] (-1067.080) (-1066.032) (-1065.483) -- 0:00:27
586000 -- (-1066.467) [-1065.304] (-1063.172) (-1061.846) * (-1061.739) (-1065.942) [-1066.853] (-1064.831) -- 0:00:27
586500 -- (-1063.810) (-1062.957) (-1061.852) [-1061.094] * [-1064.043] (-1065.747) (-1064.526) (-1063.998) -- 0:00:27
587000 -- [-1062.969] (-1068.943) (-1064.847) (-1067.197) * (-1062.298) [-1065.114] (-1063.023) (-1065.761) -- 0:00:27
587500 -- [-1063.380] (-1064.830) (-1063.942) (-1064.875) * (-1064.121) (-1068.319) [-1067.293] (-1067.884) -- 0:00:27
588000 -- (-1064.399) (-1063.505) (-1067.155) [-1065.751] * (-1069.838) (-1066.296) (-1062.617) [-1064.389] -- 0:00:27
588500 -- (-1064.381) [-1066.437] (-1064.129) (-1062.083) * (-1062.624) (-1064.621) (-1063.778) [-1068.798] -- 0:00:27
589000 -- [-1068.089] (-1067.250) (-1063.080) (-1062.713) * (-1061.176) (-1066.520) [-1062.833] (-1064.098) -- 0:00:27
589500 -- [-1064.836] (-1065.080) (-1065.105) (-1063.249) * (-1064.155) [-1063.640] (-1064.116) (-1063.835) -- 0:00:27
590000 -- (-1064.309) [-1066.931] (-1065.286) (-1062.659) * (-1064.776) (-1064.651) (-1066.999) [-1065.868] -- 0:00:27
Average standard deviation of split frequencies: 0.008247
590500 -- (-1063.873) (-1069.514) [-1062.276] (-1064.790) * (-1064.493) (-1063.491) (-1067.035) [-1065.016] -- 0:00:27
591000 -- (-1066.301) (-1065.430) (-1063.901) [-1063.473] * (-1065.664) (-1062.582) [-1060.947] (-1063.754) -- 0:00:26
591500 -- [-1065.982] (-1063.506) (-1063.417) (-1064.829) * [-1063.520] (-1063.021) (-1064.136) (-1063.540) -- 0:00:27
592000 -- (-1064.331) (-1062.817) [-1064.896] (-1063.769) * [-1064.750] (-1063.006) (-1064.494) (-1065.823) -- 0:00:27
592500 -- (-1065.226) (-1062.077) (-1072.389) [-1063.712] * (-1065.741) [-1065.438] (-1062.663) (-1065.291) -- 0:00:27
593000 -- (-1065.199) (-1063.920) [-1065.347] (-1066.338) * (-1062.725) (-1065.702) [-1061.696] (-1066.561) -- 0:00:27
593500 -- (-1063.880) (-1068.294) (-1066.687) [-1063.180] * [-1063.761] (-1066.236) (-1062.042) (-1063.662) -- 0:00:27
594000 -- [-1063.206] (-1065.771) (-1066.534) (-1068.017) * [-1068.424] (-1065.535) (-1061.782) (-1065.218) -- 0:00:27
594500 -- (-1066.256) (-1065.896) [-1063.690] (-1062.150) * (-1067.837) (-1062.864) (-1066.906) [-1062.219] -- 0:00:27
595000 -- (-1065.894) (-1065.281) [-1065.441] (-1063.103) * (-1066.015) (-1062.616) [-1061.825] (-1064.020) -- 0:00:27
Average standard deviation of split frequencies: 0.008068
595500 -- (-1066.417) [-1063.654] (-1069.077) (-1067.745) * [-1063.151] (-1065.167) (-1062.881) (-1067.236) -- 0:00:27
596000 -- [-1062.883] (-1066.607) (-1064.891) (-1068.610) * (-1061.657) [-1063.485] (-1063.882) (-1064.596) -- 0:00:27
596500 -- (-1064.080) [-1063.365] (-1066.413) (-1064.874) * (-1065.095) [-1065.085] (-1067.232) (-1066.216) -- 0:00:27
597000 -- (-1065.853) (-1064.057) [-1066.983] (-1062.957) * [-1061.338] (-1063.545) (-1063.566) (-1065.510) -- 0:00:27
597500 -- (-1065.833) (-1064.067) [-1066.256] (-1064.245) * (-1063.276) [-1066.056] (-1063.486) (-1063.226) -- 0:00:26
598000 -- (-1065.679) (-1062.254) (-1064.613) [-1063.038] * (-1062.121) (-1069.440) (-1065.340) [-1065.862] -- 0:00:26
598500 -- (-1067.381) (-1067.630) (-1062.473) [-1063.631] * (-1063.187) (-1068.759) [-1064.266] (-1066.888) -- 0:00:26
599000 -- (-1068.014) (-1064.724) (-1062.685) [-1063.108] * [-1065.474] (-1066.448) (-1060.659) (-1067.650) -- 0:00:26
599500 -- (-1065.316) (-1065.816) (-1063.647) [-1063.635] * (-1065.519) (-1065.204) [-1063.381] (-1066.900) -- 0:00:26
600000 -- (-1062.649) (-1064.679) (-1064.003) [-1066.718] * [-1064.666] (-1065.918) (-1062.005) (-1066.379) -- 0:00:26
Average standard deviation of split frequencies: 0.008685
600500 -- (-1067.684) [-1065.514] (-1064.296) (-1065.936) * (-1062.664) (-1062.463) [-1062.552] (-1067.874) -- 0:00:26
601000 -- (-1065.954) (-1062.630) (-1065.125) [-1064.309] * (-1065.499) (-1063.438) (-1063.420) [-1071.245] -- 0:00:26
601500 -- (-1074.958) (-1066.168) (-1062.721) [-1064.257] * [-1065.681] (-1065.293) (-1066.352) (-1067.139) -- 0:00:26
602000 -- (-1063.931) [-1063.248] (-1062.249) (-1066.975) * (-1064.022) (-1066.446) [-1064.729] (-1070.351) -- 0:00:26
602500 -- (-1065.634) (-1064.942) [-1065.168] (-1065.306) * (-1064.251) [-1063.576] (-1063.731) (-1067.757) -- 0:00:26
603000 -- [-1062.011] (-1065.150) (-1062.708) (-1064.261) * (-1066.240) [-1062.338] (-1065.332) (-1066.856) -- 0:00:26
603500 -- (-1064.782) [-1065.835] (-1063.063) (-1064.615) * (-1068.387) (-1065.243) [-1063.975] (-1065.469) -- 0:00:26
604000 -- (-1068.471) (-1067.512) [-1064.408] (-1061.920) * (-1066.599) (-1061.775) (-1062.704) [-1065.016] -- 0:00:26
604500 -- (-1064.793) (-1065.500) (-1065.404) [-1064.108] * (-1065.827) [-1062.831] (-1061.421) (-1066.869) -- 0:00:26
605000 -- [-1064.791] (-1066.956) (-1062.479) (-1064.973) * (-1062.468) [-1062.584] (-1060.693) (-1070.534) -- 0:00:26
Average standard deviation of split frequencies: 0.008401
605500 -- (-1061.716) (-1066.306) (-1062.380) [-1063.439] * (-1066.397) (-1062.995) [-1064.093] (-1070.947) -- 0:00:26
606000 -- [-1065.689] (-1066.188) (-1065.429) (-1064.472) * (-1064.655) (-1064.111) [-1060.785] (-1066.515) -- 0:00:26
606500 -- (-1066.284) [-1068.012] (-1063.749) (-1064.841) * (-1067.783) [-1062.061] (-1065.519) (-1065.570) -- 0:00:26
607000 -- [-1064.516] (-1066.203) (-1062.769) (-1063.202) * (-1068.532) [-1063.524] (-1064.158) (-1065.415) -- 0:00:26
607500 -- (-1066.623) (-1068.018) [-1061.267] (-1063.289) * (-1065.547) [-1062.957] (-1065.076) (-1064.477) -- 0:00:26
608000 -- (-1062.653) (-1067.297) [-1064.833] (-1063.547) * (-1068.085) [-1063.213] (-1063.665) (-1065.790) -- 0:00:26
608500 -- [-1063.048] (-1064.117) (-1066.674) (-1069.591) * (-1065.514) (-1062.776) [-1063.649] (-1064.436) -- 0:00:26
609000 -- [-1064.695] (-1062.985) (-1063.373) (-1071.227) * (-1064.907) (-1064.481) [-1062.380] (-1064.176) -- 0:00:26
609500 -- (-1064.511) (-1064.922) [-1063.042] (-1065.721) * (-1064.116) (-1062.320) [-1063.241] (-1065.416) -- 0:00:26
610000 -- (-1064.699) (-1064.038) [-1064.164] (-1066.388) * (-1063.811) (-1067.856) [-1062.977] (-1075.958) -- 0:00:26
Average standard deviation of split frequencies: 0.007822
610500 -- [-1065.587] (-1069.120) (-1061.817) (-1065.036) * [-1065.686] (-1063.260) (-1064.195) (-1067.967) -- 0:00:26
611000 -- (-1065.312) (-1067.255) [-1061.778] (-1067.755) * (-1067.198) (-1065.242) [-1066.152] (-1065.091) -- 0:00:26
611500 -- [-1063.333] (-1063.256) (-1067.063) (-1063.925) * (-1066.944) [-1066.304] (-1065.754) (-1063.059) -- 0:00:26
612000 -- [-1064.835] (-1063.914) (-1062.431) (-1066.362) * (-1064.968) (-1066.192) [-1066.703] (-1061.729) -- 0:00:25
612500 -- (-1068.786) (-1062.473) (-1062.580) [-1065.068] * (-1070.433) (-1068.322) [-1067.548] (-1062.152) -- 0:00:25
613000 -- (-1066.191) (-1064.013) [-1063.026] (-1066.717) * (-1064.803) (-1064.249) (-1065.720) [-1062.309] -- 0:00:25
613500 -- (-1062.815) [-1064.128] (-1062.029) (-1066.100) * (-1065.305) (-1061.125) (-1063.909) [-1063.903] -- 0:00:25
614000 -- (-1064.575) [-1065.751] (-1061.065) (-1063.698) * (-1062.189) (-1063.772) (-1068.799) [-1064.038] -- 0:00:25
614500 -- [-1062.986] (-1062.514) (-1065.135) (-1066.624) * (-1064.047) (-1064.282) [-1065.643] (-1069.095) -- 0:00:25
615000 -- (-1061.610) (-1064.649) [-1063.929] (-1063.870) * (-1064.052) [-1062.552] (-1061.950) (-1063.439) -- 0:00:25
Average standard deviation of split frequencies: 0.007755
615500 -- (-1061.944) (-1065.582) [-1063.542] (-1065.323) * (-1064.865) [-1062.320] (-1065.433) (-1066.806) -- 0:00:25
616000 -- [-1060.868] (-1064.761) (-1065.595) (-1063.876) * (-1065.945) (-1064.822) [-1065.217] (-1063.103) -- 0:00:25
616500 -- [-1062.132] (-1065.025) (-1066.859) (-1067.007) * (-1064.094) (-1064.208) [-1064.351] (-1064.927) -- 0:00:25
617000 -- (-1067.718) (-1067.516) (-1065.487) [-1062.119] * [-1063.099] (-1066.866) (-1062.887) (-1064.737) -- 0:00:25
617500 -- (-1064.784) [-1065.334] (-1063.087) (-1063.715) * [-1067.076] (-1063.894) (-1063.626) (-1066.148) -- 0:00:25
618000 -- (-1063.123) (-1065.141) [-1062.117] (-1065.014) * (-1067.401) (-1064.380) [-1064.075] (-1062.505) -- 0:00:25
618500 -- (-1064.974) [-1065.060] (-1066.074) (-1070.060) * (-1064.720) [-1064.914] (-1064.021) (-1066.843) -- 0:00:25
619000 -- [-1063.807] (-1069.001) (-1062.462) (-1064.995) * (-1065.626) [-1065.201] (-1063.908) (-1065.748) -- 0:00:25
619500 -- (-1063.968) (-1064.973) (-1063.220) [-1067.500] * (-1061.744) (-1071.523) (-1065.810) [-1065.212] -- 0:00:25
620000 -- [-1062.881] (-1060.734) (-1062.638) (-1063.842) * [-1061.532] (-1064.113) (-1066.231) (-1067.404) -- 0:00:25
Average standard deviation of split frequencies: 0.007848
620500 -- (-1067.055) (-1062.992) [-1062.618] (-1067.348) * (-1065.310) [-1064.837] (-1067.335) (-1067.356) -- 0:00:25
621000 -- (-1066.371) (-1065.568) [-1062.015] (-1062.608) * [-1061.654] (-1064.708) (-1063.724) (-1064.924) -- 0:00:25
621500 -- [-1062.952] (-1065.321) (-1064.461) (-1061.478) * (-1064.686) (-1063.506) (-1063.910) [-1063.565] -- 0:00:25
622000 -- (-1063.384) (-1065.857) (-1063.341) [-1061.006] * [-1062.504] (-1061.927) (-1062.973) (-1067.898) -- 0:00:25
622500 -- (-1070.438) (-1065.287) [-1065.167] (-1066.892) * (-1068.329) (-1069.346) (-1063.662) [-1063.478] -- 0:00:25
623000 -- (-1063.129) (-1066.092) (-1066.735) [-1062.970] * (-1063.468) [-1066.835] (-1062.457) (-1064.739) -- 0:00:25
623500 -- (-1063.755) (-1067.692) (-1065.899) [-1062.869] * (-1065.069) (-1066.941) [-1065.662] (-1065.923) -- 0:00:25
624000 -- (-1061.833) (-1063.938) (-1066.214) [-1066.090] * (-1063.713) (-1066.283) [-1066.016] (-1064.887) -- 0:00:25
624500 -- [-1062.600] (-1063.020) (-1065.567) (-1063.623) * (-1064.279) (-1064.742) [-1062.308] (-1064.954) -- 0:00:25
625000 -- (-1063.715) (-1064.549) [-1065.655] (-1064.204) * (-1065.423) [-1062.635] (-1062.446) (-1062.057) -- 0:00:25
Average standard deviation of split frequencies: 0.008434
625500 -- (-1070.166) [-1064.975] (-1065.754) (-1063.839) * [-1064.822] (-1065.374) (-1065.379) (-1064.579) -- 0:00:25
626000 -- (-1067.188) (-1063.252) (-1065.179) [-1062.970] * (-1064.469) (-1066.353) [-1062.315] (-1062.475) -- 0:00:25
626500 -- (-1066.556) (-1062.737) (-1063.884) [-1064.569] * (-1072.625) (-1064.004) [-1063.223] (-1064.926) -- 0:00:25
627000 -- (-1061.548) (-1064.502) [-1067.075] (-1064.398) * [-1061.595] (-1065.032) (-1064.857) (-1067.030) -- 0:00:24
627500 -- (-1061.898) (-1068.426) [-1062.789] (-1066.919) * (-1066.331) (-1062.180) (-1063.466) [-1069.466] -- 0:00:24
628000 -- (-1065.341) (-1067.138) [-1064.731] (-1063.655) * [-1061.215] (-1063.710) (-1064.131) (-1068.541) -- 0:00:24
628500 -- (-1064.392) (-1066.556) (-1065.823) [-1062.540] * (-1062.492) [-1064.630] (-1062.757) (-1065.248) -- 0:00:24
629000 -- (-1063.204) (-1065.525) (-1063.858) [-1062.613] * (-1062.101) (-1062.764) (-1062.223) [-1062.975] -- 0:00:24
629500 -- (-1061.312) (-1065.050) (-1064.762) [-1066.045] * (-1063.821) (-1066.959) [-1063.192] (-1064.849) -- 0:00:24
630000 -- (-1063.705) [-1063.359] (-1066.818) (-1066.223) * (-1063.525) (-1063.945) (-1063.502) [-1061.795] -- 0:00:24
Average standard deviation of split frequencies: 0.008671
630500 -- (-1062.707) (-1062.723) (-1064.013) [-1063.506] * [-1062.827] (-1065.427) (-1064.417) (-1063.263) -- 0:00:24
631000 -- (-1063.073) [-1064.016] (-1065.790) (-1064.577) * (-1066.857) [-1063.858] (-1064.870) (-1067.202) -- 0:00:24
631500 -- (-1064.727) (-1069.721) [-1064.831] (-1062.481) * (-1067.569) [-1065.530] (-1067.489) (-1064.866) -- 0:00:24
632000 -- [-1065.216] (-1071.797) (-1064.779) (-1065.506) * [-1063.873] (-1065.451) (-1063.515) (-1064.755) -- 0:00:24
632500 -- (-1062.948) (-1068.573) (-1064.700) [-1066.734] * [-1063.345] (-1065.961) (-1063.715) (-1065.571) -- 0:00:24
633000 -- [-1063.569] (-1068.572) (-1066.408) (-1066.153) * [-1061.562] (-1064.505) (-1064.248) (-1064.284) -- 0:00:24
633500 -- (-1066.834) [-1065.244] (-1075.131) (-1064.355) * [-1063.244] (-1064.908) (-1063.581) (-1064.338) -- 0:00:24
634000 -- (-1064.149) (-1064.050) [-1067.255] (-1062.257) * [-1061.777] (-1064.236) (-1071.272) (-1063.175) -- 0:00:24
634500 -- (-1065.647) (-1065.768) (-1067.472) [-1067.007] * (-1064.760) [-1063.907] (-1068.298) (-1067.033) -- 0:00:24
635000 -- [-1065.524] (-1065.530) (-1067.411) (-1063.334) * (-1067.967) (-1062.670) [-1062.976] (-1064.043) -- 0:00:24
Average standard deviation of split frequencies: 0.007922
635500 -- (-1065.624) (-1062.440) [-1064.936] (-1064.692) * (-1067.990) [-1063.719] (-1063.473) (-1065.279) -- 0:00:24
636000 -- (-1062.345) [-1065.154] (-1064.206) (-1063.469) * (-1061.744) (-1063.516) [-1062.370] (-1062.603) -- 0:00:24
636500 -- [-1060.991] (-1064.484) (-1063.556) (-1065.423) * (-1064.321) [-1063.139] (-1066.633) (-1068.091) -- 0:00:24
637000 -- (-1063.860) (-1065.714) (-1064.214) [-1063.639] * (-1062.588) (-1063.819) (-1068.234) [-1064.139] -- 0:00:24
637500 -- [-1062.452] (-1067.457) (-1063.612) (-1062.894) * (-1063.523) (-1062.960) (-1063.522) [-1064.745] -- 0:00:24
638000 -- (-1064.738) [-1066.148] (-1067.576) (-1065.948) * (-1063.301) (-1065.003) [-1064.744] (-1063.426) -- 0:00:24
638500 -- (-1064.505) (-1065.407) [-1063.311] (-1063.246) * (-1065.001) [-1066.364] (-1070.722) (-1066.298) -- 0:00:24
639000 -- (-1063.939) [-1066.729] (-1065.230) (-1062.736) * (-1062.420) (-1063.328) [-1062.976] (-1065.685) -- 0:00:24
639500 -- [-1066.957] (-1067.429) (-1063.959) (-1062.129) * [-1061.223] (-1065.985) (-1065.554) (-1063.646) -- 0:00:24
640000 -- (-1062.705) [-1066.220] (-1063.808) (-1063.881) * (-1071.024) (-1068.209) (-1064.696) [-1063.363] -- 0:00:24
Average standard deviation of split frequencies: 0.007898
640500 -- (-1065.391) [-1062.082] (-1064.481) (-1063.748) * (-1069.504) (-1066.270) [-1063.902] (-1065.485) -- 0:00:24
641000 -- [-1064.073] (-1062.449) (-1066.834) (-1069.859) * [-1065.906] (-1064.340) (-1064.387) (-1064.870) -- 0:00:24
641500 -- (-1065.159) (-1063.868) (-1063.077) [-1065.305] * (-1063.217) (-1064.270) (-1067.874) [-1063.648] -- 0:00:24
642000 -- (-1063.116) (-1060.547) (-1065.868) [-1063.954] * [-1063.933] (-1062.652) (-1064.183) (-1064.116) -- 0:00:23
642500 -- (-1064.122) (-1062.788) [-1067.448] (-1065.312) * [-1063.426] (-1065.334) (-1065.041) (-1064.110) -- 0:00:23
643000 -- (-1070.423) (-1066.791) [-1064.937] (-1064.778) * (-1065.144) [-1064.000] (-1065.755) (-1067.032) -- 0:00:23
643500 -- [-1066.813] (-1062.112) (-1065.367) (-1063.625) * (-1064.097) (-1066.411) (-1065.339) [-1064.285] -- 0:00:23
644000 -- (-1065.744) (-1064.888) [-1063.669] (-1064.158) * (-1063.839) (-1067.318) (-1065.970) [-1065.024] -- 0:00:23
644500 -- (-1065.441) [-1063.267] (-1067.529) (-1067.402) * (-1064.174) (-1066.619) (-1064.990) [-1064.636] -- 0:00:23
645000 -- (-1065.329) (-1061.676) (-1069.300) [-1064.301] * (-1064.817) (-1064.665) [-1066.135] (-1065.076) -- 0:00:23
Average standard deviation of split frequencies: 0.008164
645500 -- (-1069.418) [-1063.433] (-1069.921) (-1064.161) * (-1061.833) [-1064.689] (-1064.296) (-1065.843) -- 0:00:23
646000 -- (-1065.871) (-1062.101) [-1063.539] (-1062.576) * (-1064.119) (-1065.795) (-1064.479) [-1069.004] -- 0:00:23
646500 -- (-1064.385) (-1066.866) [-1065.106] (-1063.703) * (-1063.945) [-1068.727] (-1066.220) (-1063.204) -- 0:00:23
647000 -- (-1063.936) (-1063.937) [-1064.935] (-1062.694) * (-1065.240) (-1065.296) [-1064.601] (-1064.448) -- 0:00:23
647500 -- [-1066.003] (-1065.675) (-1066.635) (-1064.993) * [-1062.048] (-1063.408) (-1062.496) (-1062.723) -- 0:00:23
648000 -- [-1064.622] (-1063.994) (-1062.073) (-1062.328) * [-1066.313] (-1063.936) (-1067.185) (-1063.089) -- 0:00:23
648500 -- (-1066.300) (-1067.298) (-1062.859) [-1062.231] * (-1064.720) [-1064.911] (-1068.370) (-1065.876) -- 0:00:23
649000 -- (-1065.500) (-1069.680) [-1064.879] (-1062.733) * [-1063.227] (-1063.086) (-1069.844) (-1066.970) -- 0:00:23
649500 -- (-1066.136) [-1063.768] (-1062.815) (-1066.231) * (-1062.211) [-1068.482] (-1065.741) (-1070.674) -- 0:00:23
650000 -- (-1065.169) [-1062.424] (-1069.048) (-1061.973) * [-1064.775] (-1064.604) (-1067.739) (-1063.395) -- 0:00:23
Average standard deviation of split frequencies: 0.007698
650500 -- (-1063.367) [-1064.989] (-1063.572) (-1065.989) * (-1063.241) (-1066.019) [-1066.289] (-1065.274) -- 0:00:23
651000 -- (-1063.408) [-1063.350] (-1063.626) (-1062.942) * (-1069.441) [-1064.672] (-1067.110) (-1065.994) -- 0:00:23
651500 -- (-1065.763) [-1063.698] (-1063.187) (-1065.652) * [-1065.371] (-1063.058) (-1064.081) (-1066.956) -- 0:00:23
652000 -- (-1064.777) (-1063.638) (-1064.741) [-1064.036] * (-1064.143) (-1063.904) (-1066.574) [-1065.294] -- 0:00:23
652500 -- (-1063.945) [-1064.333] (-1066.118) (-1066.348) * [-1062.746] (-1067.646) (-1064.397) (-1063.245) -- 0:00:23
653000 -- (-1066.717) [-1063.462] (-1066.651) (-1064.767) * (-1062.883) (-1065.027) (-1065.137) [-1065.009] -- 0:00:23
653500 -- (-1065.024) (-1065.500) (-1064.904) [-1062.657] * (-1062.338) (-1063.776) [-1063.474] (-1063.853) -- 0:00:23
654000 -- (-1063.363) (-1065.211) [-1062.463] (-1062.994) * (-1063.844) (-1061.524) (-1065.926) [-1062.671] -- 0:00:23
654500 -- [-1065.032] (-1066.233) (-1064.447) (-1062.846) * (-1065.987) (-1066.418) (-1068.696) [-1062.750] -- 0:00:23
655000 -- (-1064.761) (-1066.094) (-1064.883) [-1065.490] * (-1067.281) (-1065.783) (-1063.670) [-1063.228] -- 0:00:23
Average standard deviation of split frequencies: 0.007815
655500 -- (-1071.415) (-1062.636) (-1066.762) [-1065.066] * (-1065.349) (-1064.197) (-1067.494) [-1064.341] -- 0:00:23
656000 -- (-1065.031) (-1063.563) [-1064.299] (-1067.809) * [-1064.143] (-1061.966) (-1067.061) (-1064.048) -- 0:00:23
656500 -- [-1067.032] (-1064.230) (-1067.156) (-1063.947) * (-1064.762) (-1063.128) [-1066.460] (-1065.585) -- 0:00:23
657000 -- (-1065.978) (-1060.689) [-1065.892] (-1063.277) * [-1063.786] (-1063.758) (-1069.461) (-1066.087) -- 0:00:22
657500 -- [-1065.807] (-1063.420) (-1066.315) (-1064.081) * (-1063.397) [-1064.850] (-1065.082) (-1065.251) -- 0:00:22
658000 -- (-1065.905) (-1065.384) [-1064.963] (-1065.808) * (-1063.012) [-1064.607] (-1065.470) (-1063.185) -- 0:00:22
658500 -- (-1064.346) (-1071.552) (-1065.416) [-1063.245] * (-1063.639) [-1069.528] (-1068.201) (-1064.045) -- 0:00:22
659000 -- (-1067.085) [-1068.923] (-1069.913) (-1063.398) * (-1063.807) [-1067.125] (-1070.179) (-1066.052) -- 0:00:22
659500 -- (-1069.631) [-1062.145] (-1068.699) (-1064.237) * (-1065.438) [-1065.727] (-1065.560) (-1064.818) -- 0:00:22
660000 -- (-1070.688) (-1065.892) [-1066.632] (-1062.785) * (-1071.387) (-1066.352) [-1065.701] (-1064.727) -- 0:00:22
Average standard deviation of split frequencies: 0.007849
660500 -- (-1066.870) (-1064.719) (-1068.056) [-1063.777] * (-1063.014) (-1063.838) (-1065.375) [-1065.998] -- 0:00:22
661000 -- [-1064.136] (-1065.783) (-1066.974) (-1064.610) * [-1066.955] (-1064.254) (-1064.767) (-1065.621) -- 0:00:22
661500 -- [-1065.263] (-1061.999) (-1064.928) (-1062.612) * (-1066.713) (-1071.641) [-1064.161] (-1067.267) -- 0:00:22
662000 -- [-1064.285] (-1062.562) (-1064.719) (-1066.018) * (-1063.145) [-1062.495] (-1067.260) (-1069.632) -- 0:00:22
662500 -- (-1063.067) (-1062.980) (-1064.637) [-1062.993] * (-1065.671) (-1065.865) (-1066.909) [-1063.316] -- 0:00:22
663000 -- [-1061.632] (-1068.260) (-1064.867) (-1061.537) * [-1063.529] (-1063.067) (-1066.991) (-1065.492) -- 0:00:22
663500 -- (-1064.550) (-1065.332) [-1061.641] (-1065.956) * (-1061.987) [-1063.674] (-1066.428) (-1064.546) -- 0:00:22
664000 -- (-1063.275) (-1064.241) (-1062.176) [-1066.961] * (-1069.353) (-1067.334) (-1065.292) [-1065.046] -- 0:00:22
664500 -- (-1066.672) (-1065.524) [-1066.646] (-1065.112) * (-1069.281) (-1062.157) [-1071.506] (-1065.369) -- 0:00:22
665000 -- (-1064.932) (-1069.260) (-1064.631) [-1063.076] * (-1074.662) (-1064.621) [-1063.966] (-1066.733) -- 0:00:22
Average standard deviation of split frequencies: 0.007167
665500 -- [-1064.001] (-1063.591) (-1063.671) (-1066.849) * (-1066.656) (-1062.334) (-1067.856) [-1064.586] -- 0:00:22
666000 -- (-1064.136) (-1064.463) (-1061.889) [-1062.482] * (-1064.634) (-1064.181) [-1066.455] (-1065.892) -- 0:00:22
666500 -- (-1063.305) (-1061.550) [-1062.942] (-1066.008) * (-1065.370) (-1068.324) [-1066.795] (-1066.186) -- 0:00:22
667000 -- (-1064.833) [-1062.312] (-1065.307) (-1065.001) * (-1062.628) (-1065.181) [-1063.208] (-1065.249) -- 0:00:22
667500 -- (-1062.908) (-1063.295) (-1066.455) [-1064.720] * (-1063.515) (-1065.405) [-1064.128] (-1064.634) -- 0:00:22
668000 -- [-1061.293] (-1063.306) (-1064.654) (-1062.884) * [-1062.498] (-1062.570) (-1063.481) (-1065.183) -- 0:00:22
668500 -- [-1061.850] (-1066.670) (-1061.846) (-1062.937) * (-1061.724) (-1065.987) (-1065.659) [-1064.793] -- 0:00:22
669000 -- (-1066.603) [-1065.216] (-1061.968) (-1067.348) * (-1064.877) (-1065.587) (-1063.990) [-1070.575] -- 0:00:22
669500 -- (-1064.343) (-1063.404) [-1065.609] (-1066.395) * (-1069.221) (-1065.099) [-1063.834] (-1063.296) -- 0:00:22
670000 -- (-1062.815) (-1063.201) [-1063.639] (-1065.142) * (-1065.965) (-1062.103) (-1062.747) [-1065.409] -- 0:00:22
Average standard deviation of split frequencies: 0.007380
670500 -- (-1063.353) (-1063.353) (-1064.910) [-1063.048] * (-1063.197) (-1064.641) (-1064.124) [-1063.603] -- 0:00:22
671000 -- (-1064.998) (-1064.297) (-1066.337) [-1060.460] * (-1064.310) (-1062.054) [-1062.497] (-1066.902) -- 0:00:22
671500 -- (-1065.120) (-1064.890) [-1064.119] (-1064.135) * [-1063.012] (-1061.193) (-1063.932) (-1069.390) -- 0:00:22
672000 -- (-1066.693) (-1064.227) (-1071.088) [-1064.040] * (-1064.098) (-1065.820) (-1063.599) [-1065.538] -- 0:00:21
672500 -- (-1062.733) [-1068.211] (-1072.092) (-1070.749) * (-1064.004) (-1061.673) (-1061.760) [-1070.031] -- 0:00:21
673000 -- (-1063.037) (-1062.024) [-1064.793] (-1061.441) * (-1063.558) (-1066.616) (-1064.924) [-1062.800] -- 0:00:21
673500 -- (-1065.714) [-1064.834] (-1066.364) (-1067.563) * (-1064.412) (-1066.381) (-1065.351) [-1064.196] -- 0:00:21
674000 -- [-1062.695] (-1065.747) (-1064.589) (-1062.344) * [-1064.450] (-1062.727) (-1063.764) (-1065.569) -- 0:00:21
674500 -- (-1066.500) [-1062.038] (-1071.132) (-1064.777) * (-1064.092) [-1062.726] (-1063.418) (-1065.054) -- 0:00:21
675000 -- (-1070.742) (-1066.352) [-1066.927] (-1064.997) * (-1063.293) [-1064.492] (-1066.876) (-1065.515) -- 0:00:21
Average standard deviation of split frequencies: 0.007496
675500 -- (-1064.881) (-1063.328) (-1063.933) [-1061.924] * (-1067.093) (-1062.109) [-1063.898] (-1069.550) -- 0:00:21
676000 -- [-1063.043] (-1063.145) (-1064.035) (-1066.919) * (-1065.346) (-1064.397) [-1064.250] (-1069.350) -- 0:00:21
676500 -- (-1064.790) [-1064.388] (-1062.083) (-1064.529) * (-1062.813) (-1067.078) (-1064.779) [-1063.358] -- 0:00:21
677000 -- (-1063.491) (-1064.904) (-1063.787) [-1064.192] * (-1062.985) (-1065.528) [-1067.340] (-1063.871) -- 0:00:21
677500 -- (-1065.836) (-1065.780) (-1064.552) [-1062.273] * (-1065.854) (-1066.348) (-1063.116) [-1066.061] -- 0:00:21
678000 -- (-1064.902) [-1064.321] (-1067.585) (-1067.260) * [-1064.637] (-1071.223) (-1063.931) (-1064.766) -- 0:00:21
678500 -- [-1063.288] (-1064.935) (-1064.645) (-1067.153) * (-1061.605) [-1060.974] (-1063.929) (-1063.283) -- 0:00:21
679000 -- (-1065.256) [-1066.023] (-1064.858) (-1065.511) * (-1065.005) [-1062.237] (-1064.972) (-1064.453) -- 0:00:21
679500 -- (-1061.780) (-1069.313) [-1062.089] (-1062.683) * (-1065.120) (-1063.364) [-1062.393] (-1065.301) -- 0:00:21
680000 -- (-1067.088) (-1066.722) [-1063.603] (-1064.304) * (-1063.699) (-1063.381) [-1064.100] (-1063.296) -- 0:00:21
Average standard deviation of split frequencies: 0.007661
680500 -- (-1063.828) (-1067.749) (-1064.877) [-1062.873] * [-1061.857] (-1061.579) (-1064.147) (-1063.322) -- 0:00:21
681000 -- (-1065.082) [-1067.612] (-1068.018) (-1066.007) * [-1065.084] (-1062.138) (-1065.459) (-1066.772) -- 0:00:21
681500 -- (-1062.622) (-1065.404) [-1064.861] (-1064.012) * [-1062.136] (-1062.890) (-1066.152) (-1064.129) -- 0:00:21
682000 -- (-1063.388) [-1063.226] (-1062.988) (-1062.158) * [-1063.358] (-1064.438) (-1070.475) (-1064.887) -- 0:00:21
682500 -- [-1064.511] (-1066.868) (-1065.364) (-1062.018) * (-1064.025) (-1067.972) [-1064.748] (-1065.010) -- 0:00:21
683000 -- (-1062.754) (-1064.594) (-1064.853) [-1062.042] * [-1064.130] (-1063.894) (-1064.457) (-1063.063) -- 0:00:21
683500 -- (-1064.278) (-1066.281) [-1061.694] (-1065.488) * (-1064.620) [-1065.130] (-1063.210) (-1065.337) -- 0:00:21
684000 -- (-1064.806) (-1065.725) [-1065.084] (-1065.573) * (-1063.263) [-1065.041] (-1062.720) (-1067.354) -- 0:00:21
684500 -- (-1061.762) (-1064.680) (-1062.941) [-1061.506] * (-1066.173) [-1063.984] (-1065.224) (-1066.352) -- 0:00:21
685000 -- (-1061.774) (-1065.518) [-1066.332] (-1066.451) * (-1067.305) (-1063.098) [-1063.504] (-1066.226) -- 0:00:21
Average standard deviation of split frequencies: 0.007946
685500 -- [-1068.104] (-1063.432) (-1066.088) (-1061.638) * (-1064.676) (-1062.272) [-1065.493] (-1065.966) -- 0:00:21
686000 -- (-1065.617) (-1064.505) [-1064.595] (-1064.302) * (-1062.784) [-1064.551] (-1066.692) (-1068.075) -- 0:00:21
686500 -- (-1066.586) (-1063.730) [-1061.356] (-1062.897) * (-1062.928) (-1062.884) [-1061.636] (-1067.033) -- 0:00:21
687000 -- (-1063.891) (-1065.837) (-1064.215) [-1061.128] * (-1064.681) (-1066.624) [-1064.490] (-1063.479) -- 0:00:20
687500 -- (-1064.312) (-1062.502) [-1062.824] (-1062.728) * (-1063.076) (-1063.348) [-1064.827] (-1064.352) -- 0:00:20
688000 -- (-1067.580) [-1069.142] (-1062.911) (-1062.369) * (-1063.181) (-1063.348) [-1063.939] (-1064.917) -- 0:00:20
688500 -- [-1063.124] (-1066.141) (-1063.692) (-1061.812) * (-1062.796) (-1063.812) (-1062.767) [-1064.154] -- 0:00:20
689000 -- (-1061.892) (-1064.025) [-1064.252] (-1063.154) * (-1062.143) (-1061.366) [-1065.332] (-1064.127) -- 0:00:20
689500 -- [-1061.644] (-1065.091) (-1063.059) (-1065.851) * (-1062.443) (-1066.978) [-1063.716] (-1063.819) -- 0:00:20
690000 -- (-1063.344) (-1064.984) (-1066.842) [-1067.117] * (-1062.213) (-1066.517) (-1065.195) [-1064.003] -- 0:00:20
Average standard deviation of split frequencies: 0.008148
690500 -- (-1064.701) (-1067.166) [-1065.354] (-1064.084) * (-1065.560) (-1068.842) [-1064.438] (-1067.472) -- 0:00:20
691000 -- [-1063.326] (-1064.062) (-1065.483) (-1062.343) * (-1063.716) (-1068.920) (-1062.884) [-1063.505] -- 0:00:20
691500 -- (-1064.218) (-1063.922) (-1066.115) [-1061.267] * (-1066.960) (-1063.560) [-1062.833] (-1064.084) -- 0:00:20
692000 -- (-1062.337) (-1064.918) [-1063.821] (-1064.189) * [-1066.918] (-1064.061) (-1063.910) (-1067.204) -- 0:00:20
692500 -- [-1065.719] (-1063.678) (-1062.999) (-1064.077) * (-1070.153) [-1063.186] (-1064.100) (-1066.177) -- 0:00:20
693000 -- (-1064.814) (-1066.160) (-1063.838) [-1062.137] * (-1062.644) [-1061.620] (-1065.703) (-1064.077) -- 0:00:20
693500 -- [-1063.403] (-1067.655) (-1064.742) (-1063.230) * (-1063.941) (-1061.713) (-1062.597) [-1063.045] -- 0:00:20
694000 -- (-1067.243) (-1064.165) [-1062.847] (-1061.001) * (-1063.228) (-1065.838) [-1062.126] (-1062.689) -- 0:00:20
694500 -- (-1062.401) (-1063.171) [-1063.031] (-1061.014) * (-1062.559) [-1063.433] (-1064.482) (-1061.971) -- 0:00:20
695000 -- (-1065.647) (-1064.170) [-1067.697] (-1065.124) * (-1062.157) [-1066.198] (-1064.461) (-1064.956) -- 0:00:20
Average standard deviation of split frequencies: 0.008128
695500 -- (-1064.216) [-1063.599] (-1062.942) (-1067.168) * [-1061.598] (-1063.305) (-1064.409) (-1066.592) -- 0:00:20
696000 -- (-1063.957) (-1063.931) [-1062.013] (-1066.318) * (-1064.246) [-1063.987] (-1065.204) (-1072.113) -- 0:00:20
696500 -- (-1064.636) (-1067.336) (-1066.338) [-1064.704] * [-1062.174] (-1062.594) (-1064.833) (-1064.326) -- 0:00:20
697000 -- (-1064.663) (-1063.385) [-1063.805] (-1069.030) * (-1066.773) (-1066.988) (-1064.338) [-1067.889] -- 0:00:20
697500 -- (-1063.518) [-1062.917] (-1066.416) (-1063.551) * (-1060.789) [-1063.842] (-1065.660) (-1064.123) -- 0:00:20
698000 -- (-1063.232) (-1061.762) (-1063.238) [-1064.001] * (-1062.344) (-1064.445) [-1063.527] (-1065.267) -- 0:00:20
698500 -- (-1064.914) (-1066.034) (-1063.423) [-1064.637] * (-1060.152) (-1064.892) (-1070.108) [-1063.008] -- 0:00:20
699000 -- [-1064.045] (-1063.269) (-1064.476) (-1065.859) * (-1062.370) (-1063.727) (-1065.496) [-1066.379] -- 0:00:20
699500 -- (-1062.940) [-1063.366] (-1065.179) (-1066.487) * (-1061.370) [-1063.208] (-1066.321) (-1063.726) -- 0:00:20
700000 -- (-1064.744) (-1062.085) [-1064.805] (-1064.739) * (-1062.527) (-1065.692) [-1063.107] (-1066.823) -- 0:00:20
Average standard deviation of split frequencies: 0.007821
700500 -- (-1067.329) [-1062.157] (-1063.708) (-1062.908) * (-1063.007) (-1062.421) (-1065.606) [-1065.398] -- 0:00:20
701000 -- (-1063.269) [-1062.311] (-1064.878) (-1063.750) * (-1062.511) (-1063.728) (-1071.000) [-1063.986] -- 0:00:20
701500 -- (-1066.527) [-1063.409] (-1066.073) (-1065.188) * (-1061.508) (-1064.350) (-1065.349) [-1068.195] -- 0:00:19
702000 -- (-1063.007) (-1063.740) [-1065.113] (-1065.689) * [-1062.933] (-1063.702) (-1065.368) (-1064.744) -- 0:00:19
702500 -- [-1062.867] (-1064.240) (-1064.310) (-1066.827) * (-1062.946) (-1066.362) [-1065.509] (-1063.720) -- 0:00:19
703000 -- (-1063.046) [-1064.917] (-1063.633) (-1067.045) * [-1065.024] (-1068.304) (-1068.248) (-1065.918) -- 0:00:19
703500 -- (-1064.411) [-1063.390] (-1064.513) (-1065.235) * (-1066.299) (-1066.397) [-1067.609] (-1066.047) -- 0:00:19
704000 -- (-1065.054) (-1063.583) (-1064.086) [-1063.397] * (-1065.988) [-1067.080] (-1063.838) (-1064.429) -- 0:00:19
704500 -- (-1068.439) (-1064.268) [-1062.505] (-1064.432) * (-1064.083) [-1064.482] (-1066.760) (-1061.973) -- 0:00:19
705000 -- [-1064.701] (-1066.796) (-1064.846) (-1063.739) * (-1063.874) (-1064.724) (-1068.702) [-1065.491] -- 0:00:19
Average standard deviation of split frequencies: 0.007720
705500 -- (-1066.405) (-1064.303) [-1061.787] (-1068.768) * (-1061.825) (-1063.500) [-1064.163] (-1063.056) -- 0:00:19
706000 -- (-1065.178) [-1065.446] (-1063.737) (-1067.458) * (-1067.876) [-1065.220] (-1064.259) (-1068.624) -- 0:00:19
706500 -- [-1062.637] (-1064.505) (-1062.476) (-1064.037) * [-1063.273] (-1063.846) (-1066.089) (-1062.752) -- 0:00:19
707000 -- (-1065.662) (-1062.360) [-1063.009] (-1062.978) * (-1065.159) (-1067.388) [-1064.549] (-1065.252) -- 0:00:19
707500 -- [-1066.307] (-1063.717) (-1063.076) (-1064.497) * (-1065.147) [-1065.068] (-1062.093) (-1063.775) -- 0:00:19
708000 -- [-1066.167] (-1066.548) (-1061.508) (-1064.884) * (-1067.868) (-1065.689) (-1064.814) [-1062.651] -- 0:00:19
708500 -- [-1065.148] (-1065.537) (-1065.202) (-1068.074) * (-1067.296) (-1063.976) [-1061.903] (-1062.586) -- 0:00:19
709000 -- [-1062.954] (-1063.508) (-1063.207) (-1065.435) * [-1065.757] (-1064.620) (-1066.259) (-1065.669) -- 0:00:19
709500 -- [-1062.220] (-1066.042) (-1062.208) (-1062.053) * (-1070.494) (-1065.003) [-1065.652] (-1064.694) -- 0:00:19
710000 -- (-1065.239) (-1067.093) [-1061.855] (-1065.374) * [-1066.190] (-1064.461) (-1063.015) (-1065.233) -- 0:00:19
Average standard deviation of split frequencies: 0.007504
710500 -- (-1063.905) [-1066.420] (-1064.137) (-1062.889) * [-1064.428] (-1066.562) (-1063.967) (-1064.149) -- 0:00:19
711000 -- [-1067.678] (-1065.401) (-1064.453) (-1067.647) * (-1066.978) (-1062.944) (-1065.274) [-1066.237] -- 0:00:19
711500 -- [-1065.769] (-1065.259) (-1068.114) (-1065.391) * [-1065.909] (-1064.536) (-1061.571) (-1064.443) -- 0:00:19
712000 -- (-1067.298) (-1066.492) [-1063.501] (-1065.020) * (-1063.556) (-1062.704) (-1063.625) [-1063.254] -- 0:00:19
712500 -- (-1066.813) [-1064.183] (-1063.426) (-1068.132) * (-1069.638) (-1063.598) [-1065.549] (-1064.717) -- 0:00:19
713000 -- (-1066.820) [-1066.486] (-1063.306) (-1066.430) * (-1066.728) (-1063.755) [-1063.267] (-1062.143) -- 0:00:19
713500 -- (-1064.857) (-1066.238) (-1061.704) [-1062.850] * (-1066.832) [-1063.666] (-1065.649) (-1068.147) -- 0:00:19
714000 -- (-1062.620) (-1065.504) (-1063.371) [-1064.631] * [-1066.170] (-1062.344) (-1064.334) (-1064.866) -- 0:00:19
714500 -- (-1063.631) [-1065.266] (-1066.039) (-1065.279) * [-1064.168] (-1066.247) (-1064.181) (-1063.113) -- 0:00:19
715000 -- (-1062.049) (-1064.919) [-1066.778] (-1066.315) * (-1066.745) [-1067.665] (-1065.656) (-1064.959) -- 0:00:19
Average standard deviation of split frequencies: 0.007613
715500 -- [-1065.555] (-1065.698) (-1066.373) (-1063.807) * (-1065.487) [-1064.325] (-1065.818) (-1064.449) -- 0:00:19
716000 -- (-1070.189) (-1062.978) (-1067.288) [-1063.314] * (-1065.102) [-1065.820] (-1064.413) (-1067.873) -- 0:00:19
716500 -- (-1074.547) (-1066.964) (-1064.702) [-1062.605] * (-1065.616) (-1063.772) (-1065.062) [-1063.474] -- 0:00:18
717000 -- (-1066.111) [-1064.958] (-1064.287) (-1066.790) * (-1065.614) [-1063.679] (-1064.006) (-1065.697) -- 0:00:18
717500 -- (-1066.325) (-1065.567) (-1062.884) [-1068.449] * (-1065.149) (-1067.353) (-1064.144) [-1068.677] -- 0:00:18
718000 -- (-1065.429) (-1065.393) [-1063.093] (-1064.504) * (-1064.157) (-1062.740) [-1064.603] (-1068.043) -- 0:00:18
718500 -- (-1070.255) [-1063.724] (-1066.613) (-1066.517) * (-1064.446) (-1063.721) [-1062.263] (-1068.215) -- 0:00:18
719000 -- [-1066.273] (-1066.808) (-1065.556) (-1067.004) * (-1063.913) (-1062.168) [-1064.001] (-1064.829) -- 0:00:18
719500 -- (-1073.108) (-1067.097) (-1067.420) [-1066.215] * (-1065.126) [-1062.365] (-1064.454) (-1064.053) -- 0:00:18
720000 -- (-1066.865) (-1066.812) (-1065.565) [-1064.551] * (-1062.651) (-1063.233) [-1065.802] (-1063.123) -- 0:00:18
Average standard deviation of split frequencies: 0.007073
720500 -- (-1064.244) (-1063.997) (-1061.937) [-1065.984] * [-1062.734] (-1067.550) (-1065.690) (-1065.437) -- 0:00:18
721000 -- (-1068.310) (-1065.487) [-1063.266] (-1064.989) * (-1064.197) [-1066.305] (-1065.885) (-1066.859) -- 0:00:18
721500 -- (-1066.263) (-1065.914) [-1066.633] (-1063.012) * (-1063.489) (-1067.520) [-1062.505] (-1061.766) -- 0:00:18
722000 -- [-1062.876] (-1064.035) (-1065.295) (-1061.755) * (-1068.811) (-1066.803) [-1063.206] (-1065.759) -- 0:00:18
722500 -- (-1064.555) (-1065.109) [-1062.138] (-1062.968) * (-1067.545) [-1063.916] (-1064.653) (-1067.018) -- 0:00:18
723000 -- [-1062.436] (-1063.744) (-1064.735) (-1068.561) * [-1062.669] (-1065.642) (-1064.714) (-1061.699) -- 0:00:18
723500 -- [-1061.573] (-1064.482) (-1064.614) (-1064.897) * (-1064.615) [-1064.939] (-1068.010) (-1064.712) -- 0:00:18
724000 -- (-1064.171) [-1063.728] (-1061.651) (-1066.570) * (-1067.355) (-1066.593) [-1064.657] (-1064.053) -- 0:00:18
724500 -- [-1064.860] (-1063.806) (-1067.684) (-1063.636) * (-1063.309) (-1062.609) [-1064.551] (-1064.076) -- 0:00:18
725000 -- (-1064.908) (-1066.883) (-1064.889) [-1064.374] * (-1064.505) (-1064.948) [-1062.644] (-1062.814) -- 0:00:18
Average standard deviation of split frequencies: 0.007229
725500 -- (-1065.332) (-1063.500) (-1064.861) [-1064.833] * [-1061.795] (-1064.023) (-1064.535) (-1065.401) -- 0:00:18
726000 -- (-1065.045) (-1065.372) (-1063.054) [-1064.438] * (-1062.918) [-1062.567] (-1064.299) (-1066.034) -- 0:00:18
726500 -- (-1063.021) [-1064.195] (-1066.900) (-1066.639) * (-1065.029) (-1064.271) [-1066.231] (-1066.795) -- 0:00:18
727000 -- (-1065.398) [-1064.182] (-1067.106) (-1061.981) * (-1065.150) (-1064.318) [-1065.061] (-1069.004) -- 0:00:18
727500 -- (-1069.222) (-1062.867) (-1065.077) [-1068.113] * [-1067.103] (-1062.863) (-1065.584) (-1065.165) -- 0:00:18
728000 -- (-1072.973) (-1066.841) (-1063.679) [-1064.969] * (-1066.943) [-1063.944] (-1064.711) (-1062.127) -- 0:00:18
728500 -- (-1064.977) [-1069.262] (-1063.622) (-1067.817) * (-1065.992) [-1064.217] (-1063.418) (-1065.207) -- 0:00:18
729000 -- (-1065.566) (-1064.174) (-1065.629) [-1062.816] * (-1066.489) (-1062.148) (-1064.723) [-1064.386] -- 0:00:18
729500 -- (-1065.424) (-1061.353) [-1062.583] (-1064.092) * (-1066.417) (-1067.089) [-1063.198] (-1063.635) -- 0:00:18
730000 -- (-1063.180) (-1075.309) [-1065.883] (-1062.536) * (-1067.374) [-1063.356] (-1062.274) (-1063.060) -- 0:00:18
Average standard deviation of split frequencies: 0.007011
730500 -- [-1063.090] (-1069.975) (-1070.716) (-1062.977) * (-1065.691) (-1062.292) [-1062.701] (-1064.050) -- 0:00:18
731000 -- [-1063.524] (-1067.256) (-1063.719) (-1064.257) * (-1068.519) (-1062.281) [-1062.180] (-1064.010) -- 0:00:18
731500 -- (-1067.527) (-1063.878) [-1065.890] (-1062.261) * (-1068.613) [-1062.711] (-1066.425) (-1066.987) -- 0:00:17
732000 -- [-1063.500] (-1067.112) (-1065.957) (-1062.579) * (-1067.345) (-1063.929) [-1064.219] (-1063.299) -- 0:00:17
732500 -- (-1066.486) (-1062.669) (-1062.865) [-1063.418] * (-1062.542) [-1063.487] (-1062.409) (-1069.274) -- 0:00:17
733000 -- (-1069.001) (-1062.030) [-1063.511] (-1069.252) * (-1064.905) (-1063.717) [-1062.883] (-1069.159) -- 0:00:17
733500 -- (-1066.222) (-1066.446) (-1065.923) [-1065.446] * [-1068.158] (-1062.389) (-1061.786) (-1066.386) -- 0:00:17
734000 -- (-1063.375) (-1064.285) (-1069.506) [-1065.630] * (-1066.960) [-1065.070] (-1062.194) (-1066.650) -- 0:00:17
734500 -- (-1063.066) [-1067.254] (-1063.032) (-1064.677) * [-1067.546] (-1065.290) (-1062.126) (-1062.761) -- 0:00:17
735000 -- (-1062.316) (-1062.672) [-1064.225] (-1064.064) * [-1065.051] (-1063.706) (-1063.974) (-1062.777) -- 0:00:17
Average standard deviation of split frequencies: 0.007088
735500 -- (-1062.783) (-1064.784) (-1064.986) [-1063.919] * [-1063.641] (-1066.508) (-1063.004) (-1064.128) -- 0:00:17
736000 -- (-1065.587) (-1064.917) (-1064.634) [-1062.632] * (-1065.852) (-1064.939) [-1063.468] (-1065.310) -- 0:00:17
736500 -- (-1063.860) (-1064.236) (-1065.027) [-1065.251] * (-1064.746) [-1062.704] (-1064.126) (-1064.135) -- 0:00:17
737000 -- [-1064.846] (-1068.040) (-1066.486) (-1063.867) * (-1067.943) [-1065.457] (-1062.616) (-1061.633) -- 0:00:17
737500 -- (-1065.062) (-1065.157) (-1066.028) [-1062.722] * (-1066.898) (-1065.356) (-1062.241) [-1064.942] -- 0:00:17
738000 -- (-1061.482) (-1064.384) (-1064.013) [-1062.175] * [-1064.119] (-1065.029) (-1063.240) (-1066.242) -- 0:00:17
738500 -- (-1063.628) [-1065.179] (-1064.229) (-1063.197) * (-1065.167) (-1069.296) (-1065.050) [-1063.865] -- 0:00:17
739000 -- (-1064.876) [-1061.660] (-1066.530) (-1068.368) * [-1065.278] (-1064.477) (-1064.029) (-1064.617) -- 0:00:17
739500 -- (-1063.862) (-1069.259) (-1066.447) [-1066.144] * (-1065.468) (-1064.232) [-1066.142] (-1063.999) -- 0:00:17
740000 -- (-1063.345) (-1065.538) (-1065.702) [-1064.483] * [-1064.803] (-1066.750) (-1067.505) (-1065.589) -- 0:00:17
Average standard deviation of split frequencies: 0.007298
740500 -- [-1061.784] (-1065.174) (-1064.128) (-1068.663) * (-1065.562) (-1065.396) [-1063.438] (-1065.971) -- 0:00:17
741000 -- (-1063.952) (-1067.264) [-1064.766] (-1067.471) * (-1061.800) (-1066.484) (-1062.020) [-1064.172] -- 0:00:17
741500 -- [-1063.090] (-1068.981) (-1064.903) (-1064.990) * [-1062.757] (-1067.921) (-1063.582) (-1061.967) -- 0:00:17
742000 -- [-1062.565] (-1064.241) (-1061.803) (-1063.253) * (-1066.286) (-1065.505) [-1064.739] (-1063.969) -- 0:00:17
742500 -- [-1065.033] (-1067.010) (-1061.745) (-1063.908) * (-1064.138) [-1066.354] (-1065.562) (-1066.470) -- 0:00:17
743000 -- (-1062.275) (-1064.784) [-1061.395] (-1064.854) * (-1071.274) [-1061.271] (-1065.061) (-1065.494) -- 0:00:17
743500 -- [-1064.868] (-1064.966) (-1063.189) (-1062.076) * [-1064.699] (-1064.828) (-1062.622) (-1067.723) -- 0:00:17
744000 -- (-1063.016) (-1066.973) (-1064.447) [-1063.001] * (-1064.805) [-1064.650] (-1064.055) (-1063.052) -- 0:00:17
744500 -- [-1064.727] (-1070.221) (-1068.003) (-1063.961) * [-1064.779] (-1066.210) (-1064.197) (-1063.796) -- 0:00:17
745000 -- [-1061.147] (-1065.087) (-1065.912) (-1064.158) * (-1063.696) (-1068.298) [-1062.085] (-1065.427) -- 0:00:17
Average standard deviation of split frequencies: 0.007836
745500 -- [-1060.905] (-1066.867) (-1064.766) (-1065.047) * (-1062.643) (-1068.638) [-1062.676] (-1066.270) -- 0:00:17
746000 -- (-1061.842) (-1065.768) [-1062.473] (-1064.221) * (-1062.592) [-1064.151] (-1065.551) (-1067.036) -- 0:00:17
746500 -- (-1064.480) (-1066.958) (-1064.055) [-1066.121] * (-1066.322) (-1065.551) (-1063.556) [-1067.484] -- 0:00:16
747000 -- [-1061.295] (-1062.991) (-1066.394) (-1065.633) * (-1064.464) (-1066.365) [-1062.826] (-1062.953) -- 0:00:16
747500 -- [-1061.255] (-1063.343) (-1065.150) (-1063.695) * [-1066.392] (-1066.776) (-1067.176) (-1063.603) -- 0:00:16
748000 -- (-1064.767) (-1061.657) [-1064.657] (-1065.484) * [-1064.595] (-1066.751) (-1062.546) (-1065.091) -- 0:00:16
748500 -- (-1062.369) [-1063.133] (-1063.165) (-1063.523) * [-1066.448] (-1066.684) (-1066.351) (-1065.966) -- 0:00:16
749000 -- (-1065.602) (-1068.545) (-1063.800) [-1064.626] * [-1065.038] (-1062.809) (-1068.392) (-1064.329) -- 0:00:16
749500 -- (-1065.170) (-1061.397) [-1062.217] (-1069.370) * (-1062.122) (-1065.783) [-1063.723] (-1065.138) -- 0:00:16
750000 -- (-1062.810) (-1063.942) (-1066.891) [-1065.638] * [-1062.656] (-1064.585) (-1064.233) (-1064.621) -- 0:00:16
Average standard deviation of split frequencies: 0.007494
750500 -- (-1069.051) (-1065.569) (-1066.941) [-1063.621] * (-1064.004) (-1062.764) [-1065.083] (-1065.656) -- 0:00:16
751000 -- (-1066.253) (-1063.896) [-1064.072] (-1064.930) * (-1065.473) (-1067.231) [-1064.568] (-1065.780) -- 0:00:16
751500 -- (-1063.212) (-1065.757) (-1064.315) [-1063.133] * (-1065.285) (-1064.725) [-1063.234] (-1066.407) -- 0:00:16
752000 -- [-1063.202] (-1067.121) (-1064.309) (-1062.762) * (-1062.491) [-1063.766] (-1062.955) (-1069.012) -- 0:00:16
752500 -- (-1061.080) (-1072.599) (-1064.933) [-1061.304] * (-1061.139) (-1064.475) [-1065.477] (-1065.422) -- 0:00:16
753000 -- (-1064.799) [-1067.593] (-1067.017) (-1060.820) * (-1061.209) (-1066.590) [-1062.766] (-1064.021) -- 0:00:16
753500 -- (-1064.923) (-1065.014) (-1066.138) [-1061.984] * (-1065.448) (-1066.553) [-1062.381] (-1064.964) -- 0:00:16
754000 -- (-1068.495) (-1065.211) (-1062.673) [-1065.676] * (-1061.774) (-1064.430) (-1065.433) [-1062.458] -- 0:00:16
754500 -- [-1065.326] (-1064.954) (-1065.243) (-1062.668) * (-1065.786) (-1071.072) [-1064.497] (-1066.711) -- 0:00:16
755000 -- (-1065.471) (-1067.426) (-1063.403) [-1063.749] * (-1064.651) [-1065.553] (-1064.301) (-1063.425) -- 0:00:16
Average standard deviation of split frequencies: 0.007399
755500 -- [-1064.479] (-1063.510) (-1063.373) (-1062.644) * (-1068.224) (-1066.536) [-1064.975] (-1065.011) -- 0:00:16
756000 -- [-1068.776] (-1063.718) (-1064.236) (-1064.332) * (-1067.668) (-1065.581) (-1062.280) [-1069.079] -- 0:00:16
756500 -- (-1064.955) (-1062.866) [-1062.699] (-1062.589) * (-1063.107) (-1064.119) (-1064.826) [-1065.710] -- 0:00:16
757000 -- (-1066.063) [-1063.162] (-1061.582) (-1063.109) * (-1062.216) (-1064.179) [-1065.651] (-1064.525) -- 0:00:16
757500 -- (-1066.341) [-1065.446] (-1064.300) (-1065.266) * (-1063.547) (-1062.944) (-1064.880) [-1065.644] -- 0:00:16
758000 -- (-1064.304) (-1064.826) [-1061.681] (-1068.709) * (-1064.032) (-1063.457) [-1064.513] (-1063.153) -- 0:00:16
758500 -- (-1067.361) (-1061.926) (-1063.118) [-1061.926] * (-1063.537) [-1063.110] (-1063.019) (-1065.955) -- 0:00:16
759000 -- (-1070.467) [-1065.682] (-1063.170) (-1060.670) * (-1064.149) (-1063.015) [-1063.020] (-1064.175) -- 0:00:16
759500 -- (-1063.924) (-1062.629) [-1062.384] (-1063.859) * (-1062.708) (-1064.923) [-1065.101] (-1065.739) -- 0:00:16
760000 -- [-1066.654] (-1065.373) (-1066.621) (-1062.287) * [-1065.108] (-1065.056) (-1067.633) (-1063.823) -- 0:00:16
Average standard deviation of split frequencies: 0.007437
760500 -- (-1066.008) (-1062.340) (-1067.402) [-1062.510] * (-1065.113) (-1065.745) (-1065.076) [-1063.709] -- 0:00:16
761000 -- [-1065.434] (-1069.622) (-1063.306) (-1065.510) * [-1062.539] (-1064.560) (-1072.379) (-1065.064) -- 0:00:16
761500 -- [-1062.896] (-1064.820) (-1066.080) (-1067.119) * (-1067.902) (-1064.025) [-1064.859] (-1064.571) -- 0:00:15
762000 -- [-1066.170] (-1064.838) (-1065.098) (-1064.861) * (-1066.638) (-1063.679) (-1064.176) [-1062.337] -- 0:00:15
762500 -- (-1064.633) (-1065.608) [-1062.205] (-1064.820) * (-1067.500) (-1064.106) (-1063.338) [-1065.596] -- 0:00:15
763000 -- (-1063.820) (-1061.224) [-1066.392] (-1065.223) * [-1065.474] (-1065.935) (-1067.392) (-1065.540) -- 0:00:15
763500 -- (-1066.054) (-1062.603) [-1068.530] (-1061.788) * (-1066.810) [-1063.415] (-1066.947) (-1066.026) -- 0:00:15
764000 -- (-1061.043) (-1063.107) (-1063.969) [-1061.280] * (-1065.869) (-1063.714) [-1063.572] (-1063.736) -- 0:00:15
764500 -- [-1064.667] (-1064.669) (-1070.136) (-1062.716) * (-1067.679) [-1063.554] (-1065.286) (-1068.012) -- 0:00:15
765000 -- (-1072.173) (-1065.401) (-1070.049) [-1063.554] * (-1063.978) (-1063.929) [-1065.588] (-1064.380) -- 0:00:15
Average standard deviation of split frequencies: 0.007385
765500 -- (-1064.970) (-1066.325) (-1073.671) [-1063.819] * [-1063.911] (-1064.463) (-1072.081) (-1064.206) -- 0:00:15
766000 -- (-1062.463) (-1067.306) [-1061.591] (-1065.225) * (-1064.964) (-1064.698) (-1067.718) [-1063.634] -- 0:00:15
766500 -- (-1064.291) [-1065.186] (-1065.105) (-1062.788) * [-1062.579] (-1064.703) (-1068.135) (-1065.500) -- 0:00:15
767000 -- [-1065.943] (-1065.221) (-1066.750) (-1066.035) * (-1067.850) [-1065.329] (-1064.863) (-1063.998) -- 0:00:15
767500 -- [-1067.303] (-1064.263) (-1064.749) (-1062.633) * (-1068.375) (-1066.391) (-1065.493) [-1065.974] -- 0:00:15
768000 -- [-1068.011] (-1064.652) (-1068.016) (-1065.393) * (-1065.169) [-1062.551] (-1066.474) (-1061.678) -- 0:00:15
768500 -- (-1064.678) [-1062.780] (-1064.475) (-1062.615) * (-1063.483) (-1063.227) [-1063.433] (-1062.947) -- 0:00:15
769000 -- (-1065.678) [-1069.228] (-1065.405) (-1063.894) * (-1062.097) (-1061.799) (-1064.703) [-1062.866] -- 0:00:15
769500 -- (-1063.198) (-1067.669) (-1065.246) [-1063.765] * [-1065.312] (-1062.943) (-1069.953) (-1067.041) -- 0:00:15
770000 -- (-1066.078) (-1065.922) (-1067.110) [-1062.008] * [-1064.556] (-1060.393) (-1064.004) (-1065.414) -- 0:00:15
Average standard deviation of split frequencies: 0.007422
770500 -- [-1063.163] (-1065.575) (-1069.728) (-1061.698) * (-1062.720) [-1067.716] (-1062.765) (-1065.222) -- 0:00:15
771000 -- (-1065.837) (-1065.583) [-1063.408] (-1066.802) * [-1062.784] (-1070.599) (-1066.308) (-1064.491) -- 0:00:15
771500 -- [-1066.901] (-1064.137) (-1068.341) (-1067.892) * [-1065.145] (-1062.548) (-1064.318) (-1062.848) -- 0:00:15
772000 -- (-1066.727) (-1064.064) (-1064.191) [-1063.195] * (-1062.118) (-1067.527) (-1063.134) [-1066.359] -- 0:00:15
772500 -- [-1064.258] (-1063.964) (-1064.933) (-1062.600) * (-1064.018) (-1066.577) [-1066.152] (-1064.628) -- 0:00:15
773000 -- [-1063.867] (-1064.721) (-1066.184) (-1066.644) * (-1064.843) (-1068.353) (-1062.276) [-1063.054] -- 0:00:15
773500 -- [-1063.958] (-1067.130) (-1062.336) (-1065.650) * (-1065.666) (-1064.214) [-1061.221] (-1063.090) -- 0:00:15
774000 -- [-1063.473] (-1068.778) (-1062.835) (-1064.728) * (-1064.027) [-1064.558] (-1063.562) (-1064.574) -- 0:00:15
774500 -- (-1063.885) [-1064.896] (-1064.452) (-1064.525) * [-1064.125] (-1063.495) (-1064.510) (-1065.515) -- 0:00:15
775000 -- (-1061.984) [-1066.433] (-1066.056) (-1067.124) * [-1061.651] (-1065.843) (-1065.042) (-1064.979) -- 0:00:15
Average standard deviation of split frequencies: 0.007290
775500 -- [-1063.925] (-1065.792) (-1069.265) (-1064.268) * (-1065.224) [-1062.997] (-1066.124) (-1062.744) -- 0:00:15
776000 -- [-1063.972] (-1065.848) (-1065.241) (-1065.411) * (-1066.721) (-1069.095) (-1063.797) [-1062.485] -- 0:00:15
776500 -- (-1064.578) (-1066.463) [-1063.721] (-1062.429) * (-1067.887) (-1067.923) (-1067.543) [-1063.697] -- 0:00:14
777000 -- [-1065.609] (-1064.348) (-1065.636) (-1065.075) * (-1066.525) (-1064.135) (-1065.780) [-1063.875] -- 0:00:14
777500 -- (-1064.386) [-1066.397] (-1067.403) (-1066.515) * (-1062.670) (-1065.526) (-1064.089) [-1062.888] -- 0:00:14
778000 -- (-1065.562) (-1066.791) (-1066.784) [-1063.952] * (-1063.265) (-1069.919) (-1062.227) [-1063.525] -- 0:00:14
778500 -- [-1066.174] (-1062.638) (-1065.683) (-1066.359) * (-1065.544) (-1064.686) [-1067.529] (-1061.434) -- 0:00:14
779000 -- (-1065.107) (-1065.815) [-1071.565] (-1062.925) * (-1066.503) (-1065.834) (-1068.762) [-1063.585] -- 0:00:14
779500 -- (-1067.054) (-1066.074) (-1062.218) [-1063.753] * (-1066.562) [-1062.488] (-1062.334) (-1065.040) -- 0:00:14
780000 -- [-1065.112] (-1067.850) (-1063.839) (-1064.137) * (-1065.587) (-1065.846) [-1063.368] (-1065.372) -- 0:00:14
Average standard deviation of split frequencies: 0.007407
780500 -- (-1063.360) (-1067.367) (-1065.886) [-1062.178] * (-1063.482) (-1063.705) (-1065.693) [-1064.615] -- 0:00:14
781000 -- [-1062.851] (-1069.336) (-1064.840) (-1063.857) * [-1061.743] (-1064.031) (-1062.050) (-1065.847) -- 0:00:14
781500 -- (-1063.876) (-1064.212) [-1062.550] (-1066.846) * [-1061.459] (-1065.028) (-1063.664) (-1067.286) -- 0:00:14
782000 -- (-1066.118) (-1064.544) (-1068.458) [-1063.101] * (-1064.684) (-1063.763) (-1064.893) [-1064.465] -- 0:00:14
782500 -- (-1064.072) (-1067.636) [-1064.830] (-1066.197) * (-1061.288) (-1063.689) [-1063.377] (-1066.096) -- 0:00:14
783000 -- (-1062.939) [-1063.081] (-1068.094) (-1064.983) * (-1065.431) [-1061.975] (-1066.359) (-1063.949) -- 0:00:14
783500 -- (-1063.149) (-1066.662) (-1064.375) [-1063.361] * [-1062.752] (-1067.072) (-1066.611) (-1067.637) -- 0:00:14
784000 -- (-1065.998) (-1066.330) (-1066.267) [-1065.162] * (-1065.381) (-1061.963) [-1064.856] (-1069.255) -- 0:00:14
784500 -- (-1066.676) (-1066.916) (-1064.486) [-1064.734] * (-1061.900) [-1061.721] (-1066.126) (-1064.415) -- 0:00:14
785000 -- (-1063.511) (-1064.502) [-1065.597] (-1064.300) * (-1063.779) [-1063.499] (-1066.449) (-1065.764) -- 0:00:14
Average standard deviation of split frequencies: 0.006997
785500 -- [-1063.854] (-1066.453) (-1067.353) (-1063.671) * (-1062.928) (-1061.552) (-1064.047) [-1065.447] -- 0:00:14
786000 -- [-1064.905] (-1065.813) (-1062.240) (-1065.469) * (-1063.630) (-1064.235) (-1064.791) [-1064.586] -- 0:00:14
786500 -- (-1069.306) (-1065.839) (-1062.875) [-1063.402] * [-1063.931] (-1064.659) (-1067.917) (-1065.070) -- 0:00:14
787000 -- (-1062.815) (-1065.089) (-1062.490) [-1063.453] * [-1064.738] (-1064.996) (-1065.348) (-1063.495) -- 0:00:14
787500 -- (-1064.809) (-1069.079) (-1063.509) [-1066.880] * (-1064.622) [-1062.513] (-1063.640) (-1064.075) -- 0:00:14
788000 -- [-1064.984] (-1065.726) (-1065.604) (-1069.180) * (-1060.484) [-1065.035] (-1066.560) (-1063.834) -- 0:00:14
788500 -- (-1062.274) (-1066.202) (-1065.330) [-1069.165] * [-1064.105] (-1063.747) (-1064.241) (-1064.216) -- 0:00:14
789000 -- [-1061.874] (-1065.121) (-1063.847) (-1069.508) * [-1061.105] (-1063.906) (-1064.773) (-1065.384) -- 0:00:14
789500 -- (-1063.714) (-1064.036) [-1065.253] (-1064.309) * [-1060.771] (-1066.743) (-1064.280) (-1064.752) -- 0:00:14
790000 -- [-1063.299] (-1063.537) (-1063.609) (-1064.575) * (-1061.159) [-1063.562] (-1065.903) (-1065.175) -- 0:00:14
Average standard deviation of split frequencies: 0.007155
790500 -- (-1068.144) (-1068.276) [-1065.054] (-1063.735) * [-1062.786] (-1062.416) (-1066.168) (-1066.218) -- 0:00:14
791000 -- (-1062.385) [-1062.081] (-1063.161) (-1062.788) * (-1061.151) (-1064.856) [-1062.388] (-1065.985) -- 0:00:14
791500 -- (-1063.513) [-1064.473] (-1063.356) (-1064.052) * (-1062.002) (-1064.966) [-1061.328] (-1063.991) -- 0:00:13
792000 -- (-1062.102) [-1064.068] (-1062.533) (-1064.078) * [-1063.640] (-1062.190) (-1062.938) (-1065.096) -- 0:00:13
792500 -- (-1064.680) (-1063.490) (-1065.172) [-1061.917] * [-1065.142] (-1063.281) (-1062.859) (-1064.522) -- 0:00:13
793000 -- [-1064.393] (-1066.099) (-1067.942) (-1062.143) * (-1066.988) (-1064.399) (-1062.683) [-1063.867] -- 0:00:13
793500 -- [-1062.050] (-1067.070) (-1066.580) (-1067.124) * [-1067.278] (-1063.905) (-1067.015) (-1063.860) -- 0:00:13
794000 -- [-1063.033] (-1064.208) (-1069.174) (-1066.075) * [-1065.230] (-1066.217) (-1063.031) (-1065.098) -- 0:00:13
794500 -- [-1063.284] (-1066.110) (-1065.283) (-1062.689) * (-1065.957) [-1064.664] (-1061.676) (-1067.238) -- 0:00:13
795000 -- [-1066.615] (-1063.864) (-1068.377) (-1061.231) * [-1064.286] (-1065.678) (-1064.940) (-1067.520) -- 0:00:13
Average standard deviation of split frequencies: 0.006810
795500 -- [-1062.195] (-1064.269) (-1062.200) (-1064.372) * (-1063.651) [-1064.165] (-1063.872) (-1063.810) -- 0:00:13
796000 -- (-1066.709) (-1061.979) (-1062.027) [-1061.047] * (-1065.186) (-1071.207) [-1064.293] (-1064.734) -- 0:00:13
796500 -- (-1064.922) [-1063.198] (-1067.779) (-1065.124) * [-1061.667] (-1066.400) (-1065.685) (-1065.912) -- 0:00:13
797000 -- (-1064.480) [-1062.884] (-1066.024) (-1069.463) * (-1062.724) (-1064.647) [-1068.943] (-1065.401) -- 0:00:13
797500 -- [-1064.158] (-1062.656) (-1065.814) (-1062.904) * [-1063.412] (-1065.352) (-1066.959) (-1066.503) -- 0:00:13
798000 -- (-1066.293) [-1063.675] (-1061.706) (-1063.288) * [-1061.236] (-1065.752) (-1063.190) (-1065.590) -- 0:00:13
798500 -- (-1069.718) (-1064.813) (-1063.255) [-1063.777] * [-1062.369] (-1064.268) (-1063.084) (-1065.858) -- 0:00:13
799000 -- (-1067.099) (-1065.415) (-1063.744) [-1064.337] * (-1064.246) (-1065.898) [-1064.298] (-1066.180) -- 0:00:13
799500 -- (-1067.798) [-1064.172] (-1063.469) (-1066.244) * (-1066.927) (-1067.238) [-1061.187] (-1066.699) -- 0:00:13
800000 -- (-1063.951) (-1061.977) [-1065.125] (-1064.203) * (-1064.471) (-1067.197) [-1063.248] (-1065.336) -- 0:00:13
Average standard deviation of split frequencies: 0.006808
800500 -- [-1063.166] (-1066.943) (-1063.010) (-1065.841) * (-1063.315) [-1067.254] (-1062.484) (-1066.829) -- 0:00:13
801000 -- (-1071.537) (-1063.567) (-1062.073) [-1062.476] * (-1061.998) (-1066.092) [-1063.232] (-1066.816) -- 0:00:13
801500 -- (-1065.744) [-1061.811] (-1064.340) (-1068.039) * [-1066.863] (-1068.680) (-1066.009) (-1063.877) -- 0:00:13
802000 -- (-1066.652) [-1064.345] (-1062.195) (-1065.514) * [-1063.232] (-1067.893) (-1064.449) (-1065.296) -- 0:00:13
802500 -- (-1064.954) [-1062.310] (-1063.224) (-1066.327) * [-1062.007] (-1064.283) (-1068.561) (-1066.422) -- 0:00:13
803000 -- (-1066.769) (-1063.336) [-1064.703] (-1067.178) * (-1062.522) (-1062.738) (-1064.954) [-1064.763] -- 0:00:13
803500 -- (-1063.042) [-1062.238] (-1064.112) (-1065.947) * (-1063.581) (-1062.165) [-1063.421] (-1067.347) -- 0:00:13
804000 -- (-1062.295) [-1063.407] (-1063.034) (-1066.038) * [-1068.000] (-1064.806) (-1064.412) (-1066.620) -- 0:00:13
804500 -- (-1066.280) [-1063.086] (-1061.726) (-1067.044) * [-1061.787] (-1064.874) (-1066.119) (-1065.449) -- 0:00:13
805000 -- (-1069.779) (-1065.038) (-1062.965) [-1065.721] * (-1063.267) (-1064.724) (-1064.379) [-1066.451] -- 0:00:13
Average standard deviation of split frequencies: 0.006543
805500 -- (-1065.161) [-1064.177] (-1066.068) (-1061.972) * (-1063.610) (-1062.135) [-1062.129] (-1065.856) -- 0:00:13
806000 -- (-1063.001) (-1061.892) [-1063.754] (-1065.372) * (-1064.193) [-1064.473] (-1065.310) (-1063.467) -- 0:00:12
806500 -- (-1063.069) (-1062.157) (-1062.122) [-1065.232] * (-1063.230) (-1062.636) (-1068.504) [-1064.062] -- 0:00:12
807000 -- [-1065.109] (-1062.917) (-1062.732) (-1062.850) * (-1064.868) (-1061.629) [-1062.942] (-1064.389) -- 0:00:12
807500 -- [-1061.794] (-1062.456) (-1064.303) (-1065.023) * (-1063.912) (-1061.972) (-1067.056) [-1065.454] -- 0:00:12
808000 -- (-1064.819) [-1063.285] (-1065.145) (-1067.502) * (-1061.257) (-1068.536) [-1063.396] (-1064.377) -- 0:00:12
808500 -- [-1063.219] (-1065.268) (-1065.376) (-1067.384) * (-1062.647) (-1065.323) (-1063.419) [-1062.194] -- 0:00:12
809000 -- (-1067.445) (-1066.767) [-1064.190] (-1065.274) * (-1065.737) (-1063.583) [-1064.389] (-1065.624) -- 0:00:12
809500 -- [-1063.331] (-1064.150) (-1064.623) (-1062.668) * [-1064.877] (-1063.242) (-1065.363) (-1063.723) -- 0:00:12
810000 -- [-1062.680] (-1065.309) (-1065.198) (-1064.976) * (-1064.492) (-1063.732) [-1064.243] (-1062.506) -- 0:00:12
Average standard deviation of split frequencies: 0.006506
810500 -- (-1065.700) (-1066.186) (-1066.699) [-1065.401] * (-1064.337) [-1065.880] (-1061.889) (-1065.590) -- 0:00:12
811000 -- [-1066.117] (-1072.028) (-1069.098) (-1066.727) * (-1063.423) (-1064.574) (-1066.043) [-1063.574] -- 0:00:12
811500 -- (-1065.224) [-1068.290] (-1075.591) (-1065.177) * (-1062.350) (-1065.415) (-1068.150) [-1062.592] -- 0:00:12
812000 -- [-1061.931] (-1071.830) (-1064.535) (-1064.227) * (-1067.445) (-1061.258) (-1071.057) [-1061.187] -- 0:00:12
812500 -- (-1066.526) (-1065.894) (-1064.434) [-1064.098] * (-1062.792) (-1063.324) (-1062.131) [-1066.244] -- 0:00:12
813000 -- (-1065.039) [-1066.111] (-1066.297) (-1069.039) * (-1063.956) [-1064.850] (-1065.888) (-1063.420) -- 0:00:12
813500 -- (-1068.176) (-1067.166) [-1065.856] (-1064.836) * (-1063.416) (-1064.196) (-1065.552) [-1065.615] -- 0:00:12
814000 -- [-1067.820] (-1064.865) (-1064.764) (-1069.498) * (-1062.982) [-1064.182] (-1069.335) (-1061.702) -- 0:00:12
814500 -- (-1062.259) (-1063.462) [-1063.612] (-1067.193) * [-1064.472] (-1061.850) (-1063.785) (-1064.101) -- 0:00:12
815000 -- [-1063.466] (-1065.587) (-1067.763) (-1065.045) * [-1064.322] (-1063.102) (-1066.049) (-1061.038) -- 0:00:12
Average standard deviation of split frequencies: 0.006586
815500 -- (-1063.534) [-1065.241] (-1069.401) (-1065.154) * (-1064.176) (-1063.447) [-1063.731] (-1064.758) -- 0:00:12
816000 -- [-1062.117] (-1064.077) (-1068.224) (-1067.943) * [-1063.690] (-1066.135) (-1064.689) (-1066.148) -- 0:00:12
816500 -- (-1066.325) (-1064.160) (-1064.824) [-1065.146] * (-1068.034) [-1063.413] (-1065.027) (-1063.811) -- 0:00:12
817000 -- (-1065.396) [-1064.027] (-1065.505) (-1064.563) * (-1063.083) (-1063.619) (-1062.884) [-1061.469] -- 0:00:12
817500 -- (-1066.164) (-1063.689) [-1064.036] (-1065.543) * (-1065.045) (-1066.318) [-1063.307] (-1064.593) -- 0:00:12
818000 -- (-1065.980) [-1061.516] (-1062.887) (-1062.945) * (-1063.800) (-1062.921) (-1067.905) [-1061.611] -- 0:00:12
818500 -- (-1063.714) (-1064.043) (-1062.565) [-1064.095] * [-1064.662] (-1066.114) (-1070.368) (-1064.251) -- 0:00:12
819000 -- (-1064.220) (-1068.346) (-1064.091) [-1063.585] * [-1062.827] (-1067.549) (-1066.690) (-1064.245) -- 0:00:12
819500 -- (-1066.328) (-1064.201) (-1066.903) [-1064.628] * [-1064.208] (-1067.281) (-1062.912) (-1065.902) -- 0:00:12
820000 -- (-1063.549) (-1062.919) (-1064.968) [-1064.500] * [-1063.767] (-1065.374) (-1064.258) (-1064.012) -- 0:00:12
Average standard deviation of split frequencies: 0.006498
820500 -- (-1062.344) [-1064.093] (-1062.325) (-1065.834) * (-1060.900) (-1064.942) [-1063.646] (-1062.370) -- 0:00:12
821000 -- (-1064.732) (-1067.338) (-1062.123) [-1065.911] * (-1062.338) (-1063.331) [-1066.291] (-1064.239) -- 0:00:11
821500 -- (-1062.397) (-1072.117) [-1062.379] (-1066.188) * [-1062.202] (-1065.068) (-1065.365) (-1064.862) -- 0:00:11
822000 -- [-1064.665] (-1074.077) (-1065.122) (-1063.179) * (-1068.383) (-1062.571) (-1064.926) [-1064.444] -- 0:00:11
822500 -- (-1067.486) (-1067.045) [-1064.720] (-1063.547) * (-1064.124) (-1062.712) [-1063.101] (-1062.123) -- 0:00:11
823000 -- (-1062.220) (-1067.045) (-1068.745) [-1063.291] * (-1065.237) (-1064.210) [-1063.991] (-1067.119) -- 0:00:11
823500 -- [-1062.254] (-1063.741) (-1064.712) (-1065.107) * (-1067.334) (-1063.342) (-1066.284) [-1063.848] -- 0:00:11
824000 -- (-1063.804) (-1063.809) [-1064.961] (-1066.535) * (-1066.193) (-1066.569) (-1062.624) [-1064.325] -- 0:00:11
824500 -- (-1064.324) [-1064.260] (-1065.181) (-1066.697) * (-1064.227) (-1062.808) (-1061.997) [-1062.806] -- 0:00:11
825000 -- [-1063.420] (-1064.907) (-1066.996) (-1063.684) * (-1061.841) (-1063.403) [-1063.644] (-1063.641) -- 0:00:11
Average standard deviation of split frequencies: 0.006099
825500 -- (-1061.997) (-1065.591) (-1064.361) [-1064.260] * (-1063.464) [-1061.142] (-1063.219) (-1064.263) -- 0:00:11
826000 -- (-1063.629) (-1065.825) (-1066.183) [-1066.044] * (-1063.824) (-1067.398) (-1062.488) [-1064.516] -- 0:00:11
826500 -- (-1067.335) (-1064.229) [-1067.558] (-1066.949) * (-1065.105) [-1062.543] (-1063.328) (-1064.491) -- 0:00:11
827000 -- (-1064.209) (-1065.766) [-1065.702] (-1065.074) * (-1062.917) [-1063.010] (-1064.767) (-1062.999) -- 0:00:11
827500 -- (-1065.596) (-1064.755) [-1067.584] (-1064.761) * [-1062.111] (-1065.757) (-1065.618) (-1065.582) -- 0:00:11
828000 -- (-1062.867) [-1061.286] (-1064.849) (-1062.036) * (-1061.117) [-1065.380] (-1065.577) (-1062.685) -- 0:00:11
828500 -- (-1063.041) (-1067.622) (-1064.039) [-1062.282] * [-1063.127] (-1066.050) (-1066.467) (-1064.764) -- 0:00:11
829000 -- (-1063.402) (-1065.972) (-1065.119) [-1063.500] * (-1061.662) (-1064.322) (-1067.141) [-1063.005] -- 0:00:11
829500 -- (-1065.171) [-1067.122] (-1065.194) (-1064.932) * (-1063.589) (-1064.038) (-1066.365) [-1064.301] -- 0:00:11
830000 -- (-1064.326) (-1064.270) (-1065.424) [-1062.978] * (-1066.755) [-1063.346] (-1065.575) (-1064.828) -- 0:00:11
Average standard deviation of split frequencies: 0.006243
830500 -- (-1064.977) [-1063.240] (-1066.703) (-1064.428) * (-1065.567) (-1065.250) (-1061.760) [-1062.874] -- 0:00:11
831000 -- [-1064.695] (-1064.173) (-1064.402) (-1063.983) * (-1065.039) (-1065.542) (-1061.660) [-1061.290] -- 0:00:11
831500 -- [-1064.522] (-1065.026) (-1066.258) (-1063.854) * (-1066.380) (-1069.709) [-1065.564] (-1063.280) -- 0:00:11
832000 -- (-1063.282) (-1064.255) [-1066.778] (-1063.552) * (-1065.377) (-1066.208) (-1063.367) [-1062.320] -- 0:00:11
832500 -- [-1064.330] (-1063.389) (-1065.272) (-1064.289) * [-1063.579] (-1066.771) (-1066.077) (-1065.079) -- 0:00:11
833000 -- (-1068.750) (-1067.762) [-1068.144] (-1067.357) * [-1066.072] (-1064.992) (-1064.597) (-1065.427) -- 0:00:11
833500 -- [-1062.830] (-1066.518) (-1066.353) (-1065.298) * (-1065.328) (-1066.709) [-1068.729] (-1063.324) -- 0:00:11
834000 -- (-1066.514) [-1066.283] (-1068.356) (-1064.251) * [-1064.867] (-1068.919) (-1065.989) (-1067.939) -- 0:00:11
834500 -- (-1068.939) (-1063.613) (-1065.703) [-1067.658] * (-1064.281) (-1066.779) [-1065.586] (-1065.262) -- 0:00:11
835000 -- (-1064.388) [-1063.303] (-1066.924) (-1072.335) * (-1066.660) (-1063.692) (-1065.960) [-1064.372] -- 0:00:11
Average standard deviation of split frequencies: 0.006015
835500 -- [-1066.461] (-1066.282) (-1064.042) (-1069.034) * (-1063.596) (-1064.820) [-1064.245] (-1063.898) -- 0:00:11
836000 -- (-1063.259) (-1067.721) (-1066.810) [-1067.622] * (-1064.830) (-1064.904) [-1066.666] (-1066.230) -- 0:00:10
836500 -- (-1066.244) (-1066.470) (-1067.774) [-1064.127] * [-1062.364] (-1070.542) (-1066.278) (-1067.111) -- 0:00:10
837000 -- (-1069.255) [-1064.174] (-1065.084) (-1062.034) * [-1061.899] (-1065.619) (-1067.669) (-1062.835) -- 0:00:10
837500 -- (-1068.534) (-1067.194) [-1064.972] (-1065.744) * (-1064.560) [-1064.473] (-1064.338) (-1062.713) -- 0:00:10
838000 -- (-1065.286) (-1063.069) [-1065.641] (-1064.166) * [-1063.974] (-1069.332) (-1066.627) (-1062.522) -- 0:00:10
838500 -- [-1062.481] (-1065.440) (-1065.406) (-1061.796) * (-1063.249) [-1063.667] (-1067.032) (-1063.060) -- 0:00:10
839000 -- [-1062.932] (-1066.277) (-1064.257) (-1068.080) * (-1066.234) (-1068.425) [-1064.415] (-1064.199) -- 0:00:10
839500 -- [-1065.705] (-1066.410) (-1064.207) (-1066.401) * [-1063.956] (-1068.195) (-1062.286) (-1066.257) -- 0:00:10
840000 -- (-1066.437) (-1066.124) (-1065.352) [-1064.845] * [-1068.661] (-1064.271) (-1064.958) (-1062.218) -- 0:00:10
Average standard deviation of split frequencies: 0.006243
840500 -- (-1064.704) (-1062.868) (-1065.101) [-1063.868] * (-1068.158) (-1064.712) [-1063.949] (-1063.690) -- 0:00:10
841000 -- (-1066.538) (-1066.007) [-1063.461] (-1064.882) * (-1065.772) (-1063.541) (-1064.778) [-1065.521] -- 0:00:10
841500 -- (-1063.270) (-1063.819) [-1064.107] (-1064.945) * (-1067.310) [-1064.113] (-1067.118) (-1065.731) -- 0:00:10
842000 -- (-1066.096) (-1061.109) (-1064.327) [-1063.682] * (-1065.598) [-1065.305] (-1062.990) (-1068.681) -- 0:00:10
842500 -- (-1063.999) (-1063.540) [-1065.132] (-1063.526) * [-1063.856] (-1062.801) (-1062.641) (-1065.040) -- 0:00:10
843000 -- [-1063.926] (-1062.436) (-1065.457) (-1065.269) * (-1063.335) [-1064.147] (-1063.672) (-1065.722) -- 0:00:10
843500 -- [-1062.105] (-1060.588) (-1066.612) (-1065.583) * (-1064.350) (-1066.868) (-1064.308) [-1064.268] -- 0:00:10
844000 -- (-1061.537) [-1063.715] (-1065.910) (-1065.117) * (-1065.980) (-1064.269) (-1067.654) [-1062.802] -- 0:00:10
844500 -- (-1068.139) (-1065.994) (-1064.227) [-1064.707] * (-1068.971) [-1064.892] (-1064.501) (-1066.924) -- 0:00:10
845000 -- [-1063.746] (-1065.021) (-1062.889) (-1067.992) * (-1063.960) (-1063.715) [-1064.098] (-1068.553) -- 0:00:10
Average standard deviation of split frequencies: 0.006129
845500 -- (-1064.900) (-1066.018) (-1063.225) [-1063.732] * [-1062.786] (-1065.258) (-1061.277) (-1065.436) -- 0:00:10
846000 -- [-1064.365] (-1065.237) (-1066.106) (-1064.403) * (-1063.979) (-1063.345) [-1063.344] (-1066.728) -- 0:00:10
846500 -- [-1062.081] (-1070.564) (-1066.464) (-1070.880) * [-1064.328] (-1064.583) (-1067.149) (-1065.829) -- 0:00:10
847000 -- [-1063.484] (-1064.538) (-1062.943) (-1066.275) * [-1066.555] (-1063.612) (-1064.809) (-1066.266) -- 0:00:10
847500 -- (-1065.891) (-1064.448) (-1064.888) [-1064.795] * (-1064.671) [-1067.963] (-1063.484) (-1064.944) -- 0:00:10
848000 -- (-1062.315) (-1065.645) [-1062.692] (-1064.464) * (-1062.083) (-1062.600) [-1063.737] (-1066.472) -- 0:00:10
848500 -- [-1063.254] (-1065.571) (-1063.890) (-1062.284) * (-1063.573) (-1066.660) [-1062.903] (-1064.779) -- 0:00:10
849000 -- (-1063.143) (-1065.207) (-1064.018) [-1061.698] * (-1065.493) [-1062.204] (-1061.490) (-1065.136) -- 0:00:10
849500 -- (-1064.475) (-1065.587) (-1066.588) [-1061.990] * [-1063.944] (-1063.452) (-1064.782) (-1065.201) -- 0:00:10
850000 -- [-1063.020] (-1064.292) (-1067.066) (-1062.312) * [-1065.077] (-1063.335) (-1070.394) (-1065.310) -- 0:00:10
Average standard deviation of split frequencies: 0.006133
850500 -- (-1065.080) (-1064.960) (-1064.378) [-1062.815] * (-1065.030) (-1066.547) [-1065.405] (-1063.179) -- 0:00:10
851000 -- [-1063.880] (-1062.718) (-1067.347) (-1064.219) * (-1067.459) [-1064.706] (-1063.140) (-1066.282) -- 0:00:09
851500 -- (-1064.345) (-1064.432) [-1064.009] (-1065.905) * (-1063.818) (-1065.358) [-1062.834] (-1066.769) -- 0:00:09
852000 -- (-1066.079) (-1064.808) (-1064.110) [-1065.790] * (-1064.532) (-1065.015) [-1067.050] (-1063.930) -- 0:00:09
852500 -- (-1065.065) [-1062.285] (-1064.555) (-1065.244) * (-1067.501) (-1066.826) (-1064.929) [-1065.632] -- 0:00:09
853000 -- [-1071.204] (-1064.653) (-1062.505) (-1061.649) * (-1066.630) [-1062.812] (-1065.390) (-1066.365) -- 0:00:09
853500 -- (-1065.739) (-1063.720) (-1064.560) [-1065.606] * (-1064.894) (-1065.572) (-1064.701) [-1064.510] -- 0:00:09
854000 -- (-1065.610) (-1065.852) (-1061.894) [-1064.619] * (-1062.044) (-1066.436) [-1064.576] (-1068.249) -- 0:00:09
854500 -- (-1064.531) [-1066.594] (-1066.160) (-1064.285) * (-1062.418) (-1064.058) [-1062.919] (-1065.304) -- 0:00:09
855000 -- (-1068.069) [-1063.335] (-1063.588) (-1066.628) * [-1064.234] (-1064.047) (-1063.049) (-1069.341) -- 0:00:09
Average standard deviation of split frequencies: 0.006918
855500 -- (-1069.010) (-1064.331) [-1062.888] (-1066.419) * (-1066.822) (-1064.606) [-1067.390] (-1070.394) -- 0:00:09
856000 -- (-1063.902) (-1064.266) (-1065.529) [-1066.374] * (-1066.821) (-1067.343) [-1065.740] (-1068.570) -- 0:00:09
856500 -- [-1061.508] (-1063.461) (-1065.802) (-1066.498) * (-1065.778) [-1062.955] (-1066.691) (-1066.534) -- 0:00:09
857000 -- (-1065.097) (-1064.469) [-1064.899] (-1062.784) * (-1064.466) [-1066.659] (-1064.886) (-1063.955) -- 0:00:09
857500 -- [-1063.351] (-1064.153) (-1062.915) (-1064.413) * (-1067.315) (-1067.026) [-1063.126] (-1062.750) -- 0:00:09
858000 -- (-1062.796) [-1064.268] (-1063.154) (-1064.201) * (-1065.395) (-1067.644) [-1064.353] (-1066.337) -- 0:00:09
858500 -- (-1067.612) [-1065.152] (-1063.559) (-1065.057) * (-1065.103) [-1066.476] (-1064.074) (-1063.337) -- 0:00:09
859000 -- (-1068.457) (-1066.689) (-1065.114) [-1063.198] * [-1064.624] (-1067.596) (-1062.187) (-1064.284) -- 0:00:09
859500 -- (-1062.931) (-1067.977) [-1062.465] (-1063.284) * (-1063.943) (-1069.946) [-1062.386] (-1064.050) -- 0:00:09
860000 -- (-1065.652) (-1064.713) [-1065.726] (-1064.465) * (-1065.458) (-1063.052) (-1062.854) [-1063.470] -- 0:00:09
Average standard deviation of split frequencies: 0.006538
860500 -- [-1063.984] (-1063.435) (-1062.850) (-1063.410) * (-1065.526) (-1063.889) [-1064.194] (-1065.700) -- 0:00:09
861000 -- (-1066.007) (-1069.415) [-1063.722] (-1063.882) * (-1064.067) [-1063.240] (-1065.387) (-1065.836) -- 0:00:09
861500 -- [-1064.319] (-1066.888) (-1061.953) (-1064.037) * (-1065.220) (-1065.098) (-1065.378) [-1069.778] -- 0:00:09
862000 -- (-1064.129) (-1067.033) [-1065.198] (-1066.442) * (-1069.049) (-1066.233) (-1064.806) [-1063.158] -- 0:00:09
862500 -- (-1065.741) (-1067.058) (-1065.567) [-1063.616] * (-1068.185) (-1064.068) (-1061.384) [-1061.537] -- 0:00:09
863000 -- [-1068.011] (-1064.165) (-1066.167) (-1062.129) * (-1065.034) [-1063.719] (-1067.403) (-1062.105) -- 0:00:09
863500 -- (-1064.395) [-1066.100] (-1068.494) (-1066.204) * [-1066.691] (-1063.911) (-1065.902) (-1067.729) -- 0:00:09
864000 -- (-1063.909) (-1066.003) (-1067.342) [-1063.817] * (-1065.177) (-1065.367) [-1066.600] (-1065.552) -- 0:00:09
864500 -- (-1064.635) (-1064.546) (-1064.750) [-1063.750] * (-1065.493) [-1065.500] (-1063.987) (-1063.284) -- 0:00:09
865000 -- (-1062.782) [-1068.017] (-1064.151) (-1064.479) * (-1064.788) (-1068.376) (-1066.398) [-1064.826] -- 0:00:09
Average standard deviation of split frequencies: 0.006396
865500 -- [-1063.451] (-1064.165) (-1067.934) (-1063.368) * (-1067.447) (-1063.551) [-1063.280] (-1065.713) -- 0:00:09
866000 -- (-1064.194) (-1069.480) [-1062.714] (-1062.232) * (-1065.864) (-1061.340) (-1064.701) [-1063.755] -- 0:00:08
866500 -- (-1065.826) (-1065.826) (-1064.707) [-1063.713] * (-1062.412) [-1063.193] (-1067.432) (-1066.722) -- 0:00:08
867000 -- (-1061.371) (-1066.652) (-1064.732) [-1065.568] * (-1063.463) (-1064.242) [-1064.565] (-1066.640) -- 0:00:08
867500 -- (-1062.101) (-1064.141) [-1065.008] (-1064.200) * (-1062.591) [-1064.384] (-1064.183) (-1064.340) -- 0:00:08
868000 -- (-1067.283) (-1066.437) [-1067.814] (-1067.151) * (-1063.724) (-1067.666) [-1063.468] (-1064.261) -- 0:00:08
868500 -- (-1064.168) [-1064.197] (-1064.895) (-1064.277) * (-1065.661) (-1067.463) (-1061.968) [-1063.567] -- 0:00:08
869000 -- (-1062.307) (-1063.777) [-1063.777] (-1072.422) * (-1064.839) (-1065.507) (-1063.015) [-1064.193] -- 0:00:08
869500 -- (-1070.647) [-1062.579] (-1067.717) (-1066.414) * (-1067.004) (-1062.786) [-1064.245] (-1063.974) -- 0:00:08
870000 -- [-1066.307] (-1066.802) (-1065.550) (-1065.109) * [-1064.088] (-1063.493) (-1064.169) (-1063.238) -- 0:00:08
Average standard deviation of split frequencies: 0.006159
870500 -- [-1063.955] (-1064.509) (-1064.788) (-1064.151) * (-1064.134) [-1064.176] (-1065.648) (-1062.573) -- 0:00:08
871000 -- [-1066.032] (-1067.839) (-1064.977) (-1065.498) * (-1063.619) (-1064.535) (-1062.733) [-1064.394] -- 0:00:08
871500 -- (-1065.817) [-1063.910] (-1063.281) (-1063.606) * (-1062.193) (-1065.281) (-1065.552) [-1064.103] -- 0:00:08
872000 -- [-1064.417] (-1069.165) (-1067.115) (-1062.762) * (-1066.421) (-1066.303) [-1068.248] (-1065.853) -- 0:00:08
872500 -- (-1065.853) (-1063.820) [-1063.642] (-1064.373) * (-1067.113) (-1064.712) (-1067.060) [-1063.651] -- 0:00:08
873000 -- (-1066.206) (-1062.366) [-1064.804] (-1066.479) * (-1065.002) [-1064.575] (-1062.608) (-1063.510) -- 0:00:08
873500 -- (-1064.482) (-1068.110) (-1064.158) [-1066.007] * (-1062.479) (-1064.395) (-1065.038) [-1063.444] -- 0:00:08
874000 -- [-1066.626] (-1066.508) (-1063.405) (-1065.652) * (-1062.700) [-1064.465] (-1065.482) (-1064.466) -- 0:00:08
874500 -- [-1063.888] (-1066.944) (-1065.044) (-1065.997) * (-1072.557) (-1064.290) (-1063.055) [-1063.773] -- 0:00:08
875000 -- (-1063.116) (-1065.669) [-1065.258] (-1069.983) * [-1062.886] (-1064.769) (-1064.051) (-1064.616) -- 0:00:08
Average standard deviation of split frequencies: 0.006155
875500 -- [-1062.354] (-1076.698) (-1064.969) (-1063.238) * (-1063.295) [-1065.012] (-1064.688) (-1063.842) -- 0:00:08
876000 -- (-1064.297) [-1066.827] (-1064.697) (-1062.908) * [-1066.699] (-1063.624) (-1063.379) (-1068.150) -- 0:00:08
876500 -- [-1063.261] (-1064.884) (-1066.172) (-1064.050) * (-1064.054) (-1065.110) (-1068.313) [-1064.707] -- 0:00:08
877000 -- (-1064.574) [-1063.376] (-1065.421) (-1062.263) * (-1068.900) (-1065.096) [-1065.364] (-1064.882) -- 0:00:08
877500 -- (-1064.250) [-1065.586] (-1064.883) (-1065.171) * (-1064.281) [-1063.327] (-1067.619) (-1062.950) -- 0:00:08
878000 -- (-1064.470) (-1065.789) [-1062.129] (-1065.357) * (-1064.764) (-1065.356) [-1062.766] (-1066.565) -- 0:00:08
878500 -- (-1062.726) (-1067.882) (-1061.561) [-1066.003] * [-1063.899] (-1066.404) (-1065.836) (-1065.816) -- 0:00:08
879000 -- (-1062.065) (-1064.918) [-1063.430] (-1063.660) * (-1063.054) (-1066.326) [-1063.440] (-1066.196) -- 0:00:08
879500 -- (-1065.540) [-1064.225] (-1063.084) (-1065.682) * (-1065.277) (-1067.363) (-1065.552) [-1066.619] -- 0:00:08
880000 -- [-1063.667] (-1064.661) (-1062.627) (-1064.217) * [-1062.399] (-1067.744) (-1065.241) (-1065.023) -- 0:00:08
Average standard deviation of split frequencies: 0.006423
880500 -- (-1062.649) [-1064.984] (-1063.218) (-1061.881) * (-1064.164) (-1065.104) [-1064.771] (-1064.317) -- 0:00:08
881000 -- (-1063.023) [-1063.374] (-1062.903) (-1067.237) * (-1065.680) (-1065.101) (-1065.324) [-1068.757] -- 0:00:07
881500 -- (-1067.042) (-1063.335) [-1062.286] (-1060.828) * (-1065.477) [-1063.948] (-1063.732) (-1063.148) -- 0:00:07
882000 -- (-1065.541) [-1065.112] (-1064.887) (-1065.683) * (-1062.191) (-1064.204) [-1063.225] (-1065.132) -- 0:00:07
882500 -- (-1066.890) (-1065.005) (-1069.164) [-1068.073] * [-1064.663] (-1064.021) (-1062.361) (-1066.175) -- 0:00:07
883000 -- (-1065.481) (-1063.013) (-1061.664) [-1064.908] * (-1066.866) (-1064.591) (-1065.598) [-1062.395] -- 0:00:07
883500 -- (-1063.649) (-1064.161) [-1063.350] (-1062.568) * [-1063.042] (-1064.451) (-1063.550) (-1060.460) -- 0:00:07
884000 -- (-1066.409) (-1065.658) (-1068.333) [-1062.860] * (-1062.764) (-1067.142) [-1062.111] (-1062.580) -- 0:00:07
884500 -- (-1066.650) (-1064.774) [-1063.816] (-1062.756) * [-1066.964] (-1064.195) (-1067.427) (-1064.890) -- 0:00:07
885000 -- (-1063.627) [-1064.920] (-1064.147) (-1060.273) * (-1065.938) (-1064.855) (-1063.176) [-1064.213] -- 0:00:07
Average standard deviation of split frequencies: 0.006218
885500 -- (-1067.463) (-1064.613) [-1066.394] (-1063.083) * (-1067.143) [-1063.740] (-1063.232) (-1065.943) -- 0:00:07
886000 -- (-1071.698) (-1064.911) [-1063.092] (-1064.535) * (-1065.976) [-1066.954] (-1064.334) (-1065.820) -- 0:00:07
886500 -- (-1062.636) (-1067.563) [-1062.316] (-1065.161) * (-1067.505) (-1065.539) (-1063.515) [-1061.595] -- 0:00:07
887000 -- (-1066.518) (-1064.187) (-1064.569) [-1063.401] * [-1066.703] (-1067.408) (-1064.373) (-1066.758) -- 0:00:07
887500 -- (-1066.824) (-1063.771) (-1064.566) [-1064.610] * (-1065.150) (-1065.433) (-1065.681) [-1064.063] -- 0:00:07
888000 -- (-1065.210) [-1065.774] (-1064.417) (-1065.136) * (-1064.392) [-1065.076] (-1062.581) (-1064.585) -- 0:00:07
888500 -- (-1063.997) [-1065.757] (-1064.267) (-1065.344) * (-1065.564) (-1065.621) [-1062.362] (-1064.774) -- 0:00:07
889000 -- (-1064.728) [-1064.542] (-1061.567) (-1064.624) * (-1061.953) (-1064.341) [-1062.985] (-1063.952) -- 0:00:07
889500 -- (-1066.148) (-1065.850) [-1064.896] (-1063.910) * (-1064.891) (-1065.403) (-1067.868) [-1062.146] -- 0:00:07
890000 -- (-1062.560) [-1065.054] (-1064.548) (-1067.254) * [-1067.802] (-1064.224) (-1065.777) (-1068.587) -- 0:00:07
Average standard deviation of split frequencies: 0.006219
890500 -- [-1064.854] (-1064.407) (-1064.720) (-1065.378) * (-1073.405) [-1063.382] (-1065.317) (-1065.716) -- 0:00:07
891000 -- (-1064.776) (-1066.473) (-1064.176) [-1062.028] * (-1064.112) (-1063.390) (-1063.178) [-1064.101] -- 0:00:07
891500 -- [-1063.452] (-1065.338) (-1064.676) (-1063.762) * [-1065.729] (-1065.182) (-1062.393) (-1069.211) -- 0:00:07
892000 -- (-1065.782) (-1063.757) [-1062.589] (-1062.920) * (-1066.595) (-1065.311) [-1060.836] (-1063.154) -- 0:00:07
892500 -- (-1066.420) (-1065.655) [-1064.436] (-1066.390) * (-1065.606) (-1064.157) (-1064.775) [-1062.224] -- 0:00:07
893000 -- (-1063.971) [-1061.570] (-1063.428) (-1062.735) * (-1066.383) (-1061.994) [-1064.961] (-1064.132) -- 0:00:07
893500 -- [-1066.563] (-1065.583) (-1062.705) (-1062.831) * [-1062.512] (-1064.938) (-1064.797) (-1062.484) -- 0:00:07
894000 -- (-1066.017) [-1061.126] (-1062.366) (-1065.709) * (-1071.939) (-1065.247) (-1063.166) [-1066.105] -- 0:00:07
894500 -- [-1062.606] (-1065.312) (-1067.887) (-1063.995) * (-1061.310) (-1064.824) [-1064.455] (-1066.332) -- 0:00:07
895000 -- (-1065.216) [-1063.122] (-1070.164) (-1063.984) * [-1062.932] (-1068.727) (-1063.722) (-1065.341) -- 0:00:07
Average standard deviation of split frequencies: 0.005886
895500 -- [-1061.346] (-1061.877) (-1062.487) (-1063.682) * [-1064.457] (-1064.904) (-1065.217) (-1067.585) -- 0:00:07
896000 -- (-1067.023) (-1065.005) (-1070.017) [-1064.021] * (-1065.721) [-1064.759] (-1066.315) (-1065.304) -- 0:00:06
896500 -- [-1066.344] (-1063.711) (-1063.721) (-1064.044) * (-1065.154) (-1068.232) (-1064.102) [-1064.254] -- 0:00:06
897000 -- (-1065.442) [-1063.881] (-1064.388) (-1060.926) * [-1065.101] (-1064.333) (-1065.844) (-1064.691) -- 0:00:06
897500 -- (-1062.144) (-1063.425) (-1067.458) [-1065.765] * [-1064.573] (-1065.984) (-1064.136) (-1062.933) -- 0:00:06
898000 -- [-1066.571] (-1067.567) (-1066.536) (-1061.726) * (-1067.273) (-1067.816) [-1063.688] (-1062.414) -- 0:00:06
898500 -- [-1064.585] (-1064.373) (-1067.864) (-1063.760) * (-1068.448) [-1065.359] (-1064.602) (-1063.545) -- 0:00:06
899000 -- (-1067.107) (-1064.649) (-1064.781) [-1062.559] * (-1066.575) (-1069.963) (-1067.041) [-1064.032] -- 0:00:06
899500 -- (-1067.937) [-1066.381] (-1065.702) (-1064.393) * (-1064.732) (-1065.804) (-1064.885) [-1064.590] -- 0:00:06
900000 -- [-1063.225] (-1063.388) (-1064.930) (-1061.178) * (-1063.658) [-1066.423] (-1064.868) (-1063.601) -- 0:00:06
Average standard deviation of split frequencies: 0.006771
900500 -- (-1063.591) [-1063.680] (-1067.257) (-1061.116) * (-1066.111) (-1064.596) (-1065.468) [-1063.168] -- 0:00:06
901000 -- [-1062.816] (-1064.794) (-1071.252) (-1061.903) * (-1064.989) [-1061.812] (-1067.541) (-1066.137) -- 0:00:06
901500 -- (-1061.961) (-1065.228) [-1064.355] (-1062.149) * (-1061.969) [-1064.786] (-1066.462) (-1067.296) -- 0:00:06
902000 -- (-1064.741) (-1065.987) [-1064.324] (-1065.637) * (-1069.376) (-1063.589) [-1064.155] (-1065.373) -- 0:00:06
902500 -- (-1062.434) [-1066.315] (-1064.461) (-1062.868) * (-1066.689) [-1064.964] (-1071.754) (-1062.788) -- 0:00:06
903000 -- [-1063.054] (-1064.967) (-1064.876) (-1063.708) * (-1066.744) (-1065.054) (-1070.128) [-1064.411] -- 0:00:06
903500 -- (-1062.433) [-1064.216] (-1064.142) (-1063.918) * [-1063.651] (-1065.568) (-1063.257) (-1069.790) -- 0:00:06
904000 -- [-1063.023] (-1068.018) (-1065.641) (-1064.203) * (-1065.038) (-1063.286) (-1065.358) [-1064.730] -- 0:00:06
904500 -- (-1065.595) (-1062.801) [-1065.242] (-1061.170) * (-1066.242) [-1061.263] (-1066.155) (-1067.748) -- 0:00:06
905000 -- (-1064.209) (-1062.853) [-1066.090] (-1063.278) * (-1061.984) (-1063.569) (-1065.347) [-1064.520] -- 0:00:06
Average standard deviation of split frequencies: 0.006667
905500 -- (-1063.344) (-1063.861) [-1067.073] (-1062.418) * [-1063.611] (-1064.698) (-1064.927) (-1068.883) -- 0:00:06
906000 -- (-1061.562) [-1064.817] (-1065.943) (-1061.213) * (-1064.220) [-1064.826] (-1062.070) (-1066.583) -- 0:00:06
906500 -- (-1061.976) (-1065.584) [-1064.194] (-1066.700) * (-1067.554) (-1065.884) [-1068.725] (-1067.541) -- 0:00:06
907000 -- [-1067.351] (-1062.986) (-1066.168) (-1062.861) * (-1063.333) (-1065.761) [-1063.379] (-1066.994) -- 0:00:06
907500 -- (-1063.730) (-1069.416) [-1064.842] (-1064.145) * (-1063.902) (-1063.185) [-1064.725] (-1062.660) -- 0:00:06
908000 -- (-1064.184) (-1061.750) [-1064.668] (-1064.693) * (-1066.049) (-1061.544) [-1064.369] (-1062.338) -- 0:00:06
908500 -- [-1061.954] (-1064.271) (-1064.394) (-1063.394) * (-1062.996) [-1063.615] (-1061.733) (-1069.111) -- 0:00:06
909000 -- (-1062.103) [-1062.959] (-1064.694) (-1063.726) * (-1066.418) (-1064.574) (-1064.989) [-1066.212] -- 0:00:06
909500 -- [-1063.677] (-1065.240) (-1066.750) (-1065.192) * (-1069.157) [-1062.538] (-1062.893) (-1067.798) -- 0:00:06
910000 -- [-1063.966] (-1066.667) (-1064.385) (-1066.246) * [-1066.428] (-1066.847) (-1061.895) (-1064.143) -- 0:00:06
Average standard deviation of split frequencies: 0.006794
910500 -- (-1065.767) [-1063.424] (-1061.610) (-1066.020) * [-1064.384] (-1062.549) (-1061.305) (-1065.085) -- 0:00:05
911000 -- (-1065.020) [-1064.810] (-1064.670) (-1065.888) * (-1066.338) (-1064.499) (-1062.079) [-1065.501] -- 0:00:05
911500 -- (-1065.901) [-1062.468] (-1063.299) (-1068.136) * (-1063.435) (-1067.596) [-1061.352] (-1064.991) -- 0:00:05
912000 -- (-1067.805) (-1066.019) (-1063.256) [-1063.124] * [-1065.599] (-1063.408) (-1062.489) (-1064.476) -- 0:00:05
912500 -- (-1063.819) (-1064.772) [-1065.372] (-1065.584) * [-1064.318] (-1065.381) (-1062.879) (-1074.400) -- 0:00:05
913000 -- [-1065.727] (-1062.297) (-1061.891) (-1064.133) * (-1062.325) [-1063.636] (-1061.684) (-1069.213) -- 0:00:05
913500 -- (-1065.008) (-1067.461) [-1066.531] (-1064.110) * [-1064.135] (-1072.709) (-1062.003) (-1065.413) -- 0:00:05
914000 -- (-1067.082) [-1064.984] (-1063.293) (-1064.723) * [-1066.554] (-1065.779) (-1062.918) (-1067.713) -- 0:00:05
914500 -- [-1065.387] (-1062.786) (-1065.597) (-1067.895) * (-1063.887) (-1070.113) [-1062.518] (-1067.495) -- 0:00:05
915000 -- [-1062.467] (-1064.909) (-1060.819) (-1068.136) * (-1064.831) [-1064.413] (-1061.596) (-1064.102) -- 0:00:05
Average standard deviation of split frequencies: 0.006336
915500 -- [-1067.172] (-1066.476) (-1063.523) (-1066.862) * (-1063.478) [-1067.054] (-1061.850) (-1067.715) -- 0:00:05
916000 -- [-1066.183] (-1068.179) (-1063.920) (-1063.718) * [-1065.967] (-1071.712) (-1065.304) (-1067.708) -- 0:00:05
916500 -- (-1065.780) [-1065.728] (-1067.220) (-1065.093) * (-1063.341) [-1063.019] (-1065.211) (-1064.564) -- 0:00:05
917000 -- [-1062.596] (-1065.349) (-1066.442) (-1062.684) * [-1062.015] (-1062.648) (-1065.828) (-1065.285) -- 0:00:05
917500 -- (-1062.772) (-1065.064) [-1066.185] (-1064.863) * (-1064.449) (-1064.432) [-1061.958] (-1068.480) -- 0:00:05
918000 -- (-1063.100) (-1063.752) (-1065.411) [-1063.957] * (-1066.529) [-1068.086] (-1065.426) (-1071.103) -- 0:00:05
918500 -- (-1063.890) (-1067.510) (-1064.856) [-1065.514] * [-1067.681] (-1063.220) (-1068.028) (-1075.332) -- 0:00:05
919000 -- [-1064.085] (-1064.945) (-1065.542) (-1064.881) * (-1065.664) (-1065.045) (-1068.394) [-1067.627] -- 0:00:05
919500 -- (-1064.726) (-1066.010) (-1062.864) [-1064.384] * (-1065.345) [-1064.319] (-1067.372) (-1067.951) -- 0:00:05
920000 -- (-1066.719) (-1065.057) (-1065.308) [-1063.642] * (-1066.325) [-1064.542] (-1065.819) (-1066.062) -- 0:00:05
Average standard deviation of split frequencies: 0.006528
920500 -- [-1065.961] (-1065.258) (-1064.850) (-1066.782) * (-1067.044) (-1064.756) [-1062.206] (-1072.340) -- 0:00:05
921000 -- (-1064.649) (-1064.045) [-1062.196] (-1062.964) * (-1067.098) (-1065.059) [-1063.403] (-1064.161) -- 0:00:05
921500 -- (-1064.490) (-1064.341) [-1063.648] (-1064.105) * (-1067.377) (-1065.485) (-1064.655) [-1060.490] -- 0:00:05
922000 -- (-1066.899) (-1062.461) (-1064.284) [-1064.802] * (-1064.225) (-1070.013) (-1062.752) [-1065.777] -- 0:00:05
922500 -- (-1064.863) [-1064.666] (-1066.175) (-1064.883) * (-1064.802) (-1065.275) [-1062.373] (-1066.143) -- 0:00:05
923000 -- (-1063.349) (-1067.247) (-1066.834) [-1061.598] * (-1065.324) [-1062.082] (-1062.837) (-1063.103) -- 0:00:05
923500 -- (-1066.416) (-1071.391) (-1067.969) [-1063.270] * (-1066.010) (-1064.466) [-1064.209] (-1065.720) -- 0:00:05
924000 -- (-1064.730) (-1064.631) (-1065.571) [-1064.234] * (-1064.697) [-1065.100] (-1062.080) (-1065.656) -- 0:00:05
924500 -- (-1065.125) [-1064.772] (-1063.548) (-1066.208) * (-1064.410) [-1065.509] (-1068.659) (-1061.293) -- 0:00:05
925000 -- (-1063.578) (-1063.539) [-1065.889] (-1064.925) * [-1062.380] (-1063.077) (-1061.740) (-1062.845) -- 0:00:05
Average standard deviation of split frequencies: 0.006682
925500 -- [-1061.849] (-1062.545) (-1063.060) (-1065.231) * (-1065.365) (-1064.181) (-1065.057) [-1063.286] -- 0:00:04
926000 -- (-1064.797) (-1063.607) [-1064.590] (-1064.749) * [-1064.964] (-1065.781) (-1064.551) (-1063.392) -- 0:00:04
926500 -- (-1061.897) (-1065.698) [-1066.091] (-1063.319) * (-1064.505) (-1063.826) (-1064.835) [-1061.808] -- 0:00:04
927000 -- [-1063.240] (-1068.189) (-1068.703) (-1063.954) * [-1062.377] (-1063.519) (-1065.712) (-1065.598) -- 0:00:04
927500 -- [-1065.737] (-1064.373) (-1068.141) (-1063.972) * (-1065.191) (-1062.024) (-1065.436) [-1064.880] -- 0:00:04
928000 -- (-1068.119) (-1064.940) (-1069.829) [-1063.338] * (-1064.046) (-1065.332) (-1067.385) [-1062.356] -- 0:00:04
928500 -- (-1066.235) [-1063.225] (-1065.891) (-1061.355) * (-1063.501) (-1063.302) [-1066.680] (-1060.510) -- 0:00:04
929000 -- (-1063.757) (-1064.432) [-1063.407] (-1063.761) * [-1065.290] (-1066.566) (-1065.364) (-1065.001) -- 0:00:04
929500 -- (-1064.894) [-1065.179] (-1065.173) (-1063.001) * (-1066.041) (-1065.689) [-1066.183] (-1063.437) -- 0:00:04
930000 -- (-1064.272) [-1063.049] (-1068.070) (-1061.868) * (-1070.923) (-1065.092) (-1064.882) [-1062.933] -- 0:00:04
Average standard deviation of split frequencies: 0.006711
930500 -- (-1066.327) (-1064.667) (-1066.474) [-1062.264] * [-1067.022] (-1069.591) (-1068.345) (-1064.403) -- 0:00:04
931000 -- (-1064.150) (-1067.509) [-1065.207] (-1064.099) * (-1067.261) [-1062.444] (-1065.331) (-1061.434) -- 0:00:04
931500 -- (-1065.106) (-1064.454) (-1064.692) [-1062.789] * (-1065.813) (-1064.409) (-1061.780) [-1062.819] -- 0:00:04
932000 -- (-1066.811) (-1062.760) (-1066.106) [-1064.438] * (-1064.667) (-1063.564) (-1064.227) [-1061.869] -- 0:00:04
932500 -- (-1066.208) [-1064.075] (-1063.688) (-1060.502) * [-1062.698] (-1064.701) (-1065.599) (-1062.623) -- 0:00:04
933000 -- (-1065.887) [-1064.801] (-1062.486) (-1064.382) * (-1063.613) (-1067.337) (-1066.334) [-1063.965] -- 0:00:04
933500 -- (-1063.365) (-1065.622) (-1065.845) [-1062.975] * [-1065.771] (-1067.512) (-1064.014) (-1062.007) -- 0:00:04
934000 -- (-1063.800) (-1068.411) (-1065.973) [-1063.384] * (-1065.857) [-1065.726] (-1067.436) (-1063.340) -- 0:00:04
934500 -- (-1064.102) [-1066.659] (-1065.273) (-1064.969) * [-1064.806] (-1063.605) (-1064.017) (-1064.311) -- 0:00:04
935000 -- (-1062.284) (-1063.175) (-1062.468) [-1062.848] * (-1063.309) (-1065.688) (-1064.143) [-1063.874] -- 0:00:04
Average standard deviation of split frequencies: 0.006648
935500 -- (-1069.190) (-1062.816) (-1062.962) [-1062.764] * [-1064.415] (-1064.856) (-1063.509) (-1065.497) -- 0:00:04
936000 -- (-1069.244) (-1065.111) [-1065.186] (-1061.099) * (-1067.211) [-1065.592] (-1064.213) (-1063.816) -- 0:00:04
936500 -- [-1065.358] (-1068.182) (-1063.430) (-1061.365) * (-1063.996) (-1065.603) [-1062.773] (-1063.750) -- 0:00:04
937000 -- (-1065.107) (-1065.355) [-1064.273] (-1067.829) * (-1067.350) (-1065.495) [-1064.392] (-1063.183) -- 0:00:04
937500 -- [-1062.054] (-1062.847) (-1064.527) (-1061.555) * (-1065.777) (-1064.302) (-1064.503) [-1060.559] -- 0:00:04
938000 -- [-1062.912] (-1062.551) (-1061.652) (-1061.782) * (-1066.615) [-1064.421] (-1062.749) (-1063.767) -- 0:00:04
938500 -- (-1062.710) (-1063.329) [-1064.358] (-1065.351) * (-1061.543) [-1069.697] (-1063.632) (-1064.220) -- 0:00:04
939000 -- (-1066.420) (-1061.651) (-1063.277) [-1064.250] * (-1062.911) (-1069.349) (-1065.676) [-1060.392] -- 0:00:04
939500 -- (-1066.102) (-1062.095) [-1063.398] (-1064.819) * (-1062.732) (-1065.518) [-1068.224] (-1069.056) -- 0:00:04
940000 -- (-1063.154) [-1065.229] (-1061.994) (-1064.064) * (-1062.788) (-1067.158) (-1070.845) [-1068.652] -- 0:00:04
Average standard deviation of split frequencies: 0.007250
940500 -- [-1061.941] (-1063.103) (-1060.835) (-1063.656) * [-1068.798] (-1072.405) (-1064.821) (-1064.192) -- 0:00:03
941000 -- (-1063.028) [-1064.831] (-1063.138) (-1065.585) * (-1064.823) (-1065.507) [-1062.687] (-1066.785) -- 0:00:03
941500 -- (-1063.531) (-1067.126) [-1065.402] (-1064.269) * (-1070.759) (-1062.985) [-1064.654] (-1062.396) -- 0:00:03
942000 -- (-1066.440) [-1064.921] (-1064.425) (-1065.028) * (-1062.792) (-1064.744) [-1064.388] (-1063.499) -- 0:00:03
942500 -- (-1063.888) [-1062.155] (-1065.108) (-1067.764) * (-1064.593) (-1064.153) [-1061.845] (-1063.656) -- 0:00:03
943000 -- (-1062.795) (-1065.929) [-1063.991] (-1065.064) * (-1064.700) (-1064.958) [-1062.321] (-1063.436) -- 0:00:03
943500 -- (-1062.951) (-1064.954) (-1063.712) [-1064.491] * (-1064.458) (-1063.456) [-1064.336] (-1063.093) -- 0:00:03
944000 -- (-1064.153) (-1065.907) (-1065.769) [-1063.106] * [-1064.008] (-1064.380) (-1063.800) (-1063.624) -- 0:00:03
944500 -- (-1064.303) [-1063.961] (-1065.429) (-1066.660) * (-1066.045) (-1064.874) [-1062.833] (-1064.308) -- 0:00:03
945000 -- [-1064.190] (-1065.911) (-1065.935) (-1064.679) * (-1063.297) [-1063.241] (-1064.450) (-1063.425) -- 0:00:03
Average standard deviation of split frequencies: 0.007724
945500 -- (-1063.572) (-1062.341) (-1063.896) [-1068.596] * (-1064.476) (-1068.110) [-1065.094] (-1062.300) -- 0:00:03
946000 -- (-1063.937) (-1065.720) [-1062.495] (-1065.321) * (-1067.519) (-1064.549) [-1067.261] (-1063.338) -- 0:00:03
946500 -- (-1063.436) (-1066.379) (-1063.736) [-1064.509] * (-1065.370) (-1066.394) (-1067.419) [-1061.635] -- 0:00:03
947000 -- (-1063.559) [-1064.868] (-1068.839) (-1065.318) * [-1067.003] (-1064.902) (-1065.412) (-1063.996) -- 0:00:03
947500 -- (-1064.770) (-1065.370) [-1062.669] (-1067.158) * (-1066.539) [-1065.414] (-1065.777) (-1063.366) -- 0:00:03
948000 -- (-1067.672) [-1063.587] (-1067.288) (-1066.264) * [-1064.955] (-1065.937) (-1065.095) (-1063.920) -- 0:00:03
948500 -- (-1064.428) (-1066.609) [-1061.188] (-1066.630) * [-1065.087] (-1070.763) (-1065.707) (-1063.189) -- 0:00:03
949000 -- (-1066.735) (-1063.082) [-1066.008] (-1067.842) * (-1066.228) [-1065.657] (-1065.130) (-1066.463) -- 0:00:03
949500 -- [-1061.778] (-1065.908) (-1065.729) (-1064.001) * (-1068.501) (-1066.232) (-1067.708) [-1068.051] -- 0:00:03
950000 -- [-1061.494] (-1067.692) (-1071.389) (-1066.265) * [-1062.236] (-1061.697) (-1066.147) (-1066.760) -- 0:00:03
Average standard deviation of split frequencies: 0.007717
950500 -- (-1063.797) [-1062.674] (-1068.064) (-1065.234) * (-1062.099) [-1062.861] (-1065.020) (-1063.359) -- 0:00:03
951000 -- (-1064.196) [-1066.394] (-1067.121) (-1064.221) * (-1065.400) (-1063.225) [-1065.371] (-1063.777) -- 0:00:03
951500 -- (-1063.915) (-1066.300) [-1064.030] (-1064.425) * (-1067.130) (-1066.106) (-1064.109) [-1066.148] -- 0:00:03
952000 -- [-1066.538] (-1065.490) (-1064.107) (-1064.767) * (-1064.090) (-1063.528) [-1064.832] (-1063.003) -- 0:00:03
952500 -- (-1064.404) (-1066.047) (-1060.964) [-1068.774] * (-1063.442) [-1066.557] (-1068.889) (-1066.709) -- 0:00:03
953000 -- (-1065.293) (-1065.472) (-1062.876) [-1065.921] * [-1066.228] (-1066.185) (-1065.023) (-1066.478) -- 0:00:03
953500 -- [-1066.192] (-1065.065) (-1065.104) (-1071.304) * (-1065.320) (-1066.671) (-1068.615) [-1060.817] -- 0:00:03
954000 -- (-1069.016) (-1063.708) [-1063.081] (-1064.713) * (-1066.665) (-1066.464) [-1064.360] (-1065.912) -- 0:00:03
954500 -- (-1067.546) (-1064.460) (-1063.675) [-1063.523] * (-1067.440) [-1064.074] (-1063.826) (-1062.252) -- 0:00:03
955000 -- [-1065.444] (-1065.847) (-1062.603) (-1065.688) * (-1068.572) (-1068.318) (-1064.582) [-1063.902] -- 0:00:03
Average standard deviation of split frequencies: 0.007828
955500 -- [-1064.303] (-1071.503) (-1066.716) (-1062.444) * (-1064.543) (-1063.967) [-1063.876] (-1062.522) -- 0:00:02
956000 -- [-1063.740] (-1064.583) (-1065.534) (-1062.428) * (-1064.318) (-1063.943) (-1062.941) [-1063.458] -- 0:00:02
956500 -- (-1065.872) [-1062.934] (-1064.368) (-1064.917) * (-1062.416) (-1064.601) [-1064.594] (-1064.890) -- 0:00:02
957000 -- (-1063.664) (-1065.026) [-1063.312] (-1063.019) * (-1065.252) [-1063.745] (-1062.611) (-1061.813) -- 0:00:02
957500 -- (-1065.124) [-1063.053] (-1063.504) (-1065.469) * (-1064.656) (-1065.591) (-1064.977) [-1065.541] -- 0:00:02
958000 -- (-1064.680) (-1061.869) (-1064.143) [-1067.067] * (-1063.877) (-1066.728) (-1065.689) [-1066.189] -- 0:00:02
958500 -- [-1063.758] (-1062.510) (-1067.072) (-1067.204) * (-1064.802) (-1063.776) (-1063.584) [-1064.418] -- 0:00:02
959000 -- [-1063.719] (-1062.583) (-1066.894) (-1066.343) * [-1064.783] (-1061.915) (-1066.906) (-1073.395) -- 0:00:02
959500 -- (-1065.149) (-1065.137) [-1063.576] (-1066.058) * [-1063.730] (-1065.480) (-1064.555) (-1065.531) -- 0:00:02
960000 -- (-1065.620) (-1063.016) [-1066.303] (-1066.853) * (-1070.528) (-1064.581) (-1066.646) [-1064.965] -- 0:00:02
Average standard deviation of split frequencies: 0.007943
960500 -- [-1067.392] (-1068.139) (-1065.058) (-1065.117) * [-1061.580] (-1063.879) (-1065.325) (-1067.900) -- 0:00:02
961000 -- (-1060.756) [-1065.210] (-1068.403) (-1066.858) * (-1068.667) (-1068.511) (-1065.255) [-1065.139] -- 0:00:02
961500 -- (-1061.314) [-1065.338] (-1066.358) (-1064.706) * (-1064.162) (-1065.517) [-1063.624] (-1064.194) -- 0:00:02
962000 -- (-1062.692) (-1068.302) [-1063.715] (-1063.392) * (-1065.338) [-1066.193] (-1066.247) (-1065.862) -- 0:00:02
962500 -- [-1061.768] (-1067.114) (-1067.245) (-1067.155) * (-1063.455) (-1069.076) [-1063.662] (-1064.823) -- 0:00:02
963000 -- (-1062.760) (-1065.954) [-1062.829] (-1067.934) * (-1064.380) (-1068.500) [-1064.864] (-1065.061) -- 0:00:02
963500 -- (-1063.186) (-1062.585) [-1063.781] (-1062.895) * (-1062.930) (-1064.661) [-1063.986] (-1062.966) -- 0:00:02
964000 -- (-1061.857) (-1065.486) [-1063.231] (-1061.621) * (-1072.697) [-1063.291] (-1063.733) (-1063.567) -- 0:00:02
964500 -- (-1062.161) (-1063.150) (-1065.060) [-1061.631] * (-1064.022) (-1065.455) [-1062.196] (-1064.240) -- 0:00:02
965000 -- (-1062.439) [-1064.487] (-1064.304) (-1064.927) * (-1063.545) (-1068.668) (-1061.940) [-1064.123] -- 0:00:02
Average standard deviation of split frequencies: 0.007960
965500 -- (-1063.348) (-1064.604) [-1064.492] (-1064.091) * (-1066.986) [-1060.409] (-1064.229) (-1064.154) -- 0:00:02
966000 -- (-1065.771) [-1064.561] (-1065.657) (-1063.537) * (-1067.211) [-1064.420] (-1064.328) (-1063.490) -- 0:00:02
966500 -- (-1063.380) (-1069.569) [-1064.829] (-1065.034) * (-1064.126) [-1063.145] (-1063.375) (-1065.154) -- 0:00:02
967000 -- (-1065.822) [-1065.033] (-1068.081) (-1063.557) * [-1063.893] (-1061.108) (-1065.303) (-1063.151) -- 0:00:02
967500 -- [-1063.607] (-1067.231) (-1065.301) (-1068.638) * [-1064.189] (-1064.941) (-1062.076) (-1063.183) -- 0:00:02
968000 -- [-1064.665] (-1063.442) (-1065.852) (-1065.835) * (-1064.957) (-1066.035) (-1063.593) [-1066.294] -- 0:00:02
968500 -- (-1065.492) (-1063.134) [-1065.126] (-1063.820) * [-1065.662] (-1066.006) (-1063.482) (-1064.811) -- 0:00:02
969000 -- [-1065.743] (-1064.436) (-1065.985) (-1065.469) * [-1065.851] (-1063.112) (-1065.142) (-1065.357) -- 0:00:02
969500 -- (-1070.395) [-1064.288] (-1062.763) (-1063.637) * [-1063.732] (-1062.595) (-1066.556) (-1065.447) -- 0:00:02
970000 -- [-1063.953] (-1061.821) (-1061.971) (-1064.746) * (-1062.997) [-1062.365] (-1064.860) (-1070.205) -- 0:00:02
Average standard deviation of split frequencies: 0.007740
970500 -- (-1064.017) (-1063.386) [-1066.797] (-1062.078) * (-1067.141) [-1062.985] (-1065.483) (-1067.307) -- 0:00:01
971000 -- (-1064.634) [-1066.336] (-1062.892) (-1061.409) * [-1065.443] (-1066.498) (-1063.242) (-1069.479) -- 0:00:01
971500 -- (-1064.105) (-1063.868) (-1064.323) [-1064.025] * (-1066.236) (-1067.565) (-1062.535) [-1063.283] -- 0:00:01
972000 -- (-1065.058) [-1064.247] (-1061.294) (-1063.998) * (-1064.898) [-1063.659] (-1066.391) (-1067.091) -- 0:00:01
972500 -- (-1063.148) (-1063.976) (-1062.841) [-1066.162] * (-1064.793) (-1061.657) (-1065.838) [-1063.883] -- 0:00:01
973000 -- (-1062.894) (-1063.762) (-1062.853) [-1064.333] * [-1061.708] (-1061.985) (-1066.009) (-1062.102) -- 0:00:01
973500 -- [-1061.895] (-1062.427) (-1063.617) (-1066.309) * [-1062.028] (-1063.678) (-1064.347) (-1068.104) -- 0:00:01
974000 -- (-1065.670) [-1064.960] (-1061.832) (-1064.252) * (-1064.836) [-1064.253] (-1068.493) (-1064.055) -- 0:00:01
974500 -- (-1066.757) [-1066.128] (-1062.126) (-1063.474) * (-1064.709) (-1063.784) (-1064.331) [-1062.821] -- 0:00:01
975000 -- [-1064.545] (-1063.901) (-1065.696) (-1064.314) * (-1062.105) (-1065.688) (-1065.625) [-1064.928] -- 0:00:01
Average standard deviation of split frequencies: 0.007698
975500 -- (-1066.866) (-1064.967) [-1066.039] (-1065.162) * (-1063.280) [-1064.414] (-1064.704) (-1062.535) -- 0:00:01
976000 -- [-1067.153] (-1063.690) (-1065.109) (-1065.284) * (-1062.892) [-1063.482] (-1065.710) (-1067.454) -- 0:00:01
976500 -- [-1070.101] (-1068.198) (-1068.077) (-1065.012) * (-1062.363) (-1065.574) [-1065.361] (-1066.507) -- 0:00:01
977000 -- [-1064.098] (-1064.142) (-1066.179) (-1067.814) * (-1064.183) [-1065.920] (-1065.574) (-1062.612) -- 0:00:01
977500 -- (-1064.559) [-1062.616] (-1066.290) (-1069.294) * (-1067.847) [-1064.333] (-1064.148) (-1065.455) -- 0:00:01
978000 -- [-1062.562] (-1063.694) (-1067.460) (-1070.044) * (-1066.679) (-1064.397) (-1066.840) [-1067.307] -- 0:00:01
978500 -- (-1063.898) (-1065.505) [-1066.705] (-1070.061) * (-1066.027) (-1063.905) [-1062.735] (-1062.002) -- 0:00:01
979000 -- (-1065.150) [-1065.025] (-1064.197) (-1065.938) * (-1063.434) (-1063.570) (-1068.124) [-1065.539] -- 0:00:01
979500 -- (-1065.151) (-1066.172) [-1063.617] (-1064.535) * (-1062.471) [-1064.346] (-1062.224) (-1061.362) -- 0:00:01
980000 -- [-1068.610] (-1063.845) (-1063.460) (-1063.206) * (-1064.505) (-1066.296) [-1063.509] (-1064.292) -- 0:00:01
Average standard deviation of split frequencies: 0.007481
980500 -- (-1065.244) (-1062.789) [-1064.957] (-1062.829) * (-1063.850) (-1063.377) (-1065.166) [-1065.438] -- 0:00:01
981000 -- (-1064.741) [-1062.742] (-1065.974) (-1067.206) * [-1062.370] (-1064.619) (-1064.072) (-1064.793) -- 0:00:01
981500 -- (-1064.289) (-1062.373) (-1065.425) [-1065.934] * (-1064.951) (-1062.564) [-1064.342] (-1065.039) -- 0:00:01
982000 -- (-1066.801) (-1065.786) (-1062.189) [-1062.711] * [-1062.334] (-1063.789) (-1067.165) (-1063.520) -- 0:00:01
982500 -- (-1066.241) (-1064.267) (-1065.626) [-1063.858] * (-1064.133) (-1063.553) (-1065.143) [-1062.048] -- 0:00:01
983000 -- (-1065.519) [-1065.938] (-1066.273) (-1065.346) * (-1063.956) [-1063.967] (-1065.520) (-1062.652) -- 0:00:01
983500 -- [-1060.953] (-1065.420) (-1064.137) (-1063.767) * (-1065.373) (-1062.302) [-1064.962] (-1064.013) -- 0:00:01
984000 -- [-1062.834] (-1066.034) (-1063.962) (-1066.640) * [-1064.255] (-1064.243) (-1063.412) (-1064.211) -- 0:00:01
984500 -- [-1063.634] (-1065.271) (-1066.910) (-1066.865) * (-1066.411) (-1065.965) (-1063.605) [-1064.602] -- 0:00:01
985000 -- (-1067.507) (-1065.514) (-1069.291) [-1063.451] * [-1063.448] (-1068.975) (-1061.711) (-1067.950) -- 0:00:01
Average standard deviation of split frequencies: 0.007142
985500 -- (-1065.786) [-1065.332] (-1068.040) (-1066.250) * (-1065.172) (-1069.622) [-1062.467] (-1063.508) -- 0:00:00
986000 -- (-1063.600) (-1062.441) [-1062.374] (-1067.256) * [-1068.296] (-1071.610) (-1066.176) (-1065.327) -- 0:00:00
986500 -- (-1069.902) (-1064.379) [-1064.093] (-1065.334) * (-1065.560) (-1065.978) (-1065.193) [-1065.499] -- 0:00:00
987000 -- (-1064.208) [-1063.879] (-1068.251) (-1063.174) * (-1063.539) [-1066.459] (-1063.778) (-1065.014) -- 0:00:00
987500 -- (-1064.892) [-1065.878] (-1069.076) (-1065.979) * [-1063.431] (-1064.255) (-1064.606) (-1062.692) -- 0:00:00
988000 -- (-1066.171) (-1063.602) (-1062.959) [-1062.406] * (-1064.344) (-1066.256) (-1067.778) [-1064.807] -- 0:00:00
988500 -- [-1066.752] (-1065.025) (-1063.117) (-1064.512) * (-1064.991) [-1063.745] (-1065.067) (-1065.628) -- 0:00:00
989000 -- (-1066.239) (-1063.895) [-1063.761] (-1064.018) * [-1064.634] (-1063.532) (-1066.426) (-1063.067) -- 0:00:00
989500 -- (-1065.229) (-1066.789) (-1068.719) [-1064.800] * [-1063.547] (-1064.330) (-1064.245) (-1064.501) -- 0:00:00
990000 -- (-1067.078) (-1064.840) [-1062.604] (-1067.218) * (-1062.552) (-1063.325) [-1064.853] (-1066.237) -- 0:00:00
Average standard deviation of split frequencies: 0.006989
990500 -- [-1064.296] (-1064.175) (-1066.087) (-1063.189) * [-1061.752] (-1063.005) (-1068.867) (-1064.829) -- 0:00:00
991000 -- (-1064.033) (-1067.548) (-1064.406) [-1063.969] * [-1064.440] (-1065.829) (-1063.957) (-1065.331) -- 0:00:00
991500 -- (-1062.107) (-1062.916) (-1065.113) [-1063.331] * [-1066.088] (-1065.165) (-1062.835) (-1064.440) -- 0:00:00
992000 -- (-1063.899) [-1068.112] (-1063.842) (-1063.672) * (-1068.782) (-1064.022) (-1064.148) [-1064.254] -- 0:00:00
992500 -- [-1061.934] (-1066.468) (-1069.668) (-1062.652) * [-1063.103] (-1066.794) (-1065.074) (-1066.567) -- 0:00:00
993000 -- (-1066.633) (-1067.988) [-1061.349] (-1063.336) * [-1064.275] (-1069.315) (-1064.903) (-1064.238) -- 0:00:00
993500 -- (-1065.929) (-1066.393) (-1068.514) [-1063.772] * (-1072.496) (-1065.890) [-1064.181] (-1061.886) -- 0:00:00
994000 -- [-1063.530] (-1062.721) (-1065.834) (-1063.585) * (-1068.642) (-1063.497) (-1064.384) [-1062.047] -- 0:00:00
994500 -- (-1068.205) (-1062.666) [-1066.001] (-1063.586) * (-1067.263) (-1065.781) [-1067.449] (-1064.670) -- 0:00:00
995000 -- [-1063.870] (-1062.373) (-1067.553) (-1063.526) * (-1062.350) [-1062.042] (-1063.409) (-1064.798) -- 0:00:00
Average standard deviation of split frequencies: 0.006567
995500 -- (-1064.718) [-1064.275] (-1065.969) (-1063.493) * (-1065.246) (-1064.891) (-1064.188) [-1062.438] -- 0:00:00
996000 -- (-1067.421) (-1063.547) (-1062.811) [-1063.433] * (-1062.447) (-1070.877) (-1065.883) [-1064.543] -- 0:00:00
996500 -- [-1064.233] (-1065.568) (-1065.229) (-1064.337) * (-1067.061) (-1067.656) (-1063.928) [-1062.828] -- 0:00:00
997000 -- [-1064.833] (-1064.350) (-1063.293) (-1062.336) * [-1063.005] (-1064.315) (-1064.308) (-1064.224) -- 0:00:00
997500 -- [-1064.661] (-1063.010) (-1063.433) (-1071.471) * (-1065.962) [-1063.179] (-1066.265) (-1064.083) -- 0:00:00
998000 -- (-1065.033) (-1062.596) [-1063.019] (-1064.679) * (-1070.263) (-1068.189) (-1068.887) [-1063.376] -- 0:00:00
998500 -- (-1064.352) (-1064.526) (-1062.724) [-1061.733] * [-1061.833] (-1064.799) (-1064.172) (-1067.533) -- 0:00:00
999000 -- [-1064.152] (-1063.390) (-1062.396) (-1062.844) * [-1066.394] (-1062.984) (-1063.815) (-1066.387) -- 0:00:00
999500 -- (-1064.250) (-1065.176) (-1062.371) [-1062.257] * (-1065.334) (-1066.097) [-1064.129] (-1062.637) -- 0:00:00
1000000 -- (-1063.882) (-1064.543) [-1064.763] (-1063.531) * (-1064.798) (-1063.876) [-1064.077] (-1061.781) -- 0:00:00
Average standard deviation of split frequencies: 0.007037
Analysis completed in 1 mins 7 seconds
Analysis used 65.39 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1059.35
Likelihood of best state for "cold" chain of run 2 was -1059.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 62 %) Dirichlet(Revmat{all})
97.7 % ( 95 %) Slider(Revmat{all})
27.3 % ( 30 %) Dirichlet(Pi{all})
29.1 % ( 30 %) Slider(Pi{all})
65.3 % ( 46 %) Multiplier(Alpha{1,2})
78.8 % ( 54 %) Multiplier(Alpha{3})
24.7 % ( 30 %) Slider(Pinvar{all})
97.2 % ( 97 %) ExtSPR(Tau{all},V{all})
69.1 % ( 62 %) ExtTBR(Tau{all},V{all})
98.2 % ( 98 %) NNI(Tau{all},V{all})
87.8 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
94.7 % ( 90 %) Nodeslider(V{all})
30.5 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 68 %) Dirichlet(Revmat{all})
97.9 % ( 97 %) Slider(Revmat{all})
26.8 % ( 17 %) Dirichlet(Pi{all})
29.1 % ( 22 %) Slider(Pi{all})
65.0 % ( 43 %) Multiplier(Alpha{1,2})
78.9 % ( 50 %) Multiplier(Alpha{3})
26.1 % ( 30 %) Slider(Pinvar{all})
97.3 % ( 95 %) ExtSPR(Tau{all},V{all})
68.8 % ( 69 %) ExtTBR(Tau{all},V{all})
98.2 % ( 99 %) NNI(Tau{all},V{all})
87.8 % ( 88 %) ParsSPR(Tau{all},V{all})
28.0 % ( 30 %) Multiplier(V{all})
94.7 % ( 96 %) Nodeslider(V{all})
30.7 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166049 0.82 0.66
3 | 166332 166931 0.83
4 | 166425 167312 166951
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166844 0.82 0.66
3 | 166393 166258 0.83
4 | 166773 166648 167084
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1063.26
| 2 1 |
| 2 |
| 2 1 1 1 2 |
| *11 1 1 1 2 |
|1 212 1 *2 1122 1 2|
| 1 11 2 2 2 1|
| 1 2 2 2 1 1 2* 2 22 2 1 111 1 |
| * 2 1 2 21 22 1 2 22 21 |
| 112 2 1 2 * 2 21 2 2 |
| 2 2 1 22 1 111 11 1 1 |
| 1 1 2 1 2 1 2 1 |
| 2 222 2 1 2 |
| 2 2 11 1 |
|2 2 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1065.37
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1063.11 -1067.03
2 -1063.14 -1066.72
--------------------------------------
TOTAL -1063.13 -1066.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.878346 0.088669 0.378800 1.507150 0.847670 1393.81 1439.94 1.000
r(A<->C){all} 0.156776 0.019421 0.000363 0.443137 0.116882 41.34 101.49 1.004
r(A<->G){all} 0.218958 0.025211 0.000435 0.519815 0.188285 175.99 187.20 1.001
r(A<->T){all} 0.174259 0.021925 0.000064 0.472546 0.133424 146.81 201.71 1.000
r(C<->G){all} 0.136592 0.017124 0.000035 0.395176 0.096848 231.38 242.16 1.000
r(C<->T){all} 0.169695 0.021574 0.000008 0.465974 0.127628 200.44 205.20 1.000
r(G<->T){all} 0.143720 0.015791 0.000047 0.407148 0.110301 202.71 214.75 1.007
pi(A){all} 0.230657 0.000222 0.201243 0.259657 0.230381 1250.15 1326.53 1.000
pi(C){all} 0.351937 0.000278 0.319905 0.383715 0.352567 1199.07 1208.41 1.000
pi(G){all} 0.253172 0.000237 0.222745 0.282469 0.252933 1194.93 1204.82 1.000
pi(T){all} 0.164234 0.000177 0.138511 0.190658 0.163776 1300.60 1349.42 1.000
alpha{1,2} 0.278740 0.107735 0.000175 0.893726 0.178806 1416.34 1458.67 1.000
alpha{3} 0.418570 0.248528 0.000316 1.451539 0.230656 1057.19 1207.33 1.000
pinvar{all} 0.995450 0.000014 0.988286 0.999937 0.996431 959.91 1061.56 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- ..**..
9 -- .*...*
10 -- .*.***
11 -- ..*..*
12 -- .**...
13 -- .*..*.
14 -- ...*.*
15 -- .**.**
16 -- ....**
17 -- ..*.*.
18 -- ..****
19 -- .*.*..
20 -- .****.
21 -- ...**.
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 456 0.151899 0.001884 0.150566 0.153231 2
8 456 0.151899 0.004711 0.148568 0.155230 2
9 453 0.150899 0.010835 0.143238 0.158561 2
10 445 0.148235 0.000471 0.147901 0.148568 2
11 438 0.145903 0.005653 0.141905 0.149900 2
12 438 0.145903 0.011306 0.137908 0.153897 2
13 438 0.145903 0.003769 0.143238 0.148568 2
14 434 0.144570 0.001884 0.143238 0.145903 2
15 433 0.144237 0.003298 0.141905 0.146569 2
16 427 0.142239 0.004240 0.139241 0.145237 2
17 424 0.141239 0.006595 0.136576 0.145903 2
18 415 0.138241 0.025910 0.119920 0.156562 2
19 410 0.136576 0.000942 0.135909 0.137242 2
20 407 0.135576 0.014604 0.125250 0.145903 2
21 402 0.133911 0.001884 0.132578 0.135243 2
22 271 0.090273 0.014604 0.079947 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.088226 0.008545 0.000050 0.272501 0.059669 1.000 2
length{all}[2] 0.090434 0.008605 0.000037 0.276956 0.060966 1.000 2
length{all}[3] 0.089657 0.008403 0.000002 0.265893 0.061557 1.000 2
length{all}[4] 0.093050 0.009001 0.000002 0.284000 0.063368 1.000 2
length{all}[5] 0.090759 0.008594 0.000010 0.278241 0.061160 1.000 2
length{all}[6] 0.150042 0.016218 0.000014 0.407270 0.115067 1.000 2
length{all}[7] 0.090825 0.009629 0.000208 0.237609 0.061374 1.000 2
length{all}[8] 0.093076 0.009201 0.000057 0.298421 0.066055 1.000 2
length{all}[9] 0.091372 0.009373 0.000141 0.272705 0.058764 1.031 2
length{all}[10] 0.091732 0.009332 0.000130 0.269901 0.060789 0.998 2
length{all}[11] 0.093865 0.008510 0.000231 0.271874 0.059393 1.001 2
length{all}[12] 0.094204 0.010067 0.000054 0.282178 0.064800 1.013 2
length{all}[13] 0.090596 0.008040 0.000149 0.278037 0.062685 0.998 2
length{all}[14] 0.091242 0.008130 0.000021 0.264708 0.061475 1.000 2
length{all}[15] 0.099825 0.011098 0.000098 0.277414 0.071232 0.998 2
length{all}[16] 0.095805 0.009087 0.000202 0.283226 0.065251 0.998 2
length{all}[17] 0.089184 0.007027 0.000029 0.250360 0.064153 1.013 2
length{all}[18] 0.078903 0.006166 0.000122 0.239507 0.058307 1.004 2
length{all}[19] 0.092121 0.008377 0.000142 0.286782 0.063062 1.011 2
length{all}[20] 0.098659 0.010687 0.000226 0.327413 0.067338 1.001 2
length{all}[21] 0.087759 0.008956 0.000376 0.289512 0.057690 0.998 2
length{all}[22] 0.088264 0.009224 0.000092 0.293596 0.057086 1.008 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007037
Maximum standard deviation of split frequencies = 0.025910
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.003
Maximum PSRF for parameter values = 1.031
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------- C1 (1)
|
|-------------------------------------- C2 (2)
|
|--------------------------------------- C3 (3)
+
|---------------------------------------- C4 (4)
|
|-------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|-----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 777
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 259 / 259 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 259 / 259 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.080450 0.021172 0.060406 0.094615 0.055848 0.097975 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1137.961870
Iterating by ming2
Initial: fx= 1137.961870
x= 0.08045 0.02117 0.06041 0.09461 0.05585 0.09798 0.30000 1.30000
1 h-m-p 0.0000 0.0001 616.7629 ++ 1106.435970 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 3486.1181 ++ 1056.374472 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0001 111.7093 ++ 1052.898121 m 0.0001 35 | 3/8
4 h-m-p 0.0000 0.0002 162.3470 ++ 1043.320784 m 0.0002 46 | 4/8
5 h-m-p 0.0000 0.0001 131.8334 ++ 1039.712582 m 0.0001 57 | 5/8
6 h-m-p 0.0108 5.4125 3.4004 ++++YYYCYCCC 1036.452170 7 3.2574 82 | 5/8
7 h-m-p 1.6000 8.0000 0.8735 +YCYCCC 1036.024913 5 3.8544 102 | 5/8
8 h-m-p 1.6000 8.0000 0.2014 ++ 1035.851110 m 8.0000 116 | 5/8
9 h-m-p 0.4202 8.0000 3.8344 +YCYC 1035.450442 3 3.4603 135 | 5/8
10 h-m-p 1.6000 8.0000 0.0839 ++ 1035.437374 m 8.0000 146 | 5/8
11 h-m-p 0.2689 8.0000 2.4967 ++YYC 1035.376145 2 4.9575 164 | 5/8
12 h-m-p 1.6000 8.0000 1.7993 YCCC 1035.357682 3 3.0905 180 | 5/8
13 h-m-p 1.6000 8.0000 2.3781 ++ 1035.333474 m 8.0000 191 | 5/8
14 h-m-p 1.2596 8.0000 15.1041 ++ 1035.297901 m 8.0000 202 | 5/8
15 h-m-p 1.6000 8.0000 18.5898 YC 1035.293665 1 3.1374 214 | 5/8
16 h-m-p 1.6000 8.0000 29.0847 +YC 1035.287006 1 5.0208 227 | 5/8
17 h-m-p 1.6000 8.0000 60.8092 YCC 1035.283386 2 2.7836 241 | 5/8
18 h-m-p 1.5393 7.6965 86.1771 YC 1035.280485 1 3.8119 253 | 5/8
19 h-m-p 0.5224 2.6121 128.5941 ++ 1035.278853 m 2.6121 264 | 6/8
20 h-m-p 0.6180 3.0901 99.9592 ++ 1035.277744 m 3.0901 275 | 7/8
21 h-m-p 1.6000 8.0000 0.0000 Y 1035.277732 0 0.9998 286 | 7/8
22 h-m-p 1.6000 8.0000 0.0000 ------Y 1035.277732 0 0.0001 304
Out..
lnL = -1035.277732
305 lfun, 305 eigenQcodon, 1830 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.074493 0.063341 0.023546 0.087647 0.091359 0.015129 999.000000 0.846598 0.566085
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.025051
np = 9
lnL0 = -1121.821453
Iterating by ming2
Initial: fx= 1121.821453
x= 0.07449 0.06334 0.02355 0.08765 0.09136 0.01513 951.42857 0.84660 0.56608
1 h-m-p 0.0000 0.0001 575.8310 ++ 1101.650440 m 0.0001 14 | 0/9
2 h-m-p 0.0000 0.0000 5340.3085
h-m-p: 8.07904701e-19 4.03952351e-18 5.34030848e+03 1101.650440
.. | 0/9
3 h-m-p 0.0000 0.0000 236650.6586 -YCYYYYCCCC 1095.745754 10 0.0000 51 | 0/9
4 h-m-p 0.0000 0.0000 552.0780 ++ 1092.037867 m 0.0000 63 | 1/9
5 h-m-p 0.0001 0.0040 112.9316 ++++ 1050.101728 m 0.0040 77 | 2/9
6 h-m-p 0.0000 0.0000 2734.4791 ++ 1043.000443 m 0.0000 89 | 3/9
7 h-m-p 0.0001 0.0004 320.2523 ++ 1040.206740 m 0.0004 101 | 3/9
8 h-m-p 0.0000 0.0000 142.2738
h-m-p: 1.45085309e-21 7.25426547e-21 1.42273809e+02 1040.206740
.. | 3/9
9 h-m-p 0.0000 0.0000 354.3124 ++ 1036.454437 m 0.0000 122 | 4/9
10 h-m-p 0.0000 0.0000 34.1900 ++ 1036.451498 m 0.0000 134 | 4/9
11 h-m-p 0.0000 0.0000 5.9976
h-m-p: 1.74963346e-23 8.74816728e-23 5.99755047e+00 1036.451498
.. | 4/9
12 h-m-p 0.0000 0.0000 253.2496 ++ 1035.997415 m 0.0000 155 | 5/9
13 h-m-p 0.0009 0.4550 1.4594 +++++ 1035.659526 m 0.4550 170 | 6/9
14 h-m-p 1.5912 7.9562 0.0032 YYC 1035.647153 2 1.1279 184 | 6/9
15 h-m-p 1.6000 8.0000 0.0000 Y 1035.647153 0 0.9487 199 | 6/9
16 h-m-p 1.6000 8.0000 0.0000 ---Y 1035.647153 0 0.0112 217
Out..
lnL = -1035.647153
218 lfun, 654 eigenQcodon, 2616 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.108381 0.069346 0.095199 0.022364 0.099514 0.084405 951.428579 1.367887 0.306138 0.315999 1008.375474
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000179
np = 11
lnL0 = -1072.136011
Iterating by ming2
Initial: fx= 1072.136011
x= 0.10838 0.06935 0.09520 0.02236 0.09951 0.08440 951.42858 1.36789 0.30614 0.31600 951.42857
1 h-m-p 0.0000 0.0008 60.4141 ++++ 1068.886041 m 0.0008 18 | 1/11
2 h-m-p 0.0011 0.0206 35.0691 +++ 1049.608817 m 0.0206 33 | 2/11
3 h-m-p 0.0000 0.0001 1251.4100 ++ 1046.972529 m 0.0001 47 | 3/11
4 h-m-p 0.0000 0.0001 883.6122 ++ 1046.323450 m 0.0001 61 | 4/11
5 h-m-p 0.0000 0.0000 10090.1511 ++ 1045.766076 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0060 1571.5969 ++CCCC 1040.044485 3 0.0010 97 | 5/11
7 h-m-p 0.0157 0.0783 3.3096 ++ 1039.264652 m 0.0783 111 | 6/11
8 h-m-p 0.0529 3.0738 1.7528 +YCCC 1038.833902 3 0.4476 131 | 6/11
9 h-m-p 1.0455 8.0000 0.7504 ----------------.. | 6/11
10 h-m-p 0.0001 0.0332 9.3143 ++++CYYCYYCYYY 1035.369304 10 0.0322 195 | 6/11
11 h-m-p 0.1929 8.0000 1.5542 ---------------.. | 6/11
12 h-m-p 0.0000 0.0003 31.5028 ++YCYC 1035.293180 3 0.0001 242 | 6/11
13 h-m-p 0.0859 8.0000 0.0425 ++YCC 1035.290649 2 2.6144 261 | 6/11
14 h-m-p 0.5016 8.0000 0.2218 +YYCC 1035.280948 3 2.5885 285 | 6/11
15 h-m-p 1.6000 8.0000 0.1861 YCC 1035.279058 2 0.9340 307 | 6/11
16 h-m-p 1.6000 8.0000 0.1057 +YC 1035.277992 1 5.1472 328 | 6/11
17 h-m-p 1.6000 8.0000 0.0733 YC 1035.277733 1 0.7855 348 | 6/11
18 h-m-p 0.5261 8.0000 0.1095 +CC 1035.277598 1 3.2291 370 | 6/11
19 h-m-p 1.6000 8.0000 0.0582 C 1035.277573 0 1.6000 389 | 6/11
20 h-m-p 1.1502 8.0000 0.0810 C 1035.277567 0 1.5122 408 | 6/11
21 h-m-p 1.6000 8.0000 0.0159 C 1035.277566 0 1.4648 427 | 6/11
22 h-m-p 1.6000 8.0000 0.0041 C 1035.277566 0 1.9239 446 | 6/11
23 h-m-p 1.6000 8.0000 0.0035 --Y 1035.277566 0 0.0136 467 | 6/11
24 h-m-p 0.0160 8.0000 0.0031 Y 1035.277566 0 0.0332 486 | 6/11
25 h-m-p 0.0295 8.0000 0.0035 --Y 1035.277566 0 0.0005 507 | 6/11
26 h-m-p 0.0160 8.0000 0.0041 ---N 1035.277566 0 0.0001 529 | 6/11
27 h-m-p 0.0160 8.0000 0.0001 ++Y 1035.277566 0 0.1829 550 | 6/11
28 h-m-p 0.0708 8.0000 0.0003 -----Y 1035.277566 0 0.0000 574
Out..
lnL = -1035.277566
575 lfun, 2300 eigenQcodon, 10350 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1037.777375 S = -1036.296922 -2.377987
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:04
did 20 / 55 patterns 0:04
did 30 / 55 patterns 0:04
did 40 / 55 patterns 0:04
did 50 / 55 patterns 0:04
did 55 / 55 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.011392 0.024058 0.097225 0.086933 0.065069 0.049649 951.428927 0.359541 1.344158
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.041081
np = 9
lnL0 = -1113.133743
Iterating by ming2
Initial: fx= 1113.133743
x= 0.01139 0.02406 0.09723 0.08693 0.06507 0.04965 951.42893 0.35954 1.34416
1 h-m-p 0.0000 0.0000 557.5614 ++ 1098.212826 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 396.6525 +YYCCYC 1089.463391 5 0.0001 36 | 1/9
3 h-m-p 0.0012 0.0127 30.5238 +CYYCYYCCC 1086.553698 8 0.0101 61 | 1/9
4 h-m-p 0.0033 0.0163 7.2890 ------------.. | 1/9
5 h-m-p 0.0000 0.0001 472.8776 ++ 1073.678034 m 0.0001 95 | 2/9
6 h-m-p 0.0000 0.0000 117451.6892 ++ 1048.982850 m 0.0000 107 | 3/9
7 h-m-p 0.0003 0.0017 29.8122 ++ 1040.720933 m 0.0017 119 | 4/9
8 h-m-p 0.0000 0.0000 213.7811 ++ 1038.845148 m 0.0000 131 | 5/9
9 h-m-p 0.0003 0.0210 9.4785 ++YCCYC 1036.498018 4 0.0165 152 | 5/9
10 h-m-p 0.3456 2.6667 0.4531 ++ 1036.040261 m 2.6667 164
QuantileBeta(0.85, 0.48277, 0.00494) = 1.000000e+00 2000 rounds
| 6/9
11 h-m-p 0.4124 2.0622 0.0062 YCYCCC 1035.647156 5 1.1114 188 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 Y 1035.647156 0 0.7186 203
Out..
lnL = -1035.647156
204 lfun, 2244 eigenQcodon, 12240 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.072253 0.090479 0.025087 0.082541 0.051297 0.035511 951.428937 0.900000 1.181636 1.641029 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000284
np = 11
lnL0 = -1059.354117
Iterating by ming2
Initial: fx= 1059.354117
x= 0.07225 0.09048 0.02509 0.08254 0.05130 0.03551 951.42894 0.90000 1.18164 1.64103 951.42857
1 h-m-p 0.0000 0.0006 185.7759 ++CYYCYYYYCY 1043.954060 10 0.0005 30 | 0/11
2 h-m-p 0.0002 0.0010 34.5403 ++ 1043.020291 m 0.0010 44 | 1/11
3 h-m-p 0.0012 0.0059 15.4479 ++ 1040.432928 m 0.0059 58 | 2/11
4 h-m-p 0.0000 0.0001 585.1790 ++ 1038.555483 m 0.0001 72 | 3/11
5 h-m-p 0.0021 0.0107 0.9889 ------------.. | 3/11
6 h-m-p 0.0000 0.0000 147.2339 ++ 1037.835531 m 0.0000 118 | 4/11
7 h-m-p 0.0000 0.0000 322.9016 ++ 1037.737707 m 0.0000 132 | 5/11
8 h-m-p 0.0000 0.0088 14.8906 ++++YYCYYYCCCY 1035.301743 10 0.0084 165 | 5/11
9 h-m-p 0.3169 1.5844 0.0123 -Y 1035.301728 0 0.0119 180 | 5/11
10 h-m-p 0.0305 8.0000 0.0048 +++++ 1035.287706 m 8.0000 203 | 5/11
11 h-m-p 1.6000 8.0000 0.0162 ++ 1035.279016 m 8.0000 223 | 5/11
12 h-m-p 1.6000 8.0000 0.0067 YC 1035.278865 1 0.6550 244 | 5/11
13 h-m-p 0.3091 8.0000 0.0142 +++ 1035.278143 m 8.0000 265 | 5/11
14 h-m-p 1.6000 8.0000 0.0057 YC 1035.277899 1 1.2284 286 | 5/11
15 h-m-p 0.2381 8.0000 0.0295 ++C 1035.277690 0 4.1267 308 | 5/11
16 h-m-p 1.6000 8.0000 0.0237 C 1035.277634 0 2.1224 328 | 5/11
17 h-m-p 1.2146 8.0000 0.0415 C 1035.277605 0 1.4686 348 | 5/11
18 h-m-p 1.6000 8.0000 0.0320 Y 1035.277594 0 3.1907 368 | 5/11
19 h-m-p 1.6000 8.0000 0.0041 Y 1035.277593 0 0.8746 388 | 5/11
20 h-m-p 0.7051 8.0000 0.0051 +Y 1035.277592 0 2.3195 409 | 5/11
21 h-m-p 1.6000 8.0000 0.0015 Y 1035.277592 0 1.0327 429 | 5/11
22 h-m-p 1.6000 8.0000 0.0001 +C 1035.277592 0 6.1594 450 | 5/11
23 h-m-p 0.7484 8.0000 0.0008 +C 1035.277592 0 3.4388 471 | 5/11
24 h-m-p 1.6000 8.0000 0.0017 ++ 1035.277592 m 8.0000 491 | 5/11
25 h-m-p 0.5483 8.0000 0.0248 +Y 1035.277592 0 4.6289 512 | 5/11
26 h-m-p 1.4681 8.0000 0.0782 ++ 1035.277583 m 8.0000 532 | 5/11
27 h-m-p 0.0550 0.2752 8.5233 +
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
+ 1035.277553 m 0.2752 552
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.917302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683963e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.56744) = 6.683967e-161 2000 rounds
| 6/11
28 h-m-p 1.6000 8.0000 0.6601
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22019) = 3.062728e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.69371) = 4.899767e-161 2000 rounds
C 1035.277546 0 1.6000 566
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.340725e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48080) = 5.160346e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48045) = 5.160797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48063) = 5.160571e-161 2000 rounds
| 6/11
29 h-m-p 0.7084 8.0000 1.4909
QuantileBeta(0.15, 0.00500, 5.40444) = 4.192695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.17589) = 2.682097e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 14.91330) = 1.429304e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
C 1035.277534 0 2.8988 586
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.745373e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26091) = 2.652764e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.26090) = 2.652766e-161 2000 rounds
| 6/11
30 h-m-p 1.3405 8.0000 3.2241
QuantileBeta(0.15, 0.00500, 12.03489) = 1.785695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 23.35683) = 9.014721e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
C 1035.277523 0 1.6588 600
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.714900e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657052e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.93111) = 1.657053e-161 2000 rounds
| 6/11
31 h-m-p 0.2143 3.7489 24.9501
QuantileBeta(0.15, 0.00500, 17.59639) = 1.205093e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 25.73419) = 8.165630e-162 2000 rounds
Y 1035.277479 0 0.8574 615
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.858786e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59226) = 6.627422e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.59224) = 6.627425e-162 2000 rounds
| 6/11
32 h-m-p 0.1572 0.7860 91.6678
QuantileBeta(0.15, 0.00500, 44.15825) = 3.802726e-162 2000 rounds
+C 1035.277364 0 0.6288 630 | 6/11
33 h-m-p 0.0133 0.0665 216.6083 ++ 1035.277309 m 0.0665 644 | 7/11
34 h-m-p 0.3509 2.6386 36.7279
QuantileBeta(0.15, 0.00500, 44.18782) = 3.800152e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
C 1035.277211 0 1.2834 659
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49257) = 3.577620e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49259) = 2.069996e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.49257) = 2.069997e-162 2000 rounds
| 7/11
35 h-m-p 0.3330 1.6649 31.1425
QuantileBeta(0.15, 0.00500, 58.59406) = 7.229739e-163 2000 rounds
++ 1035.277194 m 1.6649 673 | 7/11
36 h-m-p 0.0000 0.0000 230.2173
h-m-p: 0.00000000e+00 0.00000000e+00 2.30217265e+02 1035.277194
.. | 7/11
37 h-m-p 0.0000 0.0038 1.1023 Y 1035.277182 0 0.0000 698 | 7/11
38 h-m-p 0.0160 8.0000 0.0033 +++Y 1035.277174 0 1.7143 715 | 7/11
39 h-m-p 1.6000 8.0000 0.0000 Y 1035.277173 0 0.9435 733
Out..
lnL = -1035.277173
734 lfun, 8808 eigenQcodon, 48444 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1037.252762 S = -1035.998532 -2.003343
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:22
did 20 / 55 patterns 0:22
did 30 / 55 patterns 0:22
did 40 / 55 patterns 0:23
did 50 / 55 patterns 0:23
did 55 / 55 patterns 0:23
Time used: 0:23
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=259
NC_011896_1_WP_010907725_1_444_MLBR_RS02120 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
NC_002677_1_NP_301401_1_273_ML0431 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405 MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP
*************** **********************************
NC_011896_1_WP_010907725_1_444_MLBR_RS02120 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
NC_002677_1_NP_301401_1_273_ML0431 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405 PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG
**************************************************
NC_011896_1_WP_010907725_1_444_MLBR_RS02120 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
NC_002677_1_NP_301401_1_273_ML0431 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405 ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP
**************************************************
NC_011896_1_WP_010907725_1_444_MLBR_RS02120 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
NC_002677_1_NP_301401_1_273_ML0431 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405 TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT
**************************************************
NC_011896_1_WP_010907725_1_444_MLBR_RS02120 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
NC_002677_1_NP_301401_1_273_ML0431 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405 EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV
**************************************************
NC_011896_1_WP_010907725_1_444_MLBR_RS02120 GLTICDAPR
NC_002677_1_NP_301401_1_273_ML0431 GLTICDAPR
NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980 GLTICDAPR
NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405 GLTICDAPR
NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320 GLTICDAPR
NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405 GLTICDAPR
*********
>NC_011896_1_WP_010907725_1_444_MLBR_RS02120 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA GGCCTGACGATCTGCGATGCTCCCCGC >NC_002677_1_NP_301401_1_273_ML0431 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA GGCCTGACGATCTGCGATGCTCCCCGC >NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA GGCCTGACGATCTGCGATGCTCCCCGC >NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA GGCCTGACGATCTGCGATGCTCCCCGC >NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGGGTC TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA GGCCTGACGATCTGCGATGCTCCCCGC >NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405 ATGAATAATCCACGGCGATCTGAGTGGCTAGGCCCCAGTCTAGCCGAGTC TGGGCCGATCGAGCCGCAAGTCCATCAATATCCGCCACTCACCGACCCGG CCTATGCCGAACAAGCGCCCTACGCGCCCGCGTACGGCGCTTCGCTTCCA CCCTGGACGCCAAAAAAACCGCCCCAACAGTTGCCGCGATACTGGCAACA AGACCAACCCCCACCGACCGACATACCCCCAGAGGGACTGACTCTCCCAC CACCGCACGAGCCGAAATCACCACACTGGTTTTTGTGGGTCGTAGCGGGC GCATCCGTTGTGCTGGTAGTCGGACTAGTCATGGCGCTAATAATCGCAAA CGGCGCGATCAAAACACAGACGGCCGTACCACCGTTGCCCGCCATAACCG AGTCAAGTTCGGCCACCCCAACACCAACTACCAAGACGTCCCCCACACCC ACCGCCGGGCCGGCGCCATCTACTACCGGCTCTGGCACGCTCACCCAGAC TATCGGACCGTCCGCGATGCTGGACGTTGTCTATAGCATCACTGGCCAAG GCCGGGCCATTAGCGTCACGTACATGGATACCGGCGACGTCATACAAACC GAGTTCAACGTGGTGTTGCCATGGAGTAAGCAGGTCAGTCTGTCAAAGTC AGCCGTTCATCCGGCAAGCGTCACGATCGTCAACATCGGCCACGATGTCA CATGCTCGGTCACGGTGGCCGGAGTTCAAATACGCCAGCACACCGGGGTA GGCCTGACGATCTGCGATGCTCCCCGC
>NC_011896_1_WP_010907725_1_444_MLBR_RS02120 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV GLTICDAPR >NC_002677_1_NP_301401_1_273_ML0431 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV GLTICDAPR >NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV GLTICDAPR >NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV GLTICDAPR >NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320 MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV GLTICDAPR >NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405 MNNPRRSEWLGPSLAESGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLP PWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAG ASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTP TAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQT EFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGV GLTICDAPR
#NEXUS
[ID: 1182100392]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907725_1_444_MLBR_RS02120
NC_002677_1_NP_301401_1_273_ML0431
NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980
NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405
NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320
NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907725_1_444_MLBR_RS02120,
2 NC_002677_1_NP_301401_1_273_ML0431,
3 NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980,
4 NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405,
5 NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320,
6 NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05966942,2:0.06096646,3:0.0615566,4:0.0633677,5:0.0611596,6:0.1150665);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05966942,2:0.06096646,3:0.0615566,4:0.0633677,5:0.0611596,6:0.1150665);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1063.11 -1067.03
2 -1063.14 -1066.72
--------------------------------------
TOTAL -1063.13 -1066.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0431/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.878346 0.088669 0.378800 1.507150 0.847670 1393.81 1439.94 1.000
r(A<->C){all} 0.156776 0.019421 0.000363 0.443137 0.116882 41.34 101.49 1.004
r(A<->G){all} 0.218958 0.025211 0.000435 0.519815 0.188285 175.99 187.20 1.001
r(A<->T){all} 0.174259 0.021925 0.000064 0.472546 0.133424 146.81 201.71 1.000
r(C<->G){all} 0.136592 0.017124 0.000035 0.395176 0.096848 231.38 242.16 1.000
r(C<->T){all} 0.169695 0.021574 0.000008 0.465974 0.127628 200.44 205.20 1.000
r(G<->T){all} 0.143720 0.015791 0.000047 0.407148 0.110301 202.71 214.75 1.007
pi(A){all} 0.230657 0.000222 0.201243 0.259657 0.230381 1250.15 1326.53 1.000
pi(C){all} 0.351937 0.000278 0.319905 0.383715 0.352567 1199.07 1208.41 1.000
pi(G){all} 0.253172 0.000237 0.222745 0.282469 0.252933 1194.93 1204.82 1.000
pi(T){all} 0.164234 0.000177 0.138511 0.190658 0.163776 1300.60 1349.42 1.000
alpha{1,2} 0.278740 0.107735 0.000175 0.893726 0.178806 1416.34 1458.67 1.000
alpha{3} 0.418570 0.248528 0.000316 1.451539 0.230656 1057.19 1207.33 1.000
pinvar{all} 0.995450 0.000014 0.988286 0.999937 0.996431 959.91 1061.56 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0431/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 259
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 4 4 4 4 4 4 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 3 3 3 3 3 3 | TAC 4 4 4 4 4 4 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 0
CTC 3 3 3 3 3 3 | CCC 11 11 11 11 11 11 | CAC 4 4 4 4 4 4 | CGC 2 2 2 2 2 2
CTA 4 4 4 4 4 4 | CCA 14 14 14 14 14 14 | Gln CAA 10 10 10 10 10 10 | CGA 2 2 2 2 2 2
CTG 5 5 5 5 5 5 | CCG 13 13 13 13 13 13 | CAG 5 5 5 5 5 5 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 5 5 5 5 5 5 | Asn AAT 2 2 2 2 2 2 | Ser AGT 4 4 4 4 4 4
ATC 8 8 8 8 8 8 | ACC 11 11 11 11 11 11 | AAC 3 3 3 3 3 3 | AGC 3 3 3 3 3 3
ATA 5 5 5 5 5 5 | ACA 4 4 4 4 4 4 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 8 8 8 8 8 8 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 2 2 2 2 2 2 | Asp GAT 3 3 3 3 3 3 | Gly GGT 0 0 0 0 0 0
GTC 12 12 12 12 12 12 | GCC 10 10 10 10 10 10 | GAC 5 5 5 5 5 5 | GGC 11 11 11 11 11 11
GTA 4 4 4 4 4 4 | GCA 3 3 3 3 3 3 | Glu GAA 1 1 1 1 1 1 | GGA 4 4 4 4 4 4
GTG 4 4 4 4 4 4 | GCG 8 8 8 8 8 8 | GAG 6 6 6 6 6 7 | GGG 4 4 4 4 4 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907725_1_444_MLBR_RS02120
position 1: T:0.13514 C:0.30116 A:0.25097 G:0.31274
position 2: T:0.23552 C:0.39768 A:0.21236 G:0.15444
position 3: T:0.12355 C:0.35907 A:0.22780 G:0.28958
Average T:0.16474 C:0.35264 A:0.23037 G:0.25225
#2: NC_002677_1_NP_301401_1_273_ML0431
position 1: T:0.13514 C:0.30116 A:0.25097 G:0.31274
position 2: T:0.23552 C:0.39768 A:0.21236 G:0.15444
position 3: T:0.12355 C:0.35907 A:0.22780 G:0.28958
Average T:0.16474 C:0.35264 A:0.23037 G:0.25225
#3: NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980
position 1: T:0.13514 C:0.30116 A:0.25097 G:0.31274
position 2: T:0.23552 C:0.39768 A:0.21236 G:0.15444
position 3: T:0.12355 C:0.35907 A:0.22780 G:0.28958
Average T:0.16474 C:0.35264 A:0.23037 G:0.25225
#4: NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405
position 1: T:0.13514 C:0.30116 A:0.25097 G:0.31274
position 2: T:0.23552 C:0.39768 A:0.21236 G:0.15444
position 3: T:0.12355 C:0.35907 A:0.22780 G:0.28958
Average T:0.16474 C:0.35264 A:0.23037 G:0.25225
#5: NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320
position 1: T:0.13514 C:0.30116 A:0.25097 G:0.31274
position 2: T:0.23552 C:0.39768 A:0.21236 G:0.15444
position 3: T:0.12355 C:0.35907 A:0.22780 G:0.28958
Average T:0.16474 C:0.35264 A:0.23037 G:0.25225
#6: NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405
position 1: T:0.13514 C:0.30116 A:0.25097 G:0.31274
position 2: T:0.23552 C:0.39768 A:0.21622 G:0.15058
position 3: T:0.12355 C:0.35907 A:0.22780 G:0.28958
Average T:0.16474 C:0.35264 A:0.23166 G:0.25097
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 24 | Tyr Y TAT 18 | Cys C TGT 0
TTC 6 | TCC 18 | TAC 24 | TGC 12
Leu L TTA 0 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 0
CTC 18 | CCC 66 | CAC 24 | CGC 12
CTA 24 | CCA 84 | Gln Q CAA 60 | CGA 12
CTG 30 | CCG 78 | CAG 30 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 30 | Asn N AAT 12 | Ser S AGT 24
ATC 48 | ACC 66 | AAC 18 | AGC 18
ATA 30 | ACA 24 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 24 | ACG 48 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 12 | Asp D GAT 18 | Gly G GGT 0
GTC 72 | GCC 60 | GAC 30 | GGC 66
GTA 24 | GCA 18 | Glu E GAA 6 | GGA 24
GTG 24 | GCG 48 | GAG 37 | GGG 23
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13514 C:0.30116 A:0.25097 G:0.31274
position 2: T:0.23552 C:0.39768 A:0.21300 G:0.15380
position 3: T:0.12355 C:0.35907 A:0.22780 G:0.28958
Average T:0.16474 C:0.35264 A:0.23059 G:0.25204
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -1035.277732 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.003923 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003943
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.003923);
(NC_011896_1_WP_010907725_1_444_MLBR_RS02120: 0.000004, NC_002677_1_NP_301401_1_273_ML0431: 0.000004, NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980: 0.000004, NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405: 0.000004, NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320: 0.000004, NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405: 0.003923);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.5 242.5 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 534.5 242.5 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 534.5 242.5 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 534.5 242.5 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 534.5 242.5 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.004 534.5 242.5 999.0000 0.0019 0.0000 1.0 0.0
tree length for dN: 0.0019
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1035.647153 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.003939 951.428579 0.000010 0.328334
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003959
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.003939);
(NC_011896_1_WP_010907725_1_444_MLBR_RS02120: 0.000004, NC_002677_1_NP_301401_1_273_ML0431: 0.000004, NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980: 0.000004, NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405: 0.000004, NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320: 0.000004, NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405: 0.003939);
Detailed output identifying parameters
kappa (ts/tv) = 951.42858
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.32833 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.004 534.5 242.5 1.0000 0.0013 0.0013 0.7 0.3
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1035.277566 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004102 951.428927 0.780232 0.133469 0.000001 951.437193
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004122
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004102);
(NC_011896_1_WP_010907725_1_444_MLBR_RS02120: 0.000004, NC_002677_1_NP_301401_1_273_ML0431: 0.000004, NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980: 0.000004, NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405: 0.000004, NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320: 0.000004, NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405: 0.004102);
Detailed output identifying parameters
kappa (ts/tv) = 951.42893
MLEs of dN/dS (w) for site classes (K=3)
p: 0.78023 0.13347 0.08630
w: 0.00000 1.00000 951.43719
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.5 242.5 82.2417 0.0000 0.0000 0.0 0.0
7..2 0.000 534.5 242.5 82.2417 0.0000 0.0000 0.0 0.0
7..3 0.000 534.5 242.5 82.2417 0.0000 0.0000 0.0 0.0
7..4 0.000 534.5 242.5 82.2417 0.0000 0.0000 0.0 0.0
7..5 0.000 534.5 242.5 82.2417 0.0000 0.0000 0.0 0.0
7..6 0.004 534.5 242.5 82.2417 0.0020 0.0000 1.1 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907725_1_444_MLBR_RS02120)
Pr(w>1) post mean +- SE for w
16 G 0.998** 949.836
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907725_1_444_MLBR_RS02120)
Pr(w>1) post mean +- SE for w
16 G 0.796 6.020 +- 3.444
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.041 0.055 0.068 0.081 0.094 0.107 0.120 0.132 0.145 0.157
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.005
0.009 0.007 0.007 0.005 0.004
0.011 0.009 0.009 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.022 0.020 0.020 0.018 0.018 0.016 0.016 0.014 0.014 0.012 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1035.647156 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.003939 951.428937 0.477657 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003959
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.003939);
(NC_011896_1_WP_010907725_1_444_MLBR_RS02120: 0.000004, NC_002677_1_NP_301401_1_273_ML0431: 0.000004, NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980: 0.000004, NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405: 0.000004, NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320: 0.000004, NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405: 0.003939);
Detailed output identifying parameters
kappa (ts/tv) = 951.42894
Parameters in M7 (beta):
p = 0.47766 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99984 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 534.5 242.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.004 534.5 242.5 1.0000 0.0013 0.0013 0.7 0.3
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1035.277173 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004184 974.069391 0.937958 0.005000 99.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004204
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004184);
(NC_011896_1_WP_010907725_1_444_MLBR_RS02120: 0.000004, NC_002677_1_NP_301401_1_273_ML0431: 0.000004, NZ_LVXE01000046_1_WP_010907725_1_1951_A3216_RS10980: 0.000004, NZ_LYPH01000052_1_WP_010907725_1_1965_A8144_RS09405: 0.000004, NZ_CP029543_1_WP_010907725_1_452_DIJ64_RS02320: 0.000004, NZ_AP014567_1_WP_119607894_1_469_JK2ML_RS02405: 0.004184);
Detailed output identifying parameters
kappa (ts/tv) = 974.06939
Parameters in M8 (beta&w>1):
p0 = 0.93796 p = 0.00500 q = 99.00000
(p1 = 0.06204) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09380 0.09380 0.09380 0.09380 0.09380 0.09380 0.09380 0.09380 0.09380 0.09380 0.06204
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.5 242.5 61.9799 0.0000 0.0000 0.0 0.0
7..2 0.000 534.5 242.5 61.9799 0.0000 0.0000 0.0 0.0
7..3 0.000 534.5 242.5 61.9799 0.0000 0.0000 0.0 0.0
7..4 0.000 534.5 242.5 61.9799 0.0000 0.0000 0.0 0.0
7..5 0.000 534.5 242.5 61.9799 0.0000 0.0000 0.0 0.0
7..6 0.004 534.5 242.5 61.9799 0.0020 0.0000 1.1 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907725_1_444_MLBR_RS02120)
Pr(w>1) post mean +- SE for w
16 G 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907725_1_444_MLBR_RS02120)
Pr(w>1) post mean +- SE for w
1 M 0.632 4.762 +- 3.838
2 N 0.632 4.763 +- 3.838
3 N 0.632 4.763 +- 3.838
4 P 0.632 4.762 +- 3.838
5 R 0.632 4.763 +- 3.838
6 R 0.632 4.763 +- 3.838
7 S 0.632 4.763 +- 3.838
8 E 0.632 4.762 +- 3.838
9 W 0.632 4.763 +- 3.838
10 L 0.632 4.762 +- 3.838
11 G 0.632 4.762 +- 3.838
12 P 0.632 4.762 +- 3.838
13 S 0.632 4.763 +- 3.838
14 L 0.632 4.762 +- 3.838
15 A 0.632 4.762 +- 3.838
16 G 0.920 6.775 +- 3.022
17 S 0.632 4.763 +- 3.838
18 G 0.632 4.762 +- 3.838
19 P 0.632 4.762 +- 3.838
20 I 0.632 4.762 +- 3.838
21 E 0.632 4.762 +- 3.838
22 P 0.632 4.762 +- 3.838
23 Q 0.632 4.763 +- 3.838
24 V 0.632 4.762 +- 3.838
25 H 0.632 4.763 +- 3.838
26 Q 0.632 4.763 +- 3.838
27 Y 0.632 4.763 +- 3.838
28 P 0.632 4.762 +- 3.838
29 P 0.632 4.762 +- 3.838
30 L 0.632 4.762 +- 3.838
31 T 0.632 4.762 +- 3.838
32 D 0.632 4.762 +- 3.838
33 P 0.632 4.762 +- 3.838
34 A 0.632 4.762 +- 3.838
35 Y 0.632 4.763 +- 3.838
36 A 0.632 4.762 +- 3.838
37 E 0.632 4.763 +- 3.838
38 Q 0.632 4.763 +- 3.838
39 A 0.632 4.762 +- 3.838
40 P 0.632 4.762 +- 3.838
41 Y 0.632 4.762 +- 3.838
42 A 0.632 4.762 +- 3.838
43 P 0.632 4.762 +- 3.838
44 A 0.632 4.762 +- 3.838
45 Y 0.632 4.762 +- 3.838
46 G 0.632 4.762 +- 3.838
47 A 0.632 4.763 +- 3.838
48 S 0.632 4.762 +- 3.838
49 L 0.632 4.763 +- 3.838
50 P 0.632 4.762 +- 3.838
51 P 0.632 4.762 +- 3.838
52 W 0.632 4.763 +- 3.838
53 T 0.632 4.762 +- 3.838
54 P 0.632 4.762 +- 3.838
55 K 0.632 4.763 +- 3.838
56 K 0.632 4.763 +- 3.838
57 P 0.632 4.762 +- 3.838
58 P 0.632 4.762 +- 3.838
59 Q 0.632 4.763 +- 3.838
60 Q 0.632 4.763 +- 3.838
61 L 0.632 4.763 +- 3.838
62 P 0.632 4.762 +- 3.838
63 R 0.632 4.763 +- 3.838
64 Y 0.632 4.762 +- 3.838
65 W 0.632 4.763 +- 3.838
66 Q 0.632 4.763 +- 3.838
67 Q 0.632 4.763 +- 3.838
68 D 0.632 4.762 +- 3.838
69 Q 0.632 4.763 +- 3.838
70 P 0.632 4.762 +- 3.838
71 P 0.632 4.762 +- 3.838
72 P 0.632 4.762 +- 3.838
73 T 0.632 4.762 +- 3.838
74 D 0.632 4.762 +- 3.838
75 I 0.632 4.762 +- 3.838
76 P 0.632 4.762 +- 3.838
77 P 0.632 4.762 +- 3.838
78 E 0.632 4.762 +- 3.838
79 G 0.632 4.763 +- 3.838
80 L 0.632 4.762 +- 3.838
81 T 0.632 4.763 +- 3.838
82 L 0.632 4.762 +- 3.838
83 P 0.632 4.762 +- 3.838
84 P 0.632 4.762 +- 3.838
85 P 0.632 4.762 +- 3.838
86 H 0.632 4.762 +- 3.838
87 E 0.632 4.762 +- 3.838
88 P 0.632 4.762 +- 3.838
89 K 0.632 4.763 +- 3.838
90 S 0.632 4.762 +- 3.838
91 P 0.632 4.762 +- 3.838
92 H 0.632 4.762 +- 3.838
93 W 0.632 4.763 +- 3.838
94 F 0.632 4.763 +- 3.838
95 L 0.632 4.763 +- 3.838
96 W 0.632 4.763 +- 3.838
97 V 0.632 4.762 +- 3.838
98 V 0.632 4.762 +- 3.838
99 A 0.632 4.762 +- 3.838
100 G 0.632 4.762 +- 3.838
101 A 0.632 4.762 +- 3.838
102 S 0.632 4.762 +- 3.838
103 V 0.632 4.763 +- 3.838
104 V 0.632 4.762 +- 3.838
105 L 0.632 4.762 +- 3.838
106 V 0.632 4.762 +- 3.838
107 V 0.632 4.762 +- 3.838
108 G 0.632 4.763 +- 3.838
109 L 0.632 4.762 +- 3.838
110 V 0.632 4.762 +- 3.838
111 M 0.632 4.762 +- 3.838
112 A 0.632 4.762 +- 3.838
113 L 0.632 4.762 +- 3.838
114 I 0.632 4.762 +- 3.838
115 I 0.632 4.762 +- 3.838
116 A 0.632 4.762 +- 3.838
117 N 0.632 4.762 +- 3.838
118 G 0.632 4.762 +- 3.838
119 A 0.632 4.762 +- 3.838
120 I 0.632 4.762 +- 3.838
121 K 0.632 4.763 +- 3.838
122 T 0.632 4.762 +- 3.838
123 Q 0.632 4.763 +- 3.838
124 T 0.632 4.762 +- 3.838
125 A 0.632 4.762 +- 3.838
126 V 0.632 4.762 +- 3.838
127 P 0.632 4.762 +- 3.838
128 P 0.632 4.762 +- 3.838
129 L 0.632 4.763 +- 3.838
130 P 0.632 4.762 +- 3.838
131 A 0.632 4.762 +- 3.838
132 I 0.632 4.762 +- 3.838
133 T 0.632 4.762 +- 3.838
134 E 0.632 4.762 +- 3.838
135 S 0.632 4.762 +- 3.838
136 S 0.632 4.763 +- 3.838
137 S 0.632 4.762 +- 3.838
138 A 0.632 4.762 +- 3.838
139 T 0.632 4.762 +- 3.838
140 P 0.632 4.762 +- 3.838
141 T 0.632 4.762 +- 3.838
142 P 0.632 4.762 +- 3.838
143 T 0.632 4.763 +- 3.838
144 T 0.632 4.762 +- 3.838
145 K 0.632 4.762 +- 3.838
146 T 0.632 4.762 +- 3.838
147 S 0.632 4.762 +- 3.838
148 P 0.632 4.762 +- 3.838
149 T 0.632 4.762 +- 3.838
150 P 0.632 4.762 +- 3.838
151 T 0.632 4.762 +- 3.838
152 A 0.632 4.762 +- 3.838
153 G 0.632 4.762 +- 3.838
154 P 0.632 4.762 +- 3.838
155 A 0.632 4.762 +- 3.838
156 P 0.632 4.762 +- 3.838
157 S 0.632 4.763 +- 3.838
158 T 0.632 4.763 +- 3.838
159 T 0.632 4.762 +- 3.838
160 G 0.632 4.762 +- 3.838
161 S 0.632 4.763 +- 3.838
162 G 0.632 4.762 +- 3.838
163 T 0.632 4.762 +- 3.838
164 L 0.632 4.762 +- 3.838
165 T 0.632 4.762 +- 3.838
166 Q 0.632 4.763 +- 3.838
167 T 0.632 4.763 +- 3.838
168 I 0.632 4.762 +- 3.838
169 G 0.632 4.763 +- 3.838
170 P 0.632 4.762 +- 3.838
171 S 0.632 4.762 +- 3.838
172 A 0.632 4.762 +- 3.838
173 M 0.632 4.762 +- 3.838
174 L 0.632 4.762 +- 3.838
175 D 0.632 4.762 +- 3.838
176 V 0.632 4.763 +- 3.838
177 V 0.632 4.762 +- 3.838
178 Y 0.632 4.763 +- 3.838
179 S 0.632 4.762 +- 3.838
180 I 0.632 4.762 +- 3.838
181 T 0.632 4.763 +- 3.838
182 G 0.632 4.762 +- 3.838
183 Q 0.632 4.763 +- 3.838
184 G 0.632 4.762 +- 3.838
185 R 0.632 4.763 +- 3.838
186 A 0.632 4.762 +- 3.838
187 I 0.632 4.763 +- 3.838
188 S 0.632 4.762 +- 3.838
189 V 0.632 4.762 +- 3.838
190 T 0.632 4.762 +- 3.838
191 Y 0.632 4.762 +- 3.838
192 M 0.632 4.762 +- 3.838
193 D 0.632 4.763 +- 3.838
194 T 0.632 4.762 +- 3.838
195 G 0.632 4.762 +- 3.838
196 D 0.632 4.762 +- 3.838
197 V 0.632 4.762 +- 3.838
198 I 0.632 4.762 +- 3.838
199 Q 0.632 4.763 +- 3.838
200 T 0.632 4.762 +- 3.838
201 E 0.632 4.762 +- 3.838
202 F 0.632 4.762 +- 3.838
203 N 0.632 4.762 +- 3.838
204 V 0.632 4.762 +- 3.838
205 V 0.632 4.762 +- 3.838
206 L 0.632 4.763 +- 3.838
207 P 0.632 4.762 +- 3.838
208 W 0.632 4.763 +- 3.838
209 S 0.632 4.763 +- 3.838
210 K 0.632 4.762 +- 3.838
211 Q 0.632 4.763 +- 3.838
212 V 0.632 4.762 +- 3.838
213 S 0.632 4.763 +- 3.838
214 L 0.632 4.762 +- 3.838
215 S 0.632 4.762 +- 3.838
216 K 0.632 4.762 +- 3.838
217 S 0.632 4.762 +- 3.838
218 A 0.632 4.762 +- 3.838
219 V 0.632 4.763 +- 3.838
220 H 0.632 4.763 +- 3.838
221 P 0.632 4.762 +- 3.838
222 A 0.632 4.762 +- 3.838
223 S 0.632 4.762 +- 3.838
224 V 0.632 4.762 +- 3.838
225 T 0.632 4.762 +- 3.838
226 I 0.632 4.762 +- 3.838
227 V 0.632 4.762 +- 3.838
228 N 0.632 4.762 +- 3.838
229 I 0.632 4.762 +- 3.838
230 G 0.632 4.762 +- 3.838
231 H 0.632 4.762 +- 3.838
232 D 0.632 4.763 +- 3.838
233 V 0.632 4.762 +- 3.838
234 T 0.632 4.762 +- 3.838
235 C 0.632 4.762 +- 3.838
236 S 0.632 4.762 +- 3.838
237 V 0.632 4.762 +- 3.838
238 T 0.632 4.762 +- 3.838
239 V 0.632 4.762 +- 3.838
240 A 0.632 4.762 +- 3.838
241 G 0.632 4.763 +- 3.838
242 V 0.632 4.763 +- 3.838
243 Q 0.632 4.763 +- 3.838
244 I 0.632 4.762 +- 3.838
245 R 0.632 4.762 +- 3.838
246 Q 0.632 4.763 +- 3.838
247 H 0.632 4.762 +- 3.838
248 T 0.632 4.762 +- 3.838
249 G 0.632 4.762 +- 3.838
250 V 0.632 4.762 +- 3.838
251 G 0.632 4.762 +- 3.838
252 L 0.632 4.762 +- 3.838
253 T 0.632 4.762 +- 3.838
254 I 0.632 4.762 +- 3.838
255 C 0.632 4.762 +- 3.838
256 D 0.632 4.763 +- 3.838
257 A 0.632 4.763 +- 3.838
258 P 0.632 4.762 +- 3.838
259 R 0.632 4.762 +- 3.838
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.170 0.155 0.140 0.125 0.110 0.094 0.077 0.060 0.043 0.026
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.033 0.049 0.064 0.079 0.094 0.109 0.123 0.136 0.150 0.163
Time used: 0:23
Model 1: NearlyNeutral -1035.647153 Model 2: PositiveSelection -1035.277566 Model 0: one-ratio -1035.277732 Model 7: beta -1035.647156 Model 8: beta&w>1 -1035.277173 Model 0 vs 1 0.7388419999997495 Model 2 vs 1 0.7391739999998208 Model 8 vs 7 0.7399660000000949
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
