--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 17:41:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0455/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -845.52          -849.49
2       -845.56          -848.38
--------------------------------------
TOTAL     -845.54          -849.08
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.900121    0.089120    0.359665    1.475860    0.869149   1473.58   1487.29    1.000
r(A<->C){all}   0.167782    0.020520    0.000033    0.456448    0.130462    149.23    184.53    1.000
r(A<->G){all}   0.178181    0.021186    0.000036    0.470541    0.141499    230.20    285.00    1.000
r(A<->T){all}   0.175981    0.019392    0.000030    0.455720    0.143948    302.12    330.15    1.000
r(C<->G){all}   0.166109    0.020683    0.000012    0.463239    0.125918    270.92    356.16    1.000
r(C<->T){all}   0.158917    0.018986    0.000027    0.433663    0.122279    145.17    256.39    1.000
r(G<->T){all}   0.153030    0.016560    0.000030    0.412610    0.118047    364.27    380.13    1.003
pi(A){all}      0.225509    0.000264    0.193683    0.256828    0.225400   1286.56   1315.06    1.000
pi(C){all}      0.299195    0.000341    0.263526    0.335646    0.298778   1281.16   1289.03    1.000
pi(G){all}      0.295996    0.000336    0.258719    0.330793    0.296094   1377.90   1396.63    1.000
pi(T){all}      0.179301    0.000232    0.149964    0.207750    0.179081   1343.71   1343.90    1.000
alpha{1,2}      0.418100    0.236144    0.000297    1.404564    0.237022   1287.71   1356.36    1.000
alpha{3}        0.449958    0.243625    0.000176    1.423558    0.285643   1070.14   1269.28    1.000
pinvar{all}     0.997468    0.000010    0.991795    1.000000    0.998452   1367.63   1434.32    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-813.113299
Model 2: PositiveSelection	-813.113299
Model 0: one-ratio	-813.113639
Model 7: beta	-813.113299
Model 8: beta&w>1	-813.113527


Model 0 vs 1	6.800000001021544E-4

Model 2 vs 1	0.0

Model 8 vs 7	4.5599999998557905E-4
>C1
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C2
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C3
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C4
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C5
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C6
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=206 

C1              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C2              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C3              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C4              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C5              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C6              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
                **************************************************

C1              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C2              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C3              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C4              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C5              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C6              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
                **************************************************

C1              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C2              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C3              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C4              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C5              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C6              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
                **************************************************

C1              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C2              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C3              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C4              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C5              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C6              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
                **************************************************

C1              DAERSL
C2              DAERSL
C3              DAERSL
C4              DAERSL
C5              DAERSL
C6              DAERSL
                ******




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6180]--->[6180]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.482 Mb, Max= 30.750 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C2              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C3              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C4              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C5              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C6              VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
                **************************************************

C1              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C2              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C3              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C4              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C5              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C6              STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
                **************************************************

C1              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C2              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C3              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C4              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C5              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C6              ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
                **************************************************

C1              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C2              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C3              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C4              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C5              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C6              LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
                **************************************************

C1              DAERSL
C2              DAERSL
C3              DAERSL
C4              DAERSL
C5              DAERSL
C6              DAERSL
                ******




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C2              GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C3              GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C4              GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C5              GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C6              GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
                **************************************************

C1              CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C2              CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C3              CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C4              CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C5              CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C6              CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
                **************************************************

C1              CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C2              CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C3              CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C4              CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C5              CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C6              CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
                **************************************************

C1              TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C2              TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C3              TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C4              TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C5              TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C6              TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
                **************************************************

C1              CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C2              CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C3              CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C4              CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C5              CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C6              CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
                **************************************************

C1              ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C2              ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C3              ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C4              ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C5              ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C6              ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
                **************************************************

C1              GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C2              GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C3              GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C4              GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C5              GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C6              GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
                **************************************************

C1              TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C2              TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C3              TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C4              TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C5              TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C6              TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
                **************************************************

C1              ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C2              ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C3              ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C4              ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C5              ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C6              ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
                **************************************************

C1              CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C2              CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C3              CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C4              CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C5              CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C6              CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
                **************************************************

C1              CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C2              CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C3              CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C4              CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C5              CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C6              CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
                **************************************************

C1              AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C2              AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C3              AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C4              AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C5              AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C6              AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
                **************************************************

C1              GATGCAGAGCGAAGCTTA
C2              GATGCAGAGCGAAGCTTA
C3              GATGCAGAGCGAAGCTTA
C4              GATGCAGAGCGAAGCTTA
C5              GATGCAGAGCGAAGCTTA
C6              GATGCAGAGCGAAGCTTA
                ******************



>C1
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C2
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C3
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C4
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C5
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C6
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C1
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C2
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C3
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C4
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C5
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C6
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 618 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579801233
      Setting output file names to "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1286797094
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1869557754
      Seed = 1626093861
      Swapseed = 1579801233
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1383.113419 -- -24.965149
         Chain 2 -- -1383.113630 -- -24.965149
         Chain 3 -- -1383.113630 -- -24.965149
         Chain 4 -- -1383.113630 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1383.113419 -- -24.965149
         Chain 2 -- -1383.113630 -- -24.965149
         Chain 3 -- -1383.113630 -- -24.965149
         Chain 4 -- -1383.113419 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1383.113] (-1383.114) (-1383.114) (-1383.114) * [-1383.113] (-1383.114) (-1383.114) (-1383.113) 
        500 -- (-860.899) (-856.736) (-865.061) [-861.992] * [-853.548] (-872.665) (-856.860) (-855.187) -- 0:00:00
       1000 -- [-852.002] (-859.722) (-856.461) (-865.527) * (-855.562) [-855.819] (-858.470) (-861.148) -- 0:00:00
       1500 -- (-853.377) [-857.195] (-857.686) (-857.004) * [-852.089] (-858.782) (-859.930) (-855.801) -- 0:00:00
       2000 -- (-864.287) (-858.741) (-857.660) [-854.646] * (-852.874) (-856.490) [-855.574] (-862.711) -- 0:00:00
       2500 -- (-853.329) [-853.072] (-857.485) (-855.804) * [-851.178] (-861.735) (-849.826) (-858.201) -- 0:00:00
       3000 -- (-849.720) (-853.635) [-853.783] (-849.240) * (-855.955) [-853.608] (-861.517) (-857.663) -- 0:00:00
       3500 -- [-855.354] (-858.924) (-864.938) (-865.541) * (-853.384) [-852.457] (-860.126) (-851.512) -- 0:00:00
       4000 -- (-857.737) (-851.827) [-855.658] (-854.221) * [-852.000] (-855.296) (-852.758) (-857.103) -- 0:00:00
       4500 -- (-857.102) [-856.109] (-852.767) (-856.357) * (-855.750) (-855.088) (-856.940) [-852.840] -- 0:00:00
       5000 -- (-857.715) [-848.639] (-862.607) (-856.376) * (-860.678) [-854.550] (-856.436) (-849.549) -- 0:03:19

      Average standard deviation of split frequencies: 0.082309

       5500 -- (-850.550) [-861.996] (-860.338) (-855.868) * (-855.261) (-848.631) (-854.225) [-851.323] -- 0:03:00
       6000 -- (-861.168) (-848.376) [-852.650] (-852.726) * (-862.770) (-851.429) (-849.989) [-853.334] -- 0:02:45
       6500 -- (-851.635) [-849.738] (-859.633) (-857.616) * (-849.911) (-858.469) (-860.207) [-852.374] -- 0:02:32
       7000 -- (-859.486) (-857.481) [-850.903] (-850.352) * [-850.692] (-854.208) (-857.528) (-855.298) -- 0:02:21
       7500 -- [-854.076] (-853.705) (-856.658) (-860.455) * (-862.967) (-859.707) [-850.866] (-860.883) -- 0:02:12
       8000 -- (-852.360) (-850.347) [-862.797] (-854.216) * (-852.733) (-851.806) [-855.139] (-850.497) -- 0:02:04
       8500 -- [-851.731] (-852.922) (-859.185) (-860.319) * (-852.018) [-857.826] (-858.997) (-860.192) -- 0:01:56
       9000 -- (-862.204) [-851.730] (-868.495) (-857.306) * (-858.403) (-861.345) (-852.587) [-850.208] -- 0:01:50
       9500 -- (-859.186) (-854.629) [-853.367] (-871.171) * (-855.245) (-860.856) (-853.757) [-852.616] -- 0:01:44
      10000 -- (-844.276) (-859.577) (-845.361) [-848.617] * (-857.048) [-859.495] (-857.126) (-869.491) -- 0:01:39

      Average standard deviation of split frequencies: 0.072106

      10500 -- (-846.299) (-857.424) (-846.252) [-846.307] * [-859.335] (-855.775) (-857.519) (-857.087) -- 0:01:34
      11000 -- [-846.620] (-853.307) (-848.740) (-846.767) * (-849.384) [-852.944] (-859.123) (-853.410) -- 0:01:29
      11500 -- (-845.118) (-858.451) [-845.968] (-846.150) * (-862.746) [-858.193] (-858.271) (-857.776) -- 0:01:25
      12000 -- (-845.374) [-855.440] (-846.669) (-846.269) * (-855.960) (-859.143) (-854.651) [-852.848] -- 0:01:22
      12500 -- [-845.034] (-857.913) (-847.477) (-847.837) * (-856.828) [-854.629] (-854.284) (-857.929) -- 0:01:19
      13000 -- [-845.973] (-852.679) (-847.340) (-844.280) * (-861.785) (-844.834) [-858.580] (-850.821) -- 0:01:15
      13500 -- (-844.451) (-851.202) (-844.814) [-844.446] * (-853.765) (-845.645) [-852.555] (-853.549) -- 0:01:13
      14000 -- (-846.750) (-856.904) [-844.506] (-845.386) * (-854.711) (-844.992) [-857.995] (-858.644) -- 0:01:10
      14500 -- (-849.166) [-862.490] (-846.797) (-845.043) * [-851.768] (-846.703) (-854.296) (-857.580) -- 0:01:07
      15000 -- [-847.710] (-857.094) (-845.814) (-844.874) * (-856.661) (-845.571) (-862.004) [-853.679] -- 0:01:05

      Average standard deviation of split frequencies: 0.053401

      15500 -- (-846.153) (-851.177) (-850.460) [-847.982] * (-850.845) [-845.726] (-864.081) (-858.038) -- 0:01:03
      16000 -- (-845.942) (-853.548) [-847.684] (-846.513) * (-858.609) [-845.542] (-851.954) (-856.591) -- 0:01:01
      16500 -- (-849.402) (-862.666) (-849.126) [-847.469] * (-854.114) [-846.124] (-853.165) (-853.378) -- 0:00:59
      17000 -- (-848.373) (-853.051) (-848.064) [-844.228] * [-852.468] (-848.844) (-854.355) (-854.707) -- 0:00:57
      17500 -- (-846.134) (-854.816) (-847.907) [-844.004] * (-858.629) [-846.277] (-850.934) (-856.803) -- 0:00:56
      18000 -- (-847.921) (-862.711) (-845.304) [-847.849] * [-856.968] (-846.258) (-859.121) (-856.379) -- 0:00:54
      18500 -- (-847.960) (-862.766) [-844.548] (-847.352) * (-855.835) (-847.566) [-852.674] (-861.080) -- 0:00:53
      19000 -- (-845.926) [-853.935] (-844.165) (-845.562) * (-861.315) (-846.984) [-857.253] (-856.359) -- 0:00:51
      19500 -- (-844.984) (-855.337) [-845.913] (-846.132) * [-848.582] (-848.338) (-858.785) (-850.427) -- 0:00:50
      20000 -- (-845.055) (-853.991) [-845.675] (-845.742) * (-853.266) [-847.626] (-853.113) (-864.335) -- 0:00:49

      Average standard deviation of split frequencies: 0.045620

      20500 -- (-845.646) (-857.688) [-849.129] (-844.957) * (-852.669) [-847.901] (-859.882) (-853.414) -- 0:00:47
      21000 -- [-847.278] (-865.590) (-847.640) (-845.200) * (-854.825) (-848.090) [-859.455] (-852.338) -- 0:00:46
      21500 -- (-847.350) (-860.757) [-844.473] (-844.625) * (-860.983) [-844.617] (-850.778) (-857.060) -- 0:01:31
      22000 -- (-847.031) (-852.574) (-846.394) [-846.728] * (-861.230) (-845.542) [-853.436] (-862.747) -- 0:01:28
      22500 -- [-845.723] (-857.622) (-845.911) (-844.074) * (-858.101) (-853.440) (-855.947) [-857.896] -- 0:01:26
      23000 -- (-845.544) [-855.208] (-848.162) (-844.074) * (-858.089) (-858.711) [-853.580] (-856.507) -- 0:01:24
      23500 -- (-846.225) (-872.484) (-845.903) [-844.432] * (-865.825) [-847.270] (-852.342) (-859.472) -- 0:01:23
      24000 -- (-846.070) [-857.158] (-846.717) (-844.959) * (-854.971) (-847.569) [-849.787] (-860.992) -- 0:01:21
      24500 -- (-846.920) (-853.489) [-845.764] (-844.959) * (-854.771) (-844.686) (-858.397) [-854.380] -- 0:01:19
      25000 -- (-847.230) (-847.331) (-845.767) [-844.493] * (-854.227) (-845.503) [-852.255] (-849.694) -- 0:01:18

      Average standard deviation of split frequencies: 0.043679

      25500 -- (-848.255) (-847.304) (-849.764) [-846.970] * (-852.870) [-845.605] (-854.527) (-850.580) -- 0:01:16
      26000 -- (-848.994) (-846.590) (-846.788) [-848.374] * (-856.001) (-847.244) (-860.754) [-851.987] -- 0:01:14
      26500 -- (-851.616) (-847.809) [-846.790] (-850.973) * (-853.994) (-849.206) (-855.469) [-862.113] -- 0:01:13
      27000 -- (-844.068) (-846.968) [-847.165] (-849.586) * (-851.549) [-845.281] (-865.356) (-858.113) -- 0:01:12
      27500 -- [-846.316] (-846.422) (-849.143) (-851.471) * [-855.615] (-845.782) (-853.242) (-857.130) -- 0:01:10
      28000 -- (-846.873) (-847.763) [-845.971] (-850.283) * (-862.374) (-846.628) (-853.087) [-851.080] -- 0:01:09
      28500 -- [-846.030] (-847.382) (-846.681) (-846.530) * (-858.730) (-845.465) (-865.672) [-855.605] -- 0:01:08
      29000 -- (-847.559) (-845.411) [-847.808] (-848.732) * [-859.062] (-848.601) (-851.577) (-849.617) -- 0:01:06
      29500 -- (-847.684) [-845.648] (-848.701) (-847.647) * [-862.628] (-845.688) (-855.691) (-856.977) -- 0:01:05
      30000 -- (-846.038) (-845.894) (-848.874) [-846.649] * [-845.006] (-846.614) (-857.491) (-855.372) -- 0:01:04

      Average standard deviation of split frequencies: 0.044498

      30500 -- (-844.952) (-851.151) [-845.317] (-847.721) * (-846.239) [-846.641] (-858.607) (-854.335) -- 0:01:03
      31000 -- [-845.217] (-848.817) (-845.164) (-848.093) * (-848.295) [-845.449] (-863.206) (-858.668) -- 0:01:02
      31500 -- (-845.316) (-847.464) [-844.795] (-846.925) * [-845.641] (-851.385) (-860.310) (-853.419) -- 0:01:01
      32000 -- (-846.128) (-845.964) (-847.174) [-846.402] * (-846.047) (-849.434) [-851.030] (-857.338) -- 0:01:00
      32500 -- (-845.002) (-845.965) [-848.096] (-846.975) * (-849.230) (-852.504) (-854.668) [-852.915] -- 0:00:59
      33000 -- (-845.498) (-846.808) [-845.305] (-848.140) * [-845.219] (-846.937) (-854.996) (-855.714) -- 0:00:58
      33500 -- (-846.784) [-845.787] (-845.502) (-848.824) * (-846.115) [-845.108] (-851.018) (-855.825) -- 0:00:57
      34000 -- (-849.337) (-847.687) (-844.891) [-848.497] * (-845.194) [-847.563] (-854.814) (-851.912) -- 0:00:56
      34500 -- (-844.185) [-845.834] (-844.789) (-846.039) * (-845.896) (-849.963) [-856.406] (-863.449) -- 0:00:55
      35000 -- [-845.377] (-845.241) (-845.103) (-845.542) * (-848.400) [-846.697] (-856.153) (-851.431) -- 0:00:55

      Average standard deviation of split frequencies: 0.033770

      35500 -- (-847.171) [-845.244] (-845.053) (-845.825) * (-844.589) (-848.206) [-855.091] (-854.043) -- 0:00:54
      36000 -- (-846.323) (-845.612) [-846.921] (-846.974) * (-846.188) (-845.321) (-862.732) [-856.156] -- 0:00:53
      36500 -- [-847.833] (-844.690) (-846.924) (-847.378) * [-846.481] (-845.890) (-855.664) (-854.118) -- 0:00:52
      37000 -- (-845.329) (-844.727) (-845.652) [-844.535] * [-844.196] (-845.764) (-859.175) (-854.062) -- 0:00:52
      37500 -- (-845.329) (-845.748) (-845.680) [-845.307] * (-844.574) (-844.750) [-854.805] (-851.805) -- 0:00:51
      38000 -- [-845.638] (-844.761) (-845.820) (-851.611) * (-844.234) [-844.429] (-855.562) (-854.613) -- 0:01:15
      38500 -- (-844.465) [-847.616] (-844.931) (-844.195) * (-844.840) (-845.137) [-851.607] (-852.526) -- 0:01:14
      39000 -- (-845.474) (-848.475) [-845.155] (-846.854) * [-847.846] (-848.009) (-855.969) (-851.584) -- 0:01:13
      39500 -- (-844.755) (-846.184) (-849.211) [-846.079] * (-846.930) (-855.169) [-855.180] (-852.880) -- 0:01:12
      40000 -- (-844.885) (-845.458) (-846.803) [-847.942] * (-846.136) (-846.548) (-856.194) [-855.618] -- 0:01:12

      Average standard deviation of split frequencies: 0.031115

      40500 -- (-845.536) (-846.873) (-847.313) [-847.411] * [-845.324] (-844.123) (-862.344) (-859.075) -- 0:01:11
      41000 -- (-845.852) (-847.652) [-848.730] (-847.540) * [-845.219] (-844.663) (-851.683) (-858.793) -- 0:01:10
      41500 -- [-847.852] (-850.421) (-845.908) (-849.124) * [-844.973] (-845.098) (-853.203) (-853.308) -- 0:01:09
      42000 -- (-846.578) (-849.830) (-844.913) [-844.963] * (-844.469) (-845.385) (-850.585) [-854.927] -- 0:01:08
      42500 -- (-844.020) (-849.070) (-847.174) [-844.702] * (-845.758) (-844.661) (-859.744) [-851.100] -- 0:01:07
      43000 -- (-844.848) (-848.147) [-846.211] (-846.907) * [-845.948] (-845.415) (-860.804) (-856.355) -- 0:01:06
      43500 -- [-845.633] (-845.367) (-848.264) (-847.828) * (-845.234) (-845.574) [-853.325] (-865.893) -- 0:01:05
      44000 -- (-845.154) (-846.184) [-850.016] (-847.466) * (-845.211) (-845.934) (-862.814) [-852.685] -- 0:01:05
      44500 -- (-845.916) [-846.999] (-848.254) (-848.789) * (-851.738) [-845.462] (-862.732) (-859.278) -- 0:01:04
      45000 -- [-845.325] (-845.666) (-845.679) (-848.439) * (-850.105) (-850.642) [-848.082] (-855.415) -- 0:01:03

      Average standard deviation of split frequencies: 0.036893

      45500 -- [-845.113] (-846.383) (-849.043) (-847.023) * (-848.211) (-849.874) (-845.402) [-852.918] -- 0:01:02
      46000 -- (-845.113) [-845.199] (-847.378) (-847.172) * (-847.788) (-847.317) [-845.521] (-857.141) -- 0:01:02
      46500 -- [-845.775] (-846.053) (-849.837) (-847.496) * (-851.713) [-847.208] (-847.397) (-854.641) -- 0:01:01
      47000 -- [-847.442] (-847.284) (-844.545) (-845.511) * (-845.800) (-845.655) [-846.565] (-860.044) -- 0:01:00
      47500 -- (-847.836) (-844.800) [-844.832] (-845.841) * (-846.234) (-850.304) [-845.073] (-858.479) -- 0:01:00
      48000 -- (-849.207) [-845.250] (-846.378) (-847.013) * (-845.198) (-846.120) (-846.134) [-853.083] -- 0:00:59
      48500 -- (-851.678) [-845.371] (-845.847) (-848.057) * (-846.354) (-849.113) [-845.790] (-859.527) -- 0:00:58
      49000 -- (-848.896) [-846.292] (-844.313) (-844.652) * [-850.336] (-847.242) (-846.505) (-862.061) -- 0:00:58
      49500 -- (-848.890) (-847.960) [-844.559] (-846.497) * [-848.272] (-847.368) (-846.523) (-857.524) -- 0:00:57
      50000 -- (-847.834) (-851.807) (-844.405) [-845.482] * (-847.624) (-849.886) (-848.582) [-859.445] -- 0:00:57

      Average standard deviation of split frequencies: 0.034425

      50500 -- (-846.249) (-847.418) [-845.185] (-845.869) * (-847.863) (-847.974) [-846.890] (-852.640) -- 0:00:56
      51000 -- (-848.103) [-846.556] (-846.760) (-848.140) * (-845.148) [-845.199] (-849.403) (-852.083) -- 0:00:55
      51500 -- (-845.849) (-845.696) [-847.693] (-848.527) * (-845.196) [-848.870] (-845.291) (-855.051) -- 0:00:55
      52000 -- [-844.667] (-844.502) (-848.786) (-849.137) * (-845.048) [-848.603] (-847.638) (-855.384) -- 0:00:54
      52500 -- [-844.576] (-844.772) (-846.509) (-851.267) * (-844.564) (-849.077) (-847.724) [-852.773] -- 0:00:54
      53000 -- (-844.747) (-848.792) [-844.786] (-848.423) * (-844.757) (-849.154) (-847.303) [-854.257] -- 0:00:53
      53500 -- (-848.618) (-848.509) (-854.732) [-847.630] * [-845.834] (-849.193) (-847.515) (-853.423) -- 0:00:53
      54000 -- (-846.697) (-846.353) [-845.484] (-846.730) * (-845.194) (-849.639) [-845.422] (-856.888) -- 0:01:10
      54500 -- (-847.392) (-847.286) (-844.962) [-850.603] * (-844.888) (-849.676) [-844.268] (-854.973) -- 0:01:09
      55000 -- (-846.896) (-848.127) (-844.875) [-847.744] * (-844.952) (-847.992) [-845.926] (-854.220) -- 0:01:08

      Average standard deviation of split frequencies: 0.023991

      55500 -- (-846.890) (-849.549) (-845.642) [-844.883] * (-847.352) (-849.063) [-845.363] (-864.110) -- 0:01:08
      56000 -- (-846.391) (-849.506) [-846.238] (-845.746) * [-847.070] (-844.975) (-846.349) (-865.412) -- 0:01:07
      56500 -- (-845.630) [-847.368] (-845.231) (-848.224) * (-844.772) (-844.373) [-847.931] (-855.160) -- 0:01:06
      57000 -- (-845.422) (-847.271) (-847.762) [-846.230] * (-846.842) [-847.011] (-846.008) (-854.900) -- 0:01:06
      57500 -- [-845.073] (-845.478) (-852.403) (-846.800) * [-845.431] (-844.952) (-849.046) (-855.632) -- 0:01:05
      58000 -- (-857.019) [-846.882] (-850.592) (-844.783) * (-847.008) [-848.130] (-845.049) (-853.724) -- 0:01:04
      58500 -- (-845.279) (-845.011) [-846.517] (-845.273) * [-848.450] (-845.309) (-844.624) (-853.278) -- 0:01:04
      59000 -- (-845.323) [-845.868] (-846.294) (-845.251) * [-848.461] (-847.017) (-844.979) (-855.490) -- 0:01:03
      59500 -- (-850.405) (-844.811) (-847.227) [-845.259] * (-846.161) [-844.602] (-847.949) (-857.137) -- 0:01:03
      60000 -- [-845.610] (-844.902) (-850.193) (-846.686) * (-846.077) (-847.618) [-846.498] (-852.002) -- 0:01:02

      Average standard deviation of split frequencies: 0.022534

      60500 -- [-845.263] (-845.446) (-846.877) (-846.995) * (-845.484) [-845.420] (-844.877) (-856.497) -- 0:01:02
      61000 -- (-845.683) (-845.300) [-847.636] (-847.223) * [-845.684] (-848.299) (-844.928) (-855.031) -- 0:01:01
      61500 -- [-844.436] (-848.497) (-847.724) (-846.946) * (-844.673) (-844.253) [-846.346] (-850.813) -- 0:01:01
      62000 -- [-845.787] (-847.056) (-848.639) (-850.538) * [-844.928] (-849.929) (-846.539) (-859.430) -- 0:01:00
      62500 -- (-845.563) [-844.897] (-847.135) (-848.816) * (-844.488) [-852.309] (-846.587) (-852.205) -- 0:01:00
      63000 -- (-847.243) [-844.089] (-847.501) (-850.322) * [-844.974] (-849.435) (-846.460) (-852.989) -- 0:00:59
      63500 -- (-847.413) (-844.588) (-847.196) [-846.762] * [-845.028] (-850.960) (-846.411) (-859.904) -- 0:00:58
      64000 -- (-854.278) (-845.441) (-847.079) [-848.757] * (-845.016) (-846.867) (-845.987) [-854.962] -- 0:00:58
      64500 -- (-846.422) [-843.902] (-846.018) (-846.431) * [-845.542] (-847.602) (-845.127) (-856.552) -- 0:00:58
      65000 -- [-848.487] (-845.296) (-846.677) (-847.043) * (-846.221) (-845.816) [-847.429] (-851.303) -- 0:00:57

      Average standard deviation of split frequencies: 0.023128

      65500 -- (-845.924) (-844.635) (-848.946) [-850.190] * [-847.323] (-848.460) (-845.373) (-858.942) -- 0:00:57
      66000 -- (-848.113) (-844.639) [-848.040] (-845.565) * (-847.465) [-849.375] (-849.061) (-856.755) -- 0:00:56
      66500 -- (-846.979) [-845.733] (-847.944) (-848.684) * (-846.878) (-845.038) [-845.254] (-856.627) -- 0:00:56
      67000 -- (-846.139) (-845.522) (-846.565) [-848.386] * (-847.005) (-846.599) [-847.620] (-852.564) -- 0:00:55
      67500 -- (-851.682) (-844.387) (-845.701) [-846.956] * (-845.081) (-847.280) (-846.656) [-850.265] -- 0:00:55
      68000 -- (-846.030) [-846.692] (-846.553) (-846.190) * (-845.640) [-845.371] (-849.024) (-866.400) -- 0:00:54
      68500 -- (-847.341) (-848.156) [-845.781] (-849.377) * (-844.610) (-845.686) [-847.558] (-852.512) -- 0:00:54
      69000 -- (-847.252) (-849.531) [-845.086] (-846.691) * (-845.657) [-844.805] (-846.636) (-855.532) -- 0:00:53
      69500 -- (-845.717) (-847.531) (-845.416) [-845.477] * (-844.773) (-849.058) [-844.947] (-860.534) -- 0:00:53
      70000 -- (-844.655) (-845.009) [-846.872] (-846.087) * (-847.376) (-847.400) [-845.636] (-855.131) -- 0:01:06

      Average standard deviation of split frequencies: 0.022347

      70500 -- [-845.371] (-847.107) (-846.270) (-845.447) * (-845.284) (-847.041) [-846.180] (-867.817) -- 0:01:05
      71000 -- (-846.102) (-845.436) (-845.642) [-844.793] * [-845.308] (-846.925) (-847.083) (-856.803) -- 0:01:05
      71500 -- (-844.709) (-847.602) (-848.740) [-844.791] * [-845.548] (-845.570) (-845.966) (-858.389) -- 0:01:04
      72000 -- (-845.269) (-846.674) (-845.641) [-848.172] * (-845.375) (-845.751) [-846.960] (-848.732) -- 0:01:04
      72500 -- (-844.955) (-847.433) [-844.434] (-847.860) * (-847.471) [-846.784] (-846.875) (-847.729) -- 0:01:03
      73000 -- [-846.176] (-848.570) (-846.672) (-848.160) * (-846.027) [-845.926] (-845.185) (-847.750) -- 0:01:03
      73500 -- (-847.763) [-845.887] (-849.126) (-848.931) * (-844.241) (-848.366) (-848.476) [-845.553] -- 0:01:03
      74000 -- [-847.148] (-846.124) (-850.289) (-846.502) * [-844.203] (-845.772) (-844.775) (-847.510) -- 0:01:02
      74500 -- (-847.514) (-846.606) [-845.552] (-847.290) * (-846.296) (-844.881) [-844.547] (-846.362) -- 0:01:02
      75000 -- (-847.256) (-845.330) (-845.945) [-844.512] * [-844.296] (-845.958) (-845.629) (-850.918) -- 0:01:01

      Average standard deviation of split frequencies: 0.024220

      75500 -- [-847.376] (-850.787) (-845.373) (-846.142) * (-844.421) (-847.062) (-844.767) [-844.312] -- 0:01:01
      76000 -- (-848.213) (-844.968) [-844.208] (-844.301) * (-847.460) [-848.188] (-845.461) (-844.877) -- 0:01:00
      76500 -- (-848.864) (-845.791) (-846.803) [-844.344] * [-844.380] (-846.764) (-845.241) (-848.818) -- 0:01:00
      77000 -- (-844.795) (-848.599) (-846.589) [-844.512] * [-845.292] (-844.680) (-846.625) (-846.053) -- 0:00:59
      77500 -- (-846.306) [-845.444] (-846.154) (-844.135) * (-846.098) (-846.719) [-846.282] (-848.233) -- 0:00:59
      78000 -- (-845.824) [-847.044] (-847.334) (-844.909) * (-846.076) [-845.166] (-845.344) (-847.611) -- 0:00:59
      78500 -- [-844.764] (-845.771) (-846.560) (-854.129) * (-845.298) (-845.006) (-850.097) [-846.741] -- 0:00:58
      79000 -- (-845.005) (-845.287) (-845.663) [-849.220] * (-848.150) (-844.939) [-845.239] (-846.001) -- 0:00:58
      79500 -- (-845.795) (-845.466) [-847.385] (-845.209) * [-847.240] (-848.080) (-845.922) (-846.719) -- 0:00:57
      80000 -- [-846.675] (-847.333) (-849.091) (-846.248) * (-848.665) [-848.387] (-848.847) (-844.311) -- 0:00:57

      Average standard deviation of split frequencies: 0.021530

      80500 -- (-846.952) (-844.596) [-848.984] (-847.963) * [-848.323] (-845.672) (-844.782) (-845.151) -- 0:00:57
      81000 -- (-845.801) [-845.603] (-848.605) (-846.503) * (-851.691) (-844.693) (-845.056) [-844.103] -- 0:00:56
      81500 -- (-845.897) (-846.524) (-846.768) [-848.617] * (-852.827) [-845.807] (-845.684) (-844.341) -- 0:00:56
      82000 -- (-847.065) (-845.080) (-849.534) [-847.657] * [-846.997] (-846.618) (-844.728) (-846.788) -- 0:00:55
      82500 -- (-847.515) [-844.298] (-846.683) (-847.088) * [-845.863] (-844.843) (-844.827) (-845.673) -- 0:00:55
      83000 -- (-846.807) (-844.490) (-845.776) [-847.601] * (-848.734) [-847.476] (-845.388) (-847.048) -- 0:00:55
      83500 -- [-846.679] (-844.443) (-844.918) (-849.307) * [-853.155] (-845.292) (-847.173) (-849.029) -- 0:00:54
      84000 -- (-847.884) (-846.758) (-845.823) [-849.058] * [-846.335] (-846.090) (-846.030) (-846.645) -- 0:00:54
      84500 -- [-847.821] (-844.557) (-844.748) (-855.767) * (-844.433) (-846.184) (-846.541) [-847.000] -- 0:00:54
      85000 -- [-848.537] (-845.775) (-845.921) (-850.241) * (-844.248) [-847.060] (-849.377) (-846.468) -- 0:00:53

      Average standard deviation of split frequencies: 0.021104

      85500 -- (-845.538) [-846.359] (-845.373) (-846.522) * (-845.232) (-849.602) [-850.703] (-845.892) -- 0:00:53
      86000 -- [-846.636] (-847.186) (-847.239) (-846.028) * (-845.640) (-844.511) (-845.407) [-847.415] -- 0:00:53
      86500 -- (-845.602) [-847.732] (-846.219) (-850.066) * [-846.212] (-845.035) (-848.452) (-844.505) -- 0:01:03
      87000 -- [-848.932] (-844.893) (-845.652) (-849.453) * (-848.951) [-845.333] (-848.896) (-844.254) -- 0:01:02
      87500 -- (-845.845) [-846.123] (-848.791) (-852.348) * (-846.346) [-844.373] (-848.184) (-849.989) -- 0:01:02
      88000 -- (-847.405) [-847.822] (-847.326) (-845.882) * (-850.033) [-847.204] (-847.094) (-849.896) -- 0:01:02
      88500 -- [-847.292] (-849.126) (-848.316) (-847.686) * (-846.934) (-848.218) [-845.885] (-851.142) -- 0:01:01
      89000 -- [-845.035] (-844.998) (-848.644) (-844.753) * (-845.789) (-846.574) [-844.673] (-846.435) -- 0:01:01
      89500 -- (-845.300) [-845.434] (-846.315) (-844.551) * [-845.065] (-850.522) (-846.173) (-845.726) -- 0:01:01
      90000 -- [-846.554] (-846.561) (-848.349) (-848.035) * (-845.115) [-845.670] (-850.075) (-844.799) -- 0:01:00

      Average standard deviation of split frequencies: 0.020250

      90500 -- (-844.160) [-846.624] (-849.405) (-846.853) * (-845.004) [-846.593] (-849.731) (-846.288) -- 0:01:00
      91000 -- (-846.714) [-845.171] (-846.504) (-849.428) * (-843.979) (-846.428) [-845.159] (-847.583) -- 0:00:59
      91500 -- (-846.696) (-845.744) [-846.221] (-846.391) * (-844.407) [-848.733] (-848.635) (-851.250) -- 0:00:59
      92000 -- (-846.573) [-845.042] (-848.451) (-847.846) * (-845.566) (-852.197) (-846.239) [-848.535] -- 0:00:59
      92500 -- (-844.775) [-844.346] (-848.230) (-847.860) * (-847.014) (-847.526) [-846.684] (-849.531) -- 0:00:58
      93000 -- [-846.819] (-844.860) (-850.671) (-845.203) * [-846.338] (-848.144) (-848.605) (-854.394) -- 0:00:58
      93500 -- (-845.184) [-847.639] (-846.828) (-849.427) * [-846.804] (-845.747) (-847.025) (-846.240) -- 0:00:58
      94000 -- (-847.623) (-848.164) (-846.360) [-844.732] * (-844.682) [-848.673] (-845.807) (-846.633) -- 0:00:57
      94500 -- (-848.626) (-850.831) (-850.271) [-845.044] * (-845.242) (-851.690) [-846.015] (-846.553) -- 0:00:57
      95000 -- [-848.193] (-846.328) (-849.174) (-844.881) * (-845.317) (-848.669) (-847.701) [-845.024] -- 0:00:57

      Average standard deviation of split frequencies: 0.021852

      95500 -- (-848.355) (-845.187) (-852.499) [-846.448] * (-846.178) (-845.523) (-844.877) [-844.784] -- 0:00:56
      96000 -- (-846.770) (-847.807) [-845.354] (-847.485) * [-844.568] (-845.520) (-845.227) (-847.084) -- 0:00:56
      96500 -- (-844.383) [-845.086] (-853.798) (-845.966) * (-845.832) (-847.235) [-845.739] (-845.177) -- 0:00:56
      97000 -- (-848.385) (-845.838) (-854.777) [-845.714] * (-846.376) (-847.553) [-844.008] (-843.960) -- 0:00:55
      97500 -- (-844.463) (-849.611) (-849.766) [-847.719] * [-848.143] (-847.088) (-845.419) (-847.552) -- 0:00:55
      98000 -- (-844.769) [-844.606] (-849.862) (-846.056) * (-846.208) [-847.807] (-854.108) (-847.216) -- 0:00:55
      98500 -- (-845.674) (-846.754) (-848.795) [-844.149] * [-849.176] (-849.530) (-853.292) (-849.533) -- 0:00:54
      99000 -- (-845.991) (-846.872) (-848.321) [-844.527] * (-847.642) [-847.899] (-846.491) (-849.142) -- 0:00:54
      99500 -- (-847.858) (-846.173) [-845.530] (-845.353) * (-849.119) (-850.098) (-845.823) [-851.674] -- 0:00:54
      100000 -- (-849.270) [-846.482] (-845.183) (-844.910) * [-848.010] (-845.357) (-846.819) (-846.344) -- 0:00:54

      Average standard deviation of split frequencies: 0.023168

      100500 -- (-845.921) (-846.815) [-844.197] (-845.530) * (-847.275) (-844.932) [-844.497] (-844.880) -- 0:00:53
      101000 -- (-846.100) (-846.436) (-846.104) [-844.475] * (-846.822) (-847.121) [-846.117] (-844.622) -- 0:00:53
      101500 -- (-846.945) [-847.234] (-846.048) (-848.530) * [-846.216] (-847.973) (-845.370) (-848.181) -- 0:00:53
      102000 -- (-847.510) (-847.074) [-848.461] (-845.035) * [-846.046] (-847.434) (-846.036) (-845.321) -- 0:00:52
      102500 -- (-847.992) (-846.287) [-845.906] (-846.010) * (-846.581) (-850.272) [-845.606] (-850.381) -- 0:00:52
      103000 -- [-847.608] (-846.411) (-845.294) (-847.055) * [-845.777] (-847.519) (-846.162) (-849.938) -- 0:01:00
      103500 -- (-850.120) [-845.856] (-848.991) (-847.994) * (-844.547) [-844.756] (-846.155) (-844.858) -- 0:01:00
      104000 -- (-852.507) (-847.170) [-844.345] (-847.009) * (-847.110) (-845.668) (-845.871) [-846.785] -- 0:01:00
      104500 -- (-851.259) (-844.308) [-847.231] (-849.872) * (-846.679) [-847.244] (-845.679) (-846.631) -- 0:00:59
      105000 -- (-847.706) [-844.013] (-847.095) (-849.323) * (-844.269) (-848.058) [-847.776] (-844.060) -- 0:00:59

      Average standard deviation of split frequencies: 0.021569

      105500 -- (-845.749) (-844.280) [-846.944] (-848.440) * [-844.860] (-848.053) (-845.449) (-847.204) -- 0:00:59
      106000 -- (-844.762) (-844.856) [-845.306] (-847.617) * [-844.344] (-849.647) (-851.613) (-854.363) -- 0:00:59
      106500 -- (-845.805) [-849.305] (-852.776) (-845.227) * (-845.718) (-846.839) (-849.796) [-847.631] -- 0:00:58
      107000 -- (-851.229) (-847.051) [-846.115] (-846.316) * (-846.730) (-845.281) [-845.179] (-844.185) -- 0:00:58
      107500 -- (-852.369) (-850.719) (-846.612) [-846.996] * [-846.989] (-845.085) (-847.088) (-850.716) -- 0:00:58
      108000 -- [-848.838] (-848.238) (-846.961) (-847.597) * (-847.565) (-847.821) [-845.709] (-844.957) -- 0:00:57
      108500 -- (-846.513) [-849.106] (-847.905) (-851.846) * [-847.398] (-847.837) (-847.113) (-845.114) -- 0:00:57
      109000 -- (-850.399) (-850.448) [-847.172] (-844.324) * (-845.452) (-846.054) (-851.971) [-847.072] -- 0:00:57
      109500 -- (-846.409) (-849.826) (-846.121) [-844.650] * (-850.612) [-845.277] (-850.351) (-850.368) -- 0:00:56
      110000 -- [-844.251] (-847.235) (-846.167) (-845.887) * [-846.922] (-845.071) (-846.994) (-849.288) -- 0:00:56

      Average standard deviation of split frequencies: 0.022868

      110500 -- (-847.482) (-846.297) (-845.853) [-847.270] * (-846.859) [-845.422] (-846.102) (-846.363) -- 0:00:56
      111000 -- (-844.756) [-846.239] (-848.098) (-847.866) * (-845.143) (-847.921) [-849.235] (-846.222) -- 0:00:56
      111500 -- (-845.746) [-844.298] (-846.012) (-847.875) * [-845.609] (-849.851) (-846.755) (-846.348) -- 0:00:55
      112000 -- (-845.530) (-844.320) (-845.652) [-848.053] * [-844.886] (-846.842) (-846.535) (-847.701) -- 0:00:55
      112500 -- [-845.456] (-845.292) (-845.382) (-845.017) * (-844.503) (-846.518) [-846.321] (-849.866) -- 0:00:55
      113000 -- (-846.749) (-844.910) (-848.323) [-844.581] * (-847.366) [-845.832] (-845.156) (-846.575) -- 0:00:54
      113500 -- (-845.163) (-847.241) (-845.100) [-844.845] * (-847.114) (-846.750) [-846.237] (-844.356) -- 0:00:54
      114000 -- (-845.578) (-844.606) (-845.613) [-847.300] * (-846.058) [-844.616] (-845.959) (-844.506) -- 0:00:54
      114500 -- (-846.882) [-846.497] (-845.257) (-851.908) * [-844.241] (-852.364) (-845.590) (-844.244) -- 0:00:54
      115000 -- (-845.490) (-846.378) (-847.171) [-846.940] * [-844.820] (-848.493) (-844.319) (-847.761) -- 0:00:53

      Average standard deviation of split frequencies: 0.023527

      115500 -- (-847.820) [-846.063] (-845.410) (-845.349) * (-844.510) (-849.974) [-845.563] (-847.763) -- 0:00:53
      116000 -- (-845.652) (-845.213) (-846.876) [-844.908] * (-844.510) (-844.901) [-847.432] (-848.672) -- 0:00:53
      116500 -- (-847.144) (-845.577) [-846.574] (-846.613) * (-844.929) [-848.882] (-847.319) (-850.733) -- 0:00:53
      117000 -- [-844.968] (-846.440) (-846.547) (-846.738) * (-846.560) [-844.907] (-851.607) (-849.518) -- 0:00:52
      117500 -- [-848.494] (-850.155) (-845.387) (-844.669) * (-847.921) (-844.826) [-845.552] (-845.911) -- 0:00:52
      118000 -- (-848.118) (-846.947) [-845.331] (-846.341) * [-847.880] (-844.844) (-844.807) (-845.840) -- 0:00:52
      118500 -- (-845.106) (-845.611) [-846.430] (-855.878) * (-845.099) (-846.992) [-845.463] (-847.393) -- 0:00:52
      119000 -- (-844.836) [-847.699] (-847.982) (-850.166) * (-844.706) (-849.583) (-846.922) [-850.117] -- 0:00:51
      119500 -- (-845.033) (-846.537) (-849.797) [-845.576] * (-845.442) (-848.457) (-845.629) [-849.084] -- 0:00:58
      120000 -- [-846.478] (-846.593) (-845.446) (-846.581) * (-846.482) [-846.158] (-846.203) (-843.983) -- 0:00:58

      Average standard deviation of split frequencies: 0.022001

      120500 -- (-850.223) (-847.178) (-845.632) [-845.989] * (-846.701) (-847.777) [-844.330] (-844.021) -- 0:00:58
      121000 -- (-850.751) (-848.179) (-849.033) [-844.133] * [-846.987] (-849.207) (-844.690) (-845.880) -- 0:00:58
      121500 -- [-850.177] (-846.179) (-846.795) (-845.001) * (-844.688) [-846.143] (-846.818) (-846.088) -- 0:00:57
      122000 -- [-844.916] (-845.187) (-846.607) (-846.293) * [-845.924] (-845.149) (-844.826) (-850.986) -- 0:00:57
      122500 -- (-844.387) [-845.298] (-846.204) (-846.369) * (-848.481) (-844.937) (-845.615) [-847.035] -- 0:00:57
      123000 -- (-847.681) [-844.891] (-845.834) (-847.910) * (-845.981) [-845.580] (-844.602) (-846.196) -- 0:00:57
      123500 -- (-848.107) (-845.120) [-846.724] (-846.638) * [-845.829] (-846.143) (-845.578) (-847.179) -- 0:00:56
      124000 -- (-848.996) [-845.971] (-845.485) (-845.985) * [-847.033] (-849.231) (-846.725) (-845.047) -- 0:00:56
      124500 -- (-847.063) (-847.596) [-845.487] (-845.238) * (-847.634) (-848.413) (-844.740) [-847.512] -- 0:00:56
      125000 -- (-848.062) (-852.428) [-844.849] (-845.746) * (-844.725) (-846.656) [-844.831] (-845.500) -- 0:00:56

      Average standard deviation of split frequencies: 0.021660

      125500 -- (-846.518) [-845.614] (-844.520) (-845.834) * [-846.803] (-847.866) (-846.546) (-845.695) -- 0:00:55
      126000 -- [-846.862] (-845.031) (-845.769) (-852.318) * [-847.954] (-847.101) (-845.481) (-845.756) -- 0:00:55
      126500 -- (-845.742) (-848.492) [-845.769] (-846.326) * (-846.051) (-849.685) [-845.198] (-847.892) -- 0:00:55
      127000 -- [-846.669] (-845.277) (-844.490) (-846.979) * [-844.783] (-844.892) (-846.506) (-845.803) -- 0:00:54
      127500 -- (-845.621) [-845.009] (-844.837) (-845.452) * [-844.884] (-847.466) (-859.022) (-848.925) -- 0:00:54
      128000 -- [-845.736] (-845.964) (-850.163) (-844.752) * [-845.778] (-846.525) (-847.301) (-846.330) -- 0:00:54
      128500 -- [-847.676] (-847.972) (-849.134) (-845.907) * (-845.345) (-848.410) [-845.327] (-849.112) -- 0:00:54
      129000 -- (-845.080) (-846.598) [-852.296] (-846.577) * (-845.475) (-848.655) (-845.312) [-852.013] -- 0:00:54
      129500 -- [-845.804] (-845.718) (-849.548) (-846.330) * [-844.986] (-847.309) (-846.950) (-849.438) -- 0:00:53
      130000 -- [-845.972] (-846.286) (-844.623) (-845.030) * (-845.146) (-845.956) (-845.822) [-845.616] -- 0:00:53

      Average standard deviation of split frequencies: 0.023250

      130500 -- (-844.781) (-848.186) (-846.565) [-844.934] * [-845.253] (-848.336) (-845.784) (-847.745) -- 0:00:53
      131000 -- (-845.337) (-851.357) [-848.224] (-844.911) * (-846.606) [-848.100] (-844.429) (-845.083) -- 0:00:53
      131500 -- (-846.269) (-847.487) (-843.960) [-845.619] * [-846.222] (-849.049) (-846.703) (-844.365) -- 0:00:52
      132000 -- [-847.686] (-849.974) (-845.822) (-844.995) * (-844.338) (-845.302) [-845.156] (-846.054) -- 0:00:52
      132500 -- (-846.862) (-850.950) (-848.932) [-846.450] * (-845.174) (-846.915) (-845.248) [-847.272] -- 0:00:52
      133000 -- (-848.797) (-849.501) (-846.190) [-846.230] * (-845.551) (-846.219) [-844.453] (-844.877) -- 0:00:52
      133500 -- (-849.322) (-847.722) (-845.614) [-844.513] * (-844.756) [-844.947] (-848.624) (-847.869) -- 0:00:51
      134000 -- [-846.241] (-847.002) (-846.772) (-845.314) * (-845.484) (-846.577) [-848.693] (-845.821) -- 0:00:51
      134500 -- [-847.821] (-845.381) (-848.228) (-844.979) * (-845.002) (-845.329) (-847.797) [-845.825] -- 0:00:51
      135000 -- (-850.822) [-847.072] (-845.483) (-844.819) * (-844.970) [-846.892] (-844.540) (-844.801) -- 0:00:51

      Average standard deviation of split frequencies: 0.023351

      135500 -- [-845.114] (-845.536) (-845.882) (-848.862) * (-845.569) (-845.100) [-847.183] (-846.882) -- 0:00:51
      136000 -- (-847.155) [-845.015] (-847.650) (-846.526) * [-847.034] (-846.133) (-850.253) (-846.879) -- 0:00:57
      136500 -- (-847.363) (-847.995) (-844.552) [-847.796] * (-846.293) [-845.053] (-850.018) (-848.055) -- 0:00:56
      137000 -- (-847.254) (-844.635) (-846.259) [-850.737] * (-851.481) (-845.306) (-848.748) [-844.496] -- 0:00:56
      137500 -- (-849.309) [-844.722] (-847.665) (-847.434) * [-846.005] (-845.664) (-845.761) (-845.685) -- 0:00:56
      138000 -- (-845.988) (-847.494) (-847.548) [-847.481] * [-846.156] (-845.048) (-848.193) (-847.007) -- 0:00:56
      138500 -- (-845.988) (-849.428) (-845.698) [-846.881] * (-846.426) [-850.973] (-847.956) (-844.927) -- 0:00:55
      139000 -- (-845.860) [-847.090] (-846.897) (-847.125) * [-845.889] (-848.048) (-848.490) (-847.174) -- 0:00:55
      139500 -- [-847.927] (-846.018) (-845.950) (-846.298) * (-845.465) (-850.292) [-847.159] (-845.044) -- 0:00:55
      140000 -- [-850.764] (-848.473) (-845.560) (-850.331) * (-844.843) (-849.519) (-846.828) [-846.009] -- 0:00:55

      Average standard deviation of split frequencies: 0.023811

      140500 -- (-845.713) (-852.698) (-846.648) [-846.730] * (-846.762) (-852.015) [-846.011] (-844.670) -- 0:00:55
      141000 -- (-847.856) [-844.683] (-846.212) (-847.491) * (-845.956) [-847.303] (-845.502) (-844.424) -- 0:00:54
      141500 -- (-845.206) (-844.677) (-847.190) [-845.004] * (-847.974) (-845.320) (-845.636) [-845.872] -- 0:00:54
      142000 -- (-846.531) [-846.684] (-851.388) (-848.857) * (-848.290) (-845.341) [-844.856] (-847.226) -- 0:00:54
      142500 -- (-845.092) [-844.363] (-845.745) (-846.544) * (-847.511) (-848.240) (-844.845) [-846.735] -- 0:00:54
      143000 -- (-855.268) (-848.182) (-846.322) [-846.458] * (-846.000) (-846.797) [-845.032] (-844.796) -- 0:00:53
      143500 -- (-849.040) (-844.924) [-846.543] (-846.389) * (-845.303) (-844.987) [-845.160] (-846.749) -- 0:00:53
      144000 -- [-851.443] (-844.426) (-849.921) (-846.228) * [-844.711] (-846.664) (-845.115) (-845.607) -- 0:00:53
      144500 -- (-850.416) (-845.124) [-845.163] (-848.751) * (-844.326) (-845.967) (-847.340) [-846.402] -- 0:00:53
      145000 -- (-847.512) [-846.971] (-846.667) (-849.378) * (-845.492) (-846.943) (-845.748) [-846.125] -- 0:00:53

      Average standard deviation of split frequencies: 0.022941

      145500 -- (-845.426) [-849.857] (-847.257) (-847.068) * (-844.955) (-846.091) (-847.349) [-847.535] -- 0:00:52
      146000 -- (-845.552) (-850.283) [-844.753] (-846.277) * [-844.940] (-846.406) (-847.088) (-850.618) -- 0:00:52
      146500 -- (-845.469) [-843.920] (-846.921) (-846.303) * [-846.806] (-846.401) (-846.493) (-853.852) -- 0:00:52
      147000 -- (-846.876) [-844.809] (-844.735) (-849.826) * (-845.159) (-847.840) [-845.870] (-844.329) -- 0:00:52
      147500 -- [-844.206] (-846.960) (-844.433) (-847.242) * (-846.334) (-848.727) (-847.478) [-844.789] -- 0:00:52
      148000 -- [-846.743] (-847.119) (-845.811) (-848.030) * (-846.506) (-849.726) (-844.597) [-844.903] -- 0:00:51
      148500 -- [-845.060] (-844.546) (-847.055) (-845.606) * [-849.354] (-847.847) (-846.737) (-848.166) -- 0:00:51
      149000 -- (-845.514) (-844.520) [-847.874] (-848.145) * [-847.094] (-847.062) (-845.561) (-849.061) -- 0:00:51
      149500 -- [-846.317] (-846.936) (-846.205) (-852.378) * [-844.681] (-846.074) (-849.388) (-846.813) -- 0:00:51
      150000 -- (-845.812) (-845.647) (-845.934) [-848.629] * (-844.867) (-845.468) [-845.744] (-845.652) -- 0:00:51

      Average standard deviation of split frequencies: 0.022396

      150500 -- [-847.395] (-845.172) (-844.856) (-847.734) * (-849.233) (-844.951) [-844.808] (-845.473) -- 0:00:50
      151000 -- (-847.096) (-845.072) [-844.534] (-845.994) * (-849.532) (-844.111) (-847.021) [-847.305] -- 0:00:50
      151500 -- (-847.469) (-845.535) (-844.763) [-845.432] * (-845.245) [-847.344] (-849.661) (-846.460) -- 0:00:50
      152000 -- [-844.796] (-846.134) (-844.686) (-844.948) * (-846.509) [-847.067] (-846.831) (-849.643) -- 0:00:55
      152500 -- (-844.652) (-849.195) [-848.159] (-845.107) * (-847.693) [-844.533] (-845.713) (-846.604) -- 0:00:55
      153000 -- [-844.632] (-846.941) (-848.006) (-844.103) * (-847.350) (-849.323) [-846.747] (-847.398) -- 0:00:55
      153500 -- [-844.664] (-846.430) (-849.144) (-847.274) * (-848.709) (-846.326) [-846.760] (-845.447) -- 0:00:55
      154000 -- [-844.505] (-844.455) (-847.436) (-846.315) * (-845.273) (-847.860) [-845.905] (-847.387) -- 0:00:54
      154500 -- (-845.439) [-844.464] (-847.057) (-848.131) * (-847.345) [-847.051] (-845.591) (-847.414) -- 0:00:54
      155000 -- [-844.329] (-844.288) (-844.197) (-848.012) * (-849.293) (-847.554) [-847.278] (-846.271) -- 0:00:54

      Average standard deviation of split frequencies: 0.024678

      155500 -- (-849.021) [-846.995] (-844.488) (-845.319) * (-848.962) (-847.131) (-844.427) [-846.446] -- 0:00:54
      156000 -- (-847.717) [-845.256] (-848.814) (-845.474) * (-846.720) (-847.486) [-849.332] (-846.882) -- 0:00:54
      156500 -- (-844.831) (-847.990) (-850.454) [-848.276] * (-844.843) (-849.616) [-847.885] (-850.089) -- 0:00:53
      157000 -- (-844.843) (-848.681) (-850.418) [-846.353] * [-849.610] (-846.205) (-847.105) (-846.081) -- 0:00:53
      157500 -- (-846.507) [-846.472] (-845.727) (-846.967) * (-846.185) (-845.170) [-844.545] (-845.852) -- 0:00:53
      158000 -- (-847.712) (-845.544) [-847.159] (-847.708) * (-847.072) (-845.370) [-846.217] (-844.440) -- 0:00:53
      158500 -- (-846.517) (-844.525) (-845.030) [-848.707] * (-845.192) (-847.722) (-848.539) [-847.038] -- 0:00:53
      159000 -- (-844.721) [-846.671] (-846.630) (-846.730) * (-847.654) (-847.933) (-845.031) [-845.866] -- 0:00:52
      159500 -- [-844.943] (-846.045) (-845.269) (-845.439) * (-846.423) (-846.417) [-845.414] (-848.179) -- 0:00:52
      160000 -- [-844.618] (-848.686) (-848.041) (-846.105) * (-844.973) (-846.913) (-845.741) [-845.588] -- 0:00:52

      Average standard deviation of split frequencies: 0.023635

      160500 -- (-847.610) [-847.196] (-845.953) (-845.182) * [-845.702] (-846.187) (-844.766) (-845.892) -- 0:00:52
      161000 -- (-848.671) (-845.759) [-846.339] (-846.968) * (-845.767) [-846.395] (-846.215) (-844.647) -- 0:00:52
      161500 -- (-845.256) [-845.171] (-847.037) (-845.906) * (-845.062) (-846.403) (-846.836) [-844.768] -- 0:00:51
      162000 -- (-847.241) [-845.469] (-845.554) (-846.698) * (-848.577) (-845.920) [-845.444] (-847.604) -- 0:00:51
      162500 -- (-845.783) [-845.999] (-847.301) (-844.672) * (-845.594) (-847.211) (-845.298) [-845.693] -- 0:00:51
      163000 -- (-844.775) [-845.079] (-848.917) (-845.972) * [-844.697] (-846.622) (-845.053) (-845.176) -- 0:00:51
      163500 -- (-847.764) (-847.338) (-847.181) [-845.038] * (-844.264) (-846.158) (-847.362) [-846.499] -- 0:00:51
      164000 -- [-845.756] (-848.155) (-844.510) (-845.701) * (-846.088) (-851.009) (-847.964) [-846.478] -- 0:00:50
      164500 -- (-846.152) (-845.983) (-843.952) [-846.399] * (-847.017) (-846.057) [-847.488] (-846.426) -- 0:00:50
      165000 -- (-848.406) (-845.287) (-845.055) [-845.362] * (-846.196) [-846.723] (-850.424) (-848.300) -- 0:00:50

      Average standard deviation of split frequencies: 0.024769

      165500 -- (-848.098) [-849.159] (-845.585) (-847.325) * (-851.773) (-848.303) (-848.087) [-844.931] -- 0:00:50
      166000 -- (-845.893) [-846.899] (-846.465) (-844.649) * [-845.095] (-844.971) (-847.687) (-846.171) -- 0:00:50
      166500 -- (-844.619) (-851.350) [-847.641] (-849.299) * (-846.293) (-844.256) (-845.520) [-844.180] -- 0:00:50
      167000 -- [-847.613] (-847.805) (-845.418) (-846.493) * [-847.418] (-845.591) (-845.817) (-844.607) -- 0:00:49
      167500 -- (-845.353) (-845.804) (-844.993) [-846.728] * (-846.272) (-844.706) [-844.112] (-845.229) -- 0:00:49
      168000 -- (-844.350) [-845.434] (-844.829) (-850.937) * (-847.272) (-848.953) (-844.543) [-845.575] -- 0:00:49
      168500 -- [-844.350] (-847.583) (-846.958) (-845.532) * (-847.316) [-847.689] (-846.667) (-845.160) -- 0:00:49
      169000 -- [-844.297] (-846.051) (-845.013) (-846.225) * (-845.673) (-849.131) (-848.950) [-845.934] -- 0:00:54
      169500 -- (-847.911) (-849.767) [-844.664] (-845.986) * (-845.317) (-844.634) (-846.154) [-847.184] -- 0:00:53
      170000 -- (-844.357) (-848.325) [-847.569] (-847.051) * (-847.165) [-848.285] (-846.424) (-848.318) -- 0:00:53

      Average standard deviation of split frequencies: 0.022373

      170500 -- [-846.113] (-847.980) (-845.039) (-847.365) * [-846.976] (-852.826) (-845.261) (-851.039) -- 0:00:53
      171000 -- (-844.491) (-845.857) (-851.913) [-846.733] * [-850.923] (-847.652) (-844.833) (-851.895) -- 0:00:53
      171500 -- (-847.359) [-845.828] (-844.867) (-847.894) * (-845.985) [-845.009] (-846.260) (-849.591) -- 0:00:53
      172000 -- (-845.001) (-844.986) [-845.659] (-854.950) * (-846.223) (-846.486) (-851.464) [-846.801] -- 0:00:52
      172500 -- [-846.638] (-847.690) (-846.910) (-853.516) * (-844.684) [-846.791] (-851.089) (-845.711) -- 0:00:52
      173000 -- [-848.115] (-848.390) (-844.546) (-848.504) * [-847.807] (-845.518) (-847.108) (-845.833) -- 0:00:52
      173500 -- [-848.715] (-846.589) (-847.971) (-848.649) * [-847.281] (-846.244) (-848.011) (-846.119) -- 0:00:52
      174000 -- (-845.010) [-848.371] (-848.882) (-845.392) * (-847.428) (-844.882) [-847.782] (-844.450) -- 0:00:52
      174500 -- [-845.400] (-845.917) (-846.164) (-845.293) * (-851.556) (-845.462) (-848.294) [-845.081] -- 0:00:52
      175000 -- [-846.934] (-845.129) (-846.891) (-850.672) * (-846.426) (-845.421) [-845.607] (-846.230) -- 0:00:51

      Average standard deviation of split frequencies: 0.023341

      175500 -- (-844.567) [-844.931] (-848.605) (-850.515) * (-849.968) (-847.225) (-846.820) [-845.518] -- 0:00:51
      176000 -- (-846.789) (-844.617) (-856.277) [-852.573] * [-848.086] (-846.310) (-844.470) (-845.729) -- 0:00:51
      176500 -- [-846.517] (-845.434) (-850.551) (-849.852) * (-847.712) (-844.911) [-845.650] (-844.804) -- 0:00:51
      177000 -- (-847.164) (-845.159) [-849.308] (-845.569) * [-851.215] (-847.697) (-845.329) (-848.737) -- 0:00:51
      177500 -- (-848.891) (-849.686) [-846.556] (-845.653) * (-845.367) [-847.304] (-845.846) (-849.305) -- 0:00:50
      178000 -- (-847.784) (-849.476) (-847.611) [-845.015] * (-845.257) (-845.650) (-847.438) [-846.963] -- 0:00:50
      178500 -- (-846.857) (-846.257) (-846.446) [-846.194] * (-845.899) (-844.439) (-847.357) [-850.074] -- 0:00:50
      179000 -- (-845.956) [-846.018] (-846.016) (-845.453) * (-845.022) (-844.997) (-847.410) [-848.672] -- 0:00:50
      179500 -- (-848.475) (-846.324) [-845.777] (-849.403) * [-845.587] (-846.153) (-845.127) (-845.211) -- 0:00:50
      180000 -- [-844.957] (-849.999) (-844.643) (-844.744) * (-845.533) [-845.894] (-849.740) (-846.927) -- 0:00:50

      Average standard deviation of split frequencies: 0.023359

      180500 -- [-844.947] (-845.173) (-844.822) (-849.323) * (-846.107) (-844.185) [-844.140] (-847.082) -- 0:00:54
      181000 -- (-844.842) (-848.332) (-844.558) [-844.436] * (-847.121) (-844.716) [-845.450] (-850.333) -- 0:00:54
      181500 -- (-846.848) (-848.829) (-849.122) [-846.344] * (-844.749) (-844.227) [-845.341] (-846.679) -- 0:00:54
      182000 -- [-845.236] (-848.489) (-850.268) (-844.411) * (-845.011) [-848.075] (-844.936) (-846.795) -- 0:00:53
      182500 -- (-844.888) [-847.371] (-846.633) (-844.505) * (-845.658) [-845.468] (-846.499) (-846.257) -- 0:00:53
      183000 -- [-846.806] (-847.934) (-848.037) (-846.466) * (-848.507) [-846.279] (-845.899) (-844.385) -- 0:00:53
      183500 -- (-847.370) [-845.853] (-849.389) (-845.827) * [-850.114] (-845.979) (-846.871) (-844.491) -- 0:00:53
      184000 -- (-845.628) (-848.063) (-844.713) [-844.757] * (-849.139) (-845.174) (-846.849) [-848.777] -- 0:00:53
      184500 -- (-845.196) (-846.720) (-845.887) [-849.608] * (-848.777) [-844.410] (-847.314) (-849.269) -- 0:00:57
      185000 -- [-844.497] (-849.352) (-844.397) (-848.700) * (-845.160) [-847.806] (-846.009) (-845.270) -- 0:00:57

      Average standard deviation of split frequencies: 0.022206

      185500 -- (-846.155) (-846.012) [-844.660] (-845.790) * (-845.345) (-850.283) [-845.562] (-847.455) -- 0:00:57
      186000 -- (-845.867) [-844.463] (-845.613) (-847.728) * (-846.654) [-847.394] (-844.100) (-854.871) -- 0:00:56
      186500 -- (-845.382) [-845.572] (-846.868) (-847.036) * (-847.455) (-847.790) [-843.957] (-848.131) -- 0:00:56
      187000 -- (-847.962) [-845.083] (-844.071) (-845.306) * (-847.855) (-848.913) (-844.645) [-847.134] -- 0:00:56
      187500 -- (-848.303) (-849.575) (-847.366) [-844.249] * (-851.346) (-847.211) [-844.326] (-846.603) -- 0:00:56
      188000 -- (-844.994) [-845.527] (-853.839) (-844.766) * [-847.055] (-844.621) (-846.944) (-846.657) -- 0:00:56
      188500 -- (-848.035) [-846.993] (-848.057) (-844.251) * [-846.875] (-844.601) (-847.211) (-846.671) -- 0:00:55
      189000 -- [-847.133] (-846.063) (-848.866) (-846.351) * (-850.009) (-847.495) (-845.349) [-847.516] -- 0:00:55
      189500 -- (-845.235) (-848.847) [-844.715] (-844.613) * (-847.410) (-844.710) [-846.555] (-847.699) -- 0:00:55
      190000 -- [-845.124] (-845.800) (-845.810) (-845.445) * (-850.005) (-846.650) (-852.054) [-847.036] -- 0:00:55

      Average standard deviation of split frequencies: 0.024724

      190500 -- (-847.147) (-845.303) (-847.205) [-844.628] * (-845.380) [-845.021] (-849.892) (-846.132) -- 0:00:55
      191000 -- (-849.184) (-845.701) (-845.424) [-847.466] * (-845.201) [-844.564] (-848.366) (-847.783) -- 0:00:55
      191500 -- [-846.520] (-847.087) (-848.380) (-847.617) * (-845.363) [-845.938] (-847.370) (-845.381) -- 0:00:54
      192000 -- (-845.365) [-846.199] (-848.011) (-845.602) * (-844.747) [-844.529] (-845.353) (-846.488) -- 0:00:54
      192500 -- (-846.805) (-846.288) (-845.817) [-844.431] * [-844.779] (-844.455) (-846.439) (-850.905) -- 0:00:54
      193000 -- [-845.444] (-844.527) (-844.785) (-854.711) * (-847.703) [-844.568] (-844.929) (-845.916) -- 0:00:54
      193500 -- (-847.512) [-845.044] (-848.152) (-848.165) * (-846.021) (-846.924) (-845.740) [-845.496] -- 0:00:54
      194000 -- (-845.856) [-844.739] (-847.136) (-846.704) * (-844.768) (-850.360) (-845.018) [-847.191] -- 0:00:54
      194500 -- (-847.844) [-844.911] (-846.909) (-845.788) * (-844.563) (-845.277) (-844.269) [-845.245] -- 0:00:53
      195000 -- (-844.566) (-846.951) [-845.001] (-845.794) * (-844.768) (-848.533) [-845.008] (-846.974) -- 0:00:53

      Average standard deviation of split frequencies: 0.024509

      195500 -- (-845.337) [-847.951] (-846.835) (-845.251) * (-844.967) (-848.920) [-845.982] (-845.889) -- 0:00:57
      196000 -- (-844.797) (-846.186) (-845.330) [-847.180] * [-845.903] (-847.961) (-848.229) (-846.104) -- 0:00:57
      196500 -- [-847.799] (-845.275) (-845.276) (-848.368) * (-848.065) (-846.337) (-847.702) [-845.567] -- 0:00:57
      197000 -- (-845.732) (-844.725) [-847.269] (-846.167) * [-845.791] (-845.549) (-846.080) (-845.339) -- 0:00:57
      197500 -- (-847.578) (-845.395) (-844.939) [-846.045] * (-844.752) [-847.589] (-846.971) (-847.074) -- 0:00:56
      198000 -- (-847.401) (-846.268) [-843.991] (-847.868) * (-844.248) (-848.432) (-846.243) [-844.362] -- 0:00:56
      198500 -- [-847.409] (-847.000) (-844.676) (-845.834) * [-846.125] (-849.339) (-846.540) (-846.866) -- 0:00:56
      199000 -- [-847.597] (-845.936) (-845.698) (-848.009) * (-845.324) (-847.491) (-844.935) [-846.753] -- 0:00:56
      199500 -- (-848.435) (-847.528) (-847.704) [-847.641] * (-849.769) (-845.487) (-845.933) [-845.309] -- 0:00:56
      200000 -- (-849.947) [-851.139] (-847.268) (-844.821) * (-848.776) [-848.414] (-846.088) (-844.389) -- 0:00:55

      Average standard deviation of split frequencies: 0.024901

      200500 -- (-850.315) (-844.564) [-847.698] (-846.750) * (-847.954) (-847.988) (-845.089) [-848.371] -- 0:00:55
      201000 -- (-848.066) (-846.174) [-845.841] (-845.136) * (-846.520) (-845.030) (-847.901) [-844.293] -- 0:00:55
      201500 -- (-850.248) [-846.052] (-845.929) (-848.209) * [-845.694] (-848.126) (-844.750) (-844.335) -- 0:00:55
      202000 -- [-846.230] (-845.125) (-848.174) (-850.166) * (-845.821) [-845.853] (-846.590) (-845.912) -- 0:00:55
      202500 -- (-848.438) (-855.060) (-848.173) [-846.580] * (-845.692) [-846.613] (-849.562) (-846.077) -- 0:00:55
      203000 -- [-850.211] (-848.737) (-845.039) (-845.867) * (-844.389) [-844.934] (-848.342) (-845.561) -- 0:00:54
      203500 -- [-845.964] (-844.448) (-846.835) (-846.507) * [-844.641] (-844.536) (-845.417) (-845.800) -- 0:00:54
      204000 -- (-851.178) (-845.207) [-845.364] (-846.133) * (-845.474) [-845.866] (-848.761) (-847.180) -- 0:00:54
      204500 -- (-848.231) [-844.504] (-846.525) (-847.161) * (-849.263) (-848.745) [-846.100] (-844.621) -- 0:00:54
      205000 -- (-845.857) [-845.730] (-844.584) (-847.586) * (-851.980) (-844.983) (-845.041) [-846.609] -- 0:00:54

      Average standard deviation of split frequencies: 0.022540

      205500 -- (-846.756) (-846.316) [-845.451] (-848.632) * (-845.707) (-844.994) (-844.833) [-845.734] -- 0:00:54
      206000 -- (-845.125) (-846.463) [-844.899] (-850.849) * (-845.375) (-847.247) (-845.778) [-846.560] -- 0:00:53
      206500 -- (-846.075) [-847.661] (-845.804) (-848.805) * (-845.393) (-847.092) (-846.310) [-846.176] -- 0:00:53
      207000 -- (-845.813) (-847.140) [-848.064] (-851.898) * [-845.474] (-845.967) (-847.577) (-845.035) -- 0:00:53
      207500 -- [-846.787] (-846.289) (-849.595) (-851.307) * (-845.351) (-848.604) (-851.580) [-849.060] -- 0:00:53
      208000 -- (-844.822) (-844.856) (-849.947) [-846.334] * (-846.346) (-849.021) [-846.396] (-847.849) -- 0:00:53
      208500 -- (-844.681) (-846.583) (-845.961) [-845.445] * [-846.019] (-847.748) (-849.257) (-848.899) -- 0:00:53
      209000 -- [-845.882] (-844.776) (-845.252) (-845.441) * (-845.503) [-846.648] (-845.712) (-844.453) -- 0:00:52
      209500 -- (-845.935) [-847.678] (-848.743) (-845.322) * [-846.721] (-847.914) (-845.895) (-846.686) -- 0:00:52
      210000 -- (-848.129) (-845.766) (-845.911) [-846.313] * [-845.242] (-849.105) (-845.235) (-845.292) -- 0:00:52

      Average standard deviation of split frequencies: 0.023496

      210500 -- (-847.165) [-845.144] (-848.850) (-844.796) * (-845.737) (-849.704) [-846.260] (-844.074) -- 0:00:52
      211000 -- (-845.699) (-844.814) [-845.361] (-844.089) * [-844.912] (-848.496) (-848.018) (-846.837) -- 0:00:52
      211500 -- (-849.485) [-844.718] (-845.167) (-848.144) * [-844.914] (-846.718) (-845.075) (-846.369) -- 0:00:52
      212000 -- (-845.209) [-845.064] (-846.002) (-846.714) * (-844.842) (-848.675) [-845.224] (-845.869) -- 0:00:55
      212500 -- (-844.549) [-847.210] (-846.634) (-848.173) * (-844.727) (-851.774) [-845.364] (-845.384) -- 0:00:55
      213000 -- (-843.971) [-850.041] (-846.116) (-850.818) * (-846.193) [-844.512] (-845.299) (-847.955) -- 0:00:55
      213500 -- (-848.858) (-851.134) [-848.918] (-849.730) * (-846.810) (-846.230) (-845.103) [-848.333] -- 0:00:55
      214000 -- [-847.832] (-846.793) (-845.704) (-845.481) * [-845.857] (-844.803) (-851.616) (-847.304) -- 0:00:55
      214500 -- [-845.028] (-845.401) (-847.530) (-844.662) * [-845.570] (-846.171) (-845.561) (-846.410) -- 0:00:54
      215000 -- [-844.677] (-846.589) (-852.155) (-845.747) * (-846.715) (-848.206) [-848.586] (-844.752) -- 0:00:54

      Average standard deviation of split frequencies: 0.023352

      215500 -- (-847.412) [-845.671] (-845.748) (-847.940) * (-850.515) (-845.000) [-846.572] (-848.263) -- 0:00:54
      216000 -- [-845.973] (-850.699) (-845.897) (-845.619) * (-845.815) (-845.278) [-846.251] (-846.713) -- 0:00:54
      216500 -- (-846.954) (-847.170) (-845.992) [-848.761] * [-844.635] (-846.513) (-848.050) (-846.651) -- 0:00:54
      217000 -- [-845.825] (-849.369) (-849.155) (-848.754) * (-847.424) (-848.570) [-845.014] (-845.185) -- 0:00:54
      217500 -- [-844.490] (-847.919) (-848.259) (-850.828) * [-850.492] (-848.077) (-845.267) (-849.644) -- 0:00:53
      218000 -- (-846.130) (-845.946) (-847.637) [-845.368] * (-852.151) (-845.075) (-846.907) [-845.066] -- 0:00:53
      218500 -- [-845.586] (-850.250) (-845.426) (-846.081) * [-846.210] (-847.955) (-845.690) (-845.394) -- 0:00:53
      219000 -- (-844.884) (-845.932) [-844.054] (-847.488) * [-846.305] (-846.115) (-845.772) (-846.624) -- 0:00:53
      219500 -- (-845.590) (-845.331) [-846.356] (-846.453) * (-849.725) (-847.497) [-846.432] (-847.815) -- 0:00:53
      220000 -- [-845.554] (-849.771) (-848.261) (-847.840) * [-844.890] (-845.138) (-849.250) (-849.253) -- 0:00:53

      Average standard deviation of split frequencies: 0.022431

      220500 -- (-846.693) (-845.662) (-845.760) [-845.224] * (-847.412) (-845.955) (-848.618) [-846.016] -- 0:00:53
      221000 -- [-845.420] (-845.969) (-844.732) (-845.437) * [-845.823] (-846.422) (-849.371) (-846.992) -- 0:00:52
      221500 -- [-848.144] (-845.477) (-845.102) (-844.679) * [-844.762] (-845.535) (-848.848) (-846.594) -- 0:00:52
      222000 -- (-845.198) (-844.646) (-845.745) [-843.986] * (-846.173) (-845.535) [-845.711] (-845.883) -- 0:00:52
      222500 -- (-847.410) [-845.523] (-849.912) (-845.142) * (-846.494) [-845.585] (-847.948) (-844.929) -- 0:00:52
      223000 -- (-847.568) (-844.773) (-848.703) [-845.195] * (-846.039) [-844.772] (-846.645) (-845.457) -- 0:00:52
      223500 -- (-849.214) (-846.607) (-846.690) [-845.839] * (-849.735) (-845.229) [-844.641] (-845.359) -- 0:00:52
      224000 -- [-845.187] (-846.850) (-847.363) (-848.186) * (-845.795) (-847.179) (-847.754) [-844.335] -- 0:00:51
      224500 -- (-846.027) (-850.443) [-844.013] (-847.083) * (-846.128) (-847.353) (-845.939) [-845.358] -- 0:00:51
      225000 -- (-846.214) (-847.793) (-844.469) [-844.391] * (-845.308) [-845.610] (-850.650) (-845.153) -- 0:00:51

      Average standard deviation of split frequencies: 0.020963

      225500 -- [-846.649] (-846.814) (-844.982) (-846.250) * (-844.605) (-845.768) (-847.131) [-844.153] -- 0:00:51
      226000 -- (-847.504) (-847.445) (-847.850) [-845.231] * (-848.555) [-844.218] (-846.039) (-845.008) -- 0:00:51
      226500 -- (-846.124) (-848.602) (-849.679) [-845.653] * (-845.327) (-845.295) [-844.449] (-846.805) -- 0:00:51
      227000 -- (-846.607) (-844.761) (-849.683) [-850.161] * (-846.256) (-845.119) (-846.908) [-845.606] -- 0:00:51
      227500 -- (-846.373) (-846.740) [-847.789] (-848.112) * (-844.618) (-849.188) [-846.892] (-846.140) -- 0:00:54
      228000 -- [-848.116] (-846.255) (-849.506) (-846.533) * (-844.671) (-849.496) (-847.910) [-845.415] -- 0:00:54
      228500 -- (-844.977) [-846.832] (-844.950) (-845.178) * (-845.986) (-845.829) (-847.147) [-845.287] -- 0:00:54
      229000 -- (-846.952) (-848.155) (-846.715) [-845.540] * (-845.974) (-845.675) [-844.471] (-846.271) -- 0:00:53
      229500 -- (-847.329) (-845.026) (-846.081) [-848.545] * (-845.161) [-848.467] (-844.410) (-847.617) -- 0:00:53
      230000 -- (-845.874) (-846.362) (-849.714) [-845.196] * (-845.210) [-845.354] (-844.659) (-848.011) -- 0:00:53

      Average standard deviation of split frequencies: 0.019313

      230500 -- [-848.146] (-846.443) (-846.650) (-849.468) * (-849.368) (-844.431) (-845.606) [-844.596] -- 0:00:53
      231000 -- (-845.710) [-845.045] (-850.869) (-847.027) * [-845.551] (-845.296) (-847.424) (-845.545) -- 0:00:53
      231500 -- (-846.248) (-845.845) (-845.277) [-846.514] * [-846.088] (-844.994) (-844.682) (-847.542) -- 0:00:53
      232000 -- (-845.461) [-846.371] (-845.028) (-845.562) * (-848.509) (-846.701) (-844.488) [-845.666] -- 0:00:52
      232500 -- (-847.937) (-846.526) (-847.749) [-846.841] * (-846.370) (-847.410) [-844.527] (-846.054) -- 0:00:52
      233000 -- [-847.757] (-850.525) (-844.770) (-848.664) * (-847.477) [-847.633] (-844.835) (-846.216) -- 0:00:52
      233500 -- (-849.101) (-847.281) [-845.087] (-846.272) * (-847.070) (-848.313) (-845.034) [-848.205] -- 0:00:52
      234000 -- [-846.808] (-845.908) (-847.489) (-847.456) * (-847.883) [-848.254] (-848.330) (-848.118) -- 0:00:52
      234500 -- (-845.127) [-844.809] (-846.854) (-846.094) * [-845.907] (-848.963) (-849.277) (-845.639) -- 0:00:52
      235000 -- [-846.030] (-845.102) (-844.774) (-845.964) * [-845.576] (-849.841) (-848.606) (-844.641) -- 0:00:52

      Average standard deviation of split frequencies: 0.018713

      235500 -- (-847.985) [-846.664] (-847.970) (-847.335) * [-846.186] (-847.291) (-845.788) (-844.457) -- 0:00:51
      236000 -- (-850.860) (-844.677) (-848.455) [-845.613] * (-845.391) (-845.200) (-846.686) [-849.776] -- 0:00:51
      236500 -- (-847.961) (-844.852) [-846.096] (-844.472) * [-846.027] (-846.317) (-844.939) (-845.609) -- 0:00:51
      237000 -- (-845.866) [-846.361] (-845.407) (-845.006) * (-844.341) (-845.927) (-847.416) [-849.047] -- 0:00:51
      237500 -- (-846.405) [-845.583] (-845.678) (-844.148) * (-845.380) (-844.411) [-846.724] (-848.369) -- 0:00:51
      238000 -- (-845.997) (-844.232) (-849.954) [-844.148] * (-845.961) (-848.381) [-847.432] (-845.700) -- 0:00:51
      238500 -- (-847.646) (-846.835) (-852.522) [-844.148] * (-847.357) [-846.206] (-848.080) (-850.383) -- 0:00:51
      239000 -- [-847.131] (-845.630) (-851.084) (-846.927) * [-846.449] (-846.847) (-846.532) (-849.243) -- 0:00:50
      239500 -- (-846.989) (-850.904) [-846.452] (-846.690) * (-844.559) (-844.744) [-846.532] (-848.299) -- 0:00:50
      240000 -- (-849.161) (-847.354) [-845.207] (-846.706) * (-845.109) (-845.077) (-844.849) [-848.053] -- 0:00:50

      Average standard deviation of split frequencies: 0.019072

      240500 -- (-846.290) (-848.976) (-845.097) [-845.152] * (-845.342) (-847.175) [-844.247] (-844.840) -- 0:00:50
      241000 -- [-845.529] (-845.344) (-846.520) (-848.710) * (-848.023) (-844.624) [-845.021] (-846.897) -- 0:00:50
      241500 -- [-845.749] (-845.955) (-845.143) (-849.899) * (-846.543) [-845.492] (-844.958) (-847.460) -- 0:00:50
      242000 -- (-846.216) (-850.547) (-845.885) [-846.004] * (-845.551) [-846.010] (-846.023) (-847.206) -- 0:00:50
      242500 -- (-847.142) (-857.100) (-846.321) [-846.337] * (-845.864) (-845.219) (-846.841) [-845.223] -- 0:00:49
      243000 -- (-846.811) (-846.453) (-846.735) [-845.930] * (-844.726) [-844.169] (-846.843) (-845.063) -- 0:00:49
      243500 -- [-844.782] (-844.097) (-845.278) (-845.835) * (-846.534) [-848.177] (-846.552) (-847.374) -- 0:00:49
      244000 -- [-845.455] (-849.777) (-846.956) (-847.718) * (-848.285) (-845.134) [-844.463] (-848.414) -- 0:00:52
      244500 -- (-846.458) (-846.691) [-846.087] (-847.294) * (-850.476) (-844.527) [-845.505] (-847.158) -- 0:00:52
      245000 -- (-847.435) [-845.760] (-847.784) (-844.617) * (-846.065) [-844.671] (-845.564) (-848.539) -- 0:00:52

      Average standard deviation of split frequencies: 0.019264

      245500 -- [-844.906] (-846.714) (-847.646) (-845.500) * (-844.789) (-846.521) (-846.831) [-846.771] -- 0:00:52
      246000 -- [-847.337] (-848.104) (-845.960) (-846.724) * (-844.885) (-851.473) (-844.008) [-848.911] -- 0:00:52
      246500 -- (-845.233) (-846.570) [-845.325] (-845.877) * (-848.686) (-848.300) (-844.008) [-844.731] -- 0:00:51
      247000 -- (-846.654) (-846.105) (-845.998) [-847.751] * (-848.853) [-846.606] (-844.968) (-846.285) -- 0:00:51
      247500 -- (-847.263) (-846.925) (-847.533) [-848.025] * (-848.224) (-845.131) [-844.064] (-844.992) -- 0:00:51
      248000 -- [-845.627] (-846.632) (-849.099) (-846.766) * (-846.314) (-844.580) [-844.919] (-844.614) -- 0:00:51
      248500 -- [-844.691] (-845.958) (-856.527) (-848.759) * (-846.040) (-846.388) [-844.091] (-845.256) -- 0:00:51
      249000 -- (-848.749) (-846.509) (-848.529) [-844.285] * (-848.261) (-845.376) (-847.750) [-849.046] -- 0:00:51
      249500 -- (-848.184) (-848.396) (-848.055) [-848.735] * (-846.695) (-844.793) [-846.352] (-846.701) -- 0:00:51
      250000 -- (-851.273) [-844.799] (-846.356) (-847.045) * (-845.359) (-845.763) [-845.941] (-844.112) -- 0:00:51

      Average standard deviation of split frequencies: 0.018509

      250500 -- (-845.326) [-844.763] (-845.412) (-849.074) * (-848.965) (-845.822) [-846.875] (-846.873) -- 0:00:50
      251000 -- (-845.008) [-845.122] (-848.290) (-849.011) * [-846.240] (-847.132) (-847.538) (-846.696) -- 0:00:50
      251500 -- (-848.523) (-849.540) [-844.246] (-850.200) * (-850.639) (-845.785) [-846.344] (-845.425) -- 0:00:50
      252000 -- (-846.879) [-847.131] (-845.765) (-850.357) * [-846.444] (-844.906) (-845.276) (-849.901) -- 0:00:50
      252500 -- (-847.477) (-847.409) (-845.614) [-846.387] * (-844.363) (-844.946) [-846.417] (-847.116) -- 0:00:50
      253000 -- (-845.814) [-845.413] (-845.068) (-846.837) * [-844.290] (-844.810) (-845.656) (-844.428) -- 0:00:50
      253500 -- (-846.797) [-845.283] (-845.567) (-849.911) * [-846.891] (-846.508) (-846.174) (-844.508) -- 0:00:50
      254000 -- (-847.920) (-845.209) [-848.290] (-845.457) * [-847.817] (-844.568) (-845.028) (-844.797) -- 0:00:49
      254500 -- (-855.590) (-846.031) [-845.787] (-848.024) * (-844.419) (-845.422) [-847.697] (-848.998) -- 0:00:49
      255000 -- (-845.398) (-846.257) (-846.846) [-848.707] * [-845.447] (-848.306) (-845.543) (-845.578) -- 0:00:49

      Average standard deviation of split frequencies: 0.018220

      255500 -- (-845.559) (-845.267) [-847.049] (-846.286) * (-846.509) [-847.385] (-848.975) (-848.560) -- 0:00:49
      256000 -- (-846.644) (-844.523) (-845.922) [-845.788] * (-845.980) (-855.337) (-850.268) [-847.158] -- 0:00:49
      256500 -- (-848.679) (-850.092) [-847.332] (-845.069) * (-844.401) [-846.233] (-848.107) (-845.281) -- 0:00:49
      257000 -- (-845.400) (-844.847) [-846.655] (-847.397) * [-847.062] (-845.111) (-846.015) (-848.172) -- 0:00:49
      257500 -- [-846.050] (-846.123) (-849.000) (-845.885) * (-845.959) [-846.530] (-845.457) (-847.185) -- 0:00:49
      258000 -- (-847.219) (-845.716) (-847.521) [-845.410] * (-844.488) [-846.048] (-848.670) (-845.283) -- 0:00:48
      258500 -- (-846.486) (-846.793) (-846.300) [-845.008] * [-845.148] (-844.508) (-845.535) (-846.622) -- 0:00:48
      259000 -- (-850.236) (-844.426) [-847.392] (-851.494) * (-846.785) [-845.967] (-846.300) (-851.097) -- 0:00:48
      259500 -- (-845.053) [-849.041] (-846.356) (-856.399) * (-846.097) (-846.390) (-851.031) [-845.157] -- 0:00:48
      260000 -- (-844.500) [-844.988] (-845.768) (-845.135) * (-851.449) (-846.381) (-849.017) [-843.870] -- 0:00:48

      Average standard deviation of split frequencies: 0.017418

      260500 -- (-845.523) [-844.044] (-846.367) (-847.553) * [-848.626] (-846.735) (-844.518) (-845.008) -- 0:00:51
      261000 -- (-853.573) (-847.349) [-847.326] (-845.704) * (-846.947) (-844.682) [-844.141] (-847.422) -- 0:00:50
      261500 -- (-848.648) (-844.494) (-850.268) [-845.642] * (-846.235) [-846.182] (-844.876) (-845.401) -- 0:00:50
      262000 -- (-849.689) (-844.295) (-853.004) [-844.676] * (-847.741) (-850.722) [-844.759] (-847.124) -- 0:00:50
      262500 -- [-850.366] (-844.454) (-848.148) (-847.068) * [-850.176] (-844.890) (-844.728) (-848.345) -- 0:00:50
      263000 -- (-846.479) (-846.306) [-844.871] (-851.083) * [-846.745] (-844.291) (-844.723) (-845.486) -- 0:00:50
      263500 -- (-845.751) (-845.111) [-846.029] (-848.038) * (-851.085) (-844.487) [-844.950] (-846.072) -- 0:00:50
      264000 -- (-845.290) [-845.413] (-848.689) (-848.164) * (-848.511) [-845.189] (-843.950) (-846.010) -- 0:00:50
      264500 -- (-844.807) [-846.979] (-847.659) (-848.018) * (-849.482) [-845.129] (-844.051) (-845.969) -- 0:00:50
      265000 -- (-844.757) [-844.519] (-846.509) (-846.196) * (-845.802) [-849.519] (-845.537) (-846.889) -- 0:00:49

      Average standard deviation of split frequencies: 0.015857

      265500 -- [-845.964] (-848.449) (-845.499) (-847.676) * (-847.770) (-848.552) [-845.633] (-850.823) -- 0:00:49
      266000 -- [-845.034] (-848.094) (-844.748) (-848.028) * (-845.913) (-846.417) [-844.813] (-848.343) -- 0:00:49
      266500 -- [-846.204] (-848.538) (-845.666) (-846.427) * (-844.986) (-849.455) [-844.785] (-856.405) -- 0:00:49
      267000 -- (-847.635) (-848.742) (-844.656) [-847.054] * (-847.048) (-847.161) [-845.318] (-847.078) -- 0:00:49
      267500 -- (-844.733) (-845.029) (-845.998) [-844.571] * (-846.355) (-847.720) [-845.874] (-847.706) -- 0:00:49
      268000 -- (-848.081) (-847.550) (-847.708) [-845.520] * [-846.769] (-845.653) (-847.061) (-850.838) -- 0:00:49
      268500 -- (-850.290) [-845.737] (-844.742) (-845.532) * (-848.567) (-845.651) [-845.178] (-848.779) -- 0:00:49
      269000 -- (-846.575) (-845.429) [-844.985] (-845.254) * (-847.813) [-849.012] (-846.342) (-850.521) -- 0:00:48
      269500 -- [-846.121] (-847.767) (-847.068) (-846.233) * (-846.286) [-847.067] (-845.515) (-846.436) -- 0:00:48
      270000 -- (-849.552) [-847.106] (-851.658) (-845.259) * (-845.687) (-846.431) [-849.374] (-851.387) -- 0:00:48

      Average standard deviation of split frequencies: 0.016933

      270500 -- (-845.143) [-846.959] (-845.859) (-845.744) * [-850.528] (-846.250) (-846.934) (-845.889) -- 0:00:48
      271000 -- [-845.077] (-848.018) (-844.284) (-846.034) * (-846.915) (-846.412) (-848.338) [-845.506] -- 0:00:48
      271500 -- (-845.434) (-846.225) [-846.201] (-845.338) * (-847.258) (-846.601) [-845.834] (-847.853) -- 0:00:48
      272000 -- (-845.108) (-845.986) [-844.392] (-850.628) * (-846.221) (-850.951) [-847.471] (-845.522) -- 0:00:48
      272500 -- (-845.670) (-846.090) [-845.946] (-844.261) * (-851.529) [-852.718] (-846.794) (-844.879) -- 0:00:48
      273000 -- (-845.628) [-845.685] (-845.861) (-846.114) * (-848.201) [-846.121] (-846.257) (-845.536) -- 0:00:47
      273500 -- (-847.500) (-845.543) (-844.719) [-846.065] * (-844.362) [-848.256] (-845.505) (-845.621) -- 0:00:47
      274000 -- (-845.696) (-846.356) [-845.935] (-847.190) * (-846.685) (-845.975) [-845.963] (-844.912) -- 0:00:47
      274500 -- (-846.368) (-848.185) [-845.519] (-845.937) * (-845.224) (-844.687) (-845.850) [-844.919] -- 0:00:47
      275000 -- [-845.693] (-847.625) (-845.978) (-845.278) * (-845.742) (-845.452) [-845.505] (-847.332) -- 0:00:47

      Average standard deviation of split frequencies: 0.015846

      275500 -- [-845.300] (-846.167) (-848.355) (-846.765) * [-845.386] (-848.815) (-845.026) (-846.252) -- 0:00:47
      276000 -- (-846.758) (-849.271) (-846.610) [-846.471] * (-846.651) (-844.813) [-845.026] (-846.445) -- 0:00:47
      276500 -- (-845.662) [-846.987] (-848.526) (-846.597) * (-848.566) [-844.394] (-846.494) (-846.656) -- 0:00:47
      277000 -- [-849.195] (-848.525) (-848.152) (-851.303) * (-850.898) [-845.985] (-847.872) (-849.083) -- 0:00:46
      277500 -- (-845.834) (-849.843) (-845.376) [-848.900] * (-848.417) [-846.590] (-845.269) (-846.853) -- 0:00:49
      278000 -- (-847.454) (-849.899) [-846.955] (-847.182) * (-848.049) (-847.378) (-848.487) [-845.874] -- 0:00:49
      278500 -- (-848.762) (-846.116) [-845.478] (-849.729) * (-850.821) (-850.666) (-845.531) [-844.869] -- 0:00:49
      279000 -- (-845.509) (-845.340) [-847.248] (-846.984) * (-846.087) (-852.489) (-845.752) [-845.937] -- 0:00:49
      279500 -- (-847.128) (-850.640) (-847.653) [-846.439] * (-846.535) (-847.978) (-845.920) [-846.901] -- 0:00:48
      280000 -- (-847.428) (-845.547) (-846.603) [-847.769] * (-853.143) (-846.813) [-844.426] (-847.880) -- 0:00:48

      Average standard deviation of split frequencies: 0.016049

      280500 -- [-846.247] (-845.001) (-847.218) (-846.469) * (-849.463) (-846.330) [-845.360] (-845.941) -- 0:00:48
      281000 -- [-845.948] (-848.815) (-847.861) (-849.213) * (-845.579) (-844.546) [-844.639] (-844.073) -- 0:00:48
      281500 -- (-846.993) (-845.270) [-848.330] (-849.823) * [-846.263] (-849.650) (-846.593) (-846.701) -- 0:00:48
      282000 -- (-849.403) (-845.232) [-850.744] (-845.479) * (-844.901) (-847.016) [-850.076] (-845.877) -- 0:00:48
      282500 -- (-845.368) (-848.398) (-845.913) [-845.852] * (-844.892) [-844.907] (-848.004) (-845.729) -- 0:00:48
      283000 -- [-847.097] (-846.508) (-848.733) (-848.823) * [-844.457] (-848.462) (-850.700) (-848.386) -- 0:00:48
      283500 -- [-847.340] (-846.660) (-847.509) (-844.947) * (-847.594) (-848.268) [-847.985] (-855.673) -- 0:00:48
      284000 -- (-847.611) (-848.089) [-850.105] (-846.856) * (-846.061) [-845.595] (-848.063) (-850.369) -- 0:00:47
      284500 -- [-848.928] (-846.338) (-851.582) (-848.170) * (-851.551) [-845.645] (-847.667) (-847.262) -- 0:00:47
      285000 -- [-848.270] (-846.830) (-845.029) (-845.280) * (-846.391) (-845.384) [-847.398] (-846.727) -- 0:00:47

      Average standard deviation of split frequencies: 0.017032

      285500 -- (-846.686) (-846.454) (-853.859) [-850.062] * [-850.082] (-844.774) (-849.933) (-847.663) -- 0:00:47
      286000 -- [-846.265] (-849.035) (-844.728) (-846.026) * (-845.283) [-844.937] (-847.083) (-846.279) -- 0:00:47
      286500 -- (-845.861) (-845.132) (-845.397) [-845.903] * (-847.739) [-846.318] (-847.106) (-845.534) -- 0:00:47
      287000 -- [-846.338] (-846.510) (-845.135) (-846.478) * (-846.222) (-847.214) (-846.229) [-846.209] -- 0:00:47
      287500 -- (-845.109) (-845.156) (-844.830) [-845.159] * (-849.463) (-847.129) (-847.071) [-845.221] -- 0:00:47
      288000 -- [-845.983] (-848.131) (-847.069) (-848.125) * (-845.153) [-847.013] (-845.193) (-845.926) -- 0:00:46
      288500 -- (-844.773) (-848.379) [-850.331] (-847.909) * (-848.827) (-847.907) (-845.228) [-845.728] -- 0:00:46
      289000 -- (-845.418) [-848.701] (-847.283) (-848.761) * (-852.355) [-845.281] (-847.633) (-846.709) -- 0:00:46
      289500 -- (-845.019) (-845.653) (-845.390) [-846.078] * (-846.526) (-844.076) (-846.060) [-845.290] -- 0:00:46
      290000 -- (-844.801) [-844.601] (-845.356) (-844.619) * [-845.818] (-846.808) (-847.860) (-845.274) -- 0:00:46

      Average standard deviation of split frequencies: 0.016986

      290500 -- (-846.657) (-847.234) (-847.770) [-845.849] * (-847.991) (-846.561) [-846.121] (-846.993) -- 0:00:46
      291000 -- (-846.830) [-844.970] (-849.874) (-846.303) * (-845.911) (-845.997) [-844.313] (-844.752) -- 0:00:46
      291500 -- [-845.503] (-847.630) (-846.817) (-846.297) * (-845.392) (-845.697) [-846.396] (-851.249) -- 0:00:46
      292000 -- (-845.378) (-845.588) [-847.118] (-846.472) * [-846.220] (-846.161) (-846.915) (-846.753) -- 0:00:46
      292500 -- [-849.184] (-846.131) (-847.345) (-848.289) * (-845.843) (-846.231) [-847.502] (-846.948) -- 0:00:45
      293000 -- (-847.694) [-844.702] (-848.597) (-848.329) * (-849.664) [-846.689] (-844.673) (-844.708) -- 0:00:45
      293500 -- (-847.168) (-845.299) [-847.235] (-846.986) * (-844.494) (-849.856) [-845.272] (-844.961) -- 0:00:45
      294000 -- (-849.800) (-844.627) (-846.605) [-845.094] * (-844.783) (-846.873) [-845.656] (-848.285) -- 0:00:48
      294500 -- (-848.944) (-845.773) (-845.389) [-844.830] * (-844.112) (-850.310) (-845.532) [-844.558] -- 0:00:47
      295000 -- (-846.908) (-845.790) [-845.427] (-847.375) * (-845.208) (-848.826) [-845.964] (-845.990) -- 0:00:47

      Average standard deviation of split frequencies: 0.016345

      295500 -- (-845.314) (-847.815) [-845.401] (-848.004) * (-848.595) (-845.524) [-846.684] (-846.715) -- 0:00:47
      296000 -- (-844.306) (-846.442) [-846.383] (-847.210) * (-848.627) [-846.087] (-844.735) (-846.120) -- 0:00:47
      296500 -- (-844.625) [-847.064] (-846.062) (-845.607) * [-848.557] (-845.470) (-847.381) (-845.491) -- 0:00:47
      297000 -- (-845.070) [-848.059] (-847.189) (-847.159) * (-845.630) (-845.371) [-849.140] (-845.937) -- 0:00:47
      297500 -- (-849.695) (-849.376) [-844.285] (-846.892) * [-846.482] (-844.576) (-847.931) (-847.991) -- 0:00:47
      298000 -- [-845.783] (-846.759) (-844.623) (-847.565) * (-845.769) (-844.514) [-847.362] (-846.976) -- 0:00:47
      298500 -- (-852.552) (-847.718) [-844.412] (-845.956) * (-848.013) [-845.796] (-845.926) (-848.305) -- 0:00:47
      299000 -- (-847.850) [-845.612] (-844.740) (-846.358) * (-846.492) (-845.106) [-845.229] (-847.853) -- 0:00:46
      299500 -- (-849.046) [-844.471] (-847.644) (-845.900) * [-844.874] (-845.820) (-849.608) (-846.200) -- 0:00:46
      300000 -- (-847.786) [-844.541] (-845.884) (-845.690) * (-845.024) [-848.210] (-846.115) (-846.032) -- 0:00:46

      Average standard deviation of split frequencies: 0.016256

      300500 -- (-849.053) (-844.553) [-847.894] (-845.793) * (-845.414) [-844.148] (-847.580) (-846.664) -- 0:00:46
      301000 -- (-845.062) (-844.935) (-845.516) [-845.793] * (-845.538) (-844.018) [-845.611] (-844.886) -- 0:00:46
      301500 -- (-845.284) (-845.011) (-845.209) [-845.283] * [-844.982] (-844.439) (-845.134) (-847.661) -- 0:00:46
      302000 -- (-845.709) [-845.427] (-847.296) (-848.388) * (-845.018) [-845.365] (-844.980) (-847.149) -- 0:00:46
      302500 -- (-847.235) (-847.015) [-845.797] (-847.314) * [-845.488] (-844.477) (-846.362) (-847.035) -- 0:00:46
      303000 -- (-844.644) (-844.022) (-846.077) [-847.612] * [-847.094] (-845.219) (-854.766) (-846.568) -- 0:00:46
      303500 -- [-846.430] (-844.701) (-845.481) (-846.015) * (-846.184) (-845.308) (-850.433) [-847.400] -- 0:00:45
      304000 -- (-847.022) [-844.702] (-847.096) (-848.299) * (-846.288) [-845.641] (-848.103) (-847.437) -- 0:00:45
      304500 -- (-847.113) [-844.999] (-845.215) (-846.397) * (-847.958) (-844.829) (-846.398) [-845.152] -- 0:00:45
      305000 -- (-848.510) [-845.281] (-845.201) (-848.190) * (-844.801) [-846.384] (-843.965) (-852.613) -- 0:00:45

      Average standard deviation of split frequencies: 0.016459

      305500 -- (-845.534) (-847.090) [-845.473] (-851.664) * [-845.108] (-847.896) (-848.470) (-853.056) -- 0:00:45
      306000 -- (-846.809) (-845.269) (-848.173) [-848.059] * (-850.864) (-845.339) [-844.517] (-848.880) -- 0:00:45
      306500 -- (-846.679) [-846.403] (-845.862) (-845.549) * [-846.331] (-845.073) (-846.131) (-850.613) -- 0:00:45
      307000 -- [-846.620] (-846.965) (-850.169) (-851.881) * (-850.514) (-845.799) (-847.042) [-846.308] -- 0:00:45
      307500 -- (-847.495) [-846.666] (-845.432) (-850.505) * (-845.554) (-846.038) [-845.141] (-844.872) -- 0:00:45
      308000 -- [-845.476] (-844.208) (-845.394) (-849.444) * [-845.345] (-844.848) (-845.618) (-845.537) -- 0:00:44
      308500 -- (-848.936) [-846.461] (-847.137) (-848.953) * (-847.011) [-846.127] (-846.000) (-847.003) -- 0:00:44
      309000 -- (-847.274) (-844.776) [-845.246] (-844.519) * (-846.164) (-844.638) (-849.461) [-845.560] -- 0:00:44
      309500 -- (-844.741) [-845.239] (-845.161) (-847.018) * (-844.612) (-846.646) (-845.137) [-848.034] -- 0:00:44
      310000 -- [-844.140] (-846.567) (-845.827) (-846.715) * [-844.378] (-847.205) (-845.200) (-845.597) -- 0:00:44

      Average standard deviation of split frequencies: 0.015893

      310500 -- [-843.913] (-847.666) (-847.702) (-846.931) * (-845.281) (-846.195) (-845.537) [-846.841] -- 0:00:46
      311000 -- (-847.203) (-848.885) [-847.553] (-845.770) * (-845.667) [-844.423] (-844.775) (-848.346) -- 0:00:46
      311500 -- (-845.217) (-846.331) [-848.669] (-846.672) * (-845.518) (-846.824) [-844.367] (-845.686) -- 0:00:46
      312000 -- (-845.101) (-846.099) (-850.227) [-846.193] * (-851.949) (-845.032) [-844.952] (-845.584) -- 0:00:46
      312500 -- [-845.698] (-846.157) (-849.866) (-847.209) * (-848.375) (-845.763) (-846.939) [-847.502] -- 0:00:46
      313000 -- [-846.693] (-849.103) (-848.404) (-847.832) * (-846.092) [-846.428] (-844.713) (-846.484) -- 0:00:46
      313500 -- [-847.232] (-850.264) (-849.504) (-853.185) * [-846.194] (-845.447) (-845.720) (-851.105) -- 0:00:45
      314000 -- [-845.202] (-849.336) (-851.128) (-848.841) * (-845.428) [-844.957] (-848.295) (-844.625) -- 0:00:45
      314500 -- (-844.338) (-850.595) [-848.364] (-851.645) * (-845.649) [-845.501] (-848.313) (-845.000) -- 0:00:45
      315000 -- (-846.053) (-846.392) [-845.073] (-848.215) * (-847.557) (-844.962) [-847.823] (-849.080) -- 0:00:45

      Average standard deviation of split frequencies: 0.015001

      315500 -- (-849.236) (-844.719) (-848.838) [-844.969] * [-844.506] (-845.201) (-849.427) (-846.054) -- 0:00:45
      316000 -- (-844.936) [-845.665] (-846.353) (-846.011) * (-844.764) [-847.166] (-846.255) (-846.992) -- 0:00:45
      316500 -- [-844.477] (-846.061) (-845.687) (-846.040) * (-845.193) [-844.340] (-845.452) (-847.938) -- 0:00:45
      317000 -- (-845.842) [-845.504] (-847.589) (-845.423) * (-845.190) (-846.737) (-844.532) [-849.627] -- 0:00:45
      317500 -- (-847.618) (-844.676) (-845.048) [-845.893] * (-845.086) (-847.890) (-847.716) [-845.885] -- 0:00:45
      318000 -- (-849.275) [-844.903] (-845.104) (-846.557) * (-845.410) [-845.090] (-847.841) (-847.924) -- 0:00:45
      318500 -- (-849.314) [-846.272] (-847.355) (-845.998) * (-845.791) [-848.220] (-847.474) (-846.647) -- 0:00:44
      319000 -- (-845.581) (-847.020) (-844.823) [-844.617] * [-845.250] (-844.077) (-847.395) (-846.642) -- 0:00:44
      319500 -- (-845.157) (-848.602) [-846.281] (-847.123) * (-847.645) [-845.121] (-848.138) (-847.362) -- 0:00:44
      320000 -- (-845.247) (-849.453) (-846.370) [-846.136] * [-844.672] (-845.902) (-848.724) (-846.187) -- 0:00:44

      Average standard deviation of split frequencies: 0.013721

      320500 -- [-848.265] (-845.603) (-854.748) (-848.005) * [-845.334] (-846.475) (-854.408) (-846.790) -- 0:00:44
      321000 -- [-845.887] (-847.637) (-846.404) (-845.072) * (-847.287) (-848.467) [-844.499] (-845.858) -- 0:00:44
      321500 -- [-845.939] (-848.656) (-845.906) (-846.685) * (-847.724) [-846.387] (-844.350) (-847.494) -- 0:00:44
      322000 -- (-848.033) (-848.177) [-849.437] (-850.996) * (-847.254) [-847.643] (-845.608) (-847.958) -- 0:00:44
      322500 -- (-854.542) [-847.684] (-846.592) (-852.327) * (-846.391) (-847.457) (-845.614) [-845.787] -- 0:00:44
      323000 -- (-850.628) (-848.986) [-844.116] (-846.543) * (-845.610) (-846.934) (-846.992) [-845.286] -- 0:00:44
      323500 -- (-847.058) (-850.362) (-845.786) [-845.668] * [-844.545] (-845.171) (-845.976) (-847.399) -- 0:00:43
      324000 -- (-844.340) (-846.056) (-845.235) [-845.715] * [-844.374] (-844.700) (-847.114) (-848.041) -- 0:00:43
      324500 -- (-847.063) (-845.908) (-847.338) [-845.127] * [-844.090] (-844.140) (-845.642) (-846.057) -- 0:00:43
      325000 -- (-844.827) (-844.801) (-845.802) [-845.297] * [-848.068] (-844.453) (-844.780) (-846.217) -- 0:00:43

      Average standard deviation of split frequencies: 0.013547

      325500 -- (-845.254) (-848.955) [-848.110] (-847.508) * (-848.524) (-845.817) (-845.086) [-849.675] -- 0:00:43
      326000 -- (-845.024) (-845.754) [-844.517] (-849.849) * (-845.715) (-846.070) [-845.030] (-846.633) -- 0:00:43
      326500 -- (-844.644) (-846.207) [-845.132] (-850.365) * (-847.728) (-848.324) [-845.798] (-848.697) -- 0:00:43
      327000 -- (-845.100) [-848.097] (-845.603) (-854.494) * (-845.341) (-851.452) (-845.653) [-844.891] -- 0:00:45
      327500 -- [-847.319] (-849.343) (-845.637) (-845.742) * (-845.130) [-849.581] (-844.430) (-847.567) -- 0:00:45
      328000 -- (-848.997) [-846.933] (-844.017) (-845.790) * (-845.104) (-847.492) (-848.474) [-845.297] -- 0:00:45
      328500 -- (-846.799) (-846.824) (-849.082) [-846.413] * [-845.714] (-848.497) (-846.967) (-845.016) -- 0:00:44
      329000 -- (-852.598) (-844.557) (-847.978) [-844.867] * (-844.883) (-850.765) (-847.238) [-846.779] -- 0:00:44
      329500 -- (-849.355) (-844.531) (-844.991) [-846.774] * (-844.544) (-846.427) (-848.210) [-846.012] -- 0:00:44
      330000 -- [-845.313] (-845.182) (-848.275) (-846.260) * [-844.376] (-845.161) (-846.585) (-847.083) -- 0:00:44

      Average standard deviation of split frequencies: 0.013506

      330500 -- (-845.093) (-845.763) (-846.191) [-844.725] * [-847.488] (-845.632) (-845.671) (-849.662) -- 0:00:44
      331000 -- (-851.809) (-845.616) (-846.311) [-844.302] * [-847.449] (-846.918) (-845.360) (-850.220) -- 0:00:44
      331500 -- (-846.816) [-845.202] (-846.708) (-848.545) * (-849.413) [-846.853] (-846.455) (-848.223) -- 0:00:44
      332000 -- (-849.445) (-848.609) (-845.694) [-851.338] * [-850.688] (-847.847) (-847.415) (-847.549) -- 0:00:44
      332500 -- (-848.336) (-849.009) [-844.833] (-849.621) * (-845.654) (-848.093) [-846.001] (-849.696) -- 0:00:44
      333000 -- (-850.173) [-850.903] (-847.470) (-847.004) * (-844.372) [-845.687] (-846.790) (-845.849) -- 0:00:44
      333500 -- [-844.168] (-846.764) (-847.488) (-848.999) * (-844.271) (-847.634) [-844.423] (-846.130) -- 0:00:43
      334000 -- (-846.036) [-848.048] (-846.427) (-847.437) * (-852.194) (-847.501) [-845.860] (-848.675) -- 0:00:43
      334500 -- (-845.992) (-846.208) [-844.490] (-845.603) * (-850.227) (-847.261) (-847.583) [-846.518] -- 0:00:43
      335000 -- (-848.358) [-845.592] (-845.490) (-845.272) * (-849.317) (-846.436) [-844.439] (-844.490) -- 0:00:43

      Average standard deviation of split frequencies: 0.013735

      335500 -- [-848.595] (-852.017) (-845.010) (-846.675) * (-846.331) (-848.658) (-845.999) [-844.808] -- 0:00:43
      336000 -- (-847.597) [-846.363] (-844.565) (-845.928) * (-846.127) (-848.823) [-847.550] (-845.077) -- 0:00:43
      336500 -- (-849.450) (-844.583) (-847.030) [-846.324] * (-845.216) [-845.246] (-849.069) (-845.000) -- 0:00:43
      337000 -- (-850.122) (-845.533) (-848.315) [-846.222] * [-846.136] (-847.325) (-848.333) (-850.081) -- 0:00:43
      337500 -- (-845.310) (-846.168) [-847.116] (-850.202) * (-848.621) (-844.492) [-845.196] (-846.904) -- 0:00:43
      338000 -- (-845.200) (-846.602) [-850.354] (-845.821) * (-845.431) (-847.308) (-847.542) [-846.837] -- 0:00:43
      338500 -- (-847.220) [-845.320] (-845.342) (-847.875) * (-845.712) [-848.255] (-846.950) (-847.086) -- 0:00:42
      339000 -- [-849.576] (-851.177) (-845.306) (-846.396) * (-846.145) (-845.203) (-846.466) [-850.054] -- 0:00:42
      339500 -- (-846.144) [-847.952] (-847.785) (-845.103) * (-846.397) (-848.482) (-845.461) [-844.694] -- 0:00:42
      340000 -- (-846.993) (-846.511) (-844.364) [-844.406] * (-850.772) (-848.472) [-845.362] (-849.731) -- 0:00:42

      Average standard deviation of split frequencies: 0.013069

      340500 -- (-844.562) (-852.377) [-845.040] (-849.521) * (-846.470) (-846.865) [-845.248] (-846.161) -- 0:00:42
      341000 -- (-846.834) (-849.774) [-849.209] (-848.088) * (-848.128) (-847.994) [-845.168] (-846.700) -- 0:00:42
      341500 -- (-846.646) [-844.407] (-847.406) (-845.951) * [-847.663] (-845.360) (-845.992) (-845.758) -- 0:00:42
      342000 -- (-846.068) [-848.160] (-847.133) (-847.099) * (-847.040) (-851.418) (-845.610) [-844.412] -- 0:00:42
      342500 -- (-852.439) (-845.805) [-846.125] (-845.707) * (-845.279) (-851.770) [-847.159] (-845.853) -- 0:00:42
      343000 -- (-846.476) (-847.035) [-845.599] (-846.242) * (-844.290) [-847.816] (-846.707) (-845.456) -- 0:00:42
      343500 -- (-848.879) [-847.172] (-846.802) (-845.922) * (-844.996) (-847.904) (-847.833) [-848.182] -- 0:00:43
      344000 -- (-853.634) [-845.232] (-848.507) (-845.181) * (-849.226) (-849.179) [-848.734] (-849.911) -- 0:00:43
      344500 -- [-846.806] (-845.732) (-847.100) (-845.996) * (-851.902) [-847.554] (-846.783) (-848.587) -- 0:00:43
      345000 -- [-846.841] (-844.949) (-849.321) (-844.554) * [-848.165] (-848.510) (-845.290) (-849.649) -- 0:00:43

      Average standard deviation of split frequencies: 0.012111

      345500 -- (-845.369) (-845.462) (-848.550) [-843.957] * (-845.781) [-850.376] (-846.941) (-844.410) -- 0:00:43
      346000 -- (-846.933) (-845.341) (-848.118) [-844.277] * [-845.310] (-845.372) (-848.091) (-844.401) -- 0:00:43
      346500 -- [-845.357] (-845.885) (-847.068) (-845.441) * (-846.624) [-845.193] (-846.746) (-845.840) -- 0:00:43
      347000 -- (-844.133) (-844.714) [-845.627] (-846.327) * [-844.912] (-845.133) (-846.670) (-847.514) -- 0:00:43
      347500 -- (-845.684) (-846.873) [-845.809] (-846.342) * [-844.672] (-846.127) (-845.605) (-846.063) -- 0:00:43
      348000 -- (-846.677) (-850.572) (-846.085) [-845.229] * (-846.660) [-847.626] (-845.238) (-844.548) -- 0:00:43
      348500 -- (-849.276) (-845.746) [-846.011] (-845.858) * (-845.364) (-847.807) [-844.805] (-847.054) -- 0:00:42
      349000 -- (-847.807) (-846.474) [-845.321] (-845.025) * (-846.399) [-846.602] (-844.633) (-847.866) -- 0:00:42
      349500 -- (-845.138) (-849.040) [-847.666] (-844.841) * (-844.932) (-845.521) [-845.377] (-849.911) -- 0:00:42
      350000 -- (-845.142) (-846.738) (-845.548) [-846.084] * (-849.159) [-845.182] (-845.265) (-847.161) -- 0:00:42

      Average standard deviation of split frequencies: 0.011703

      350500 -- (-847.337) (-845.194) [-847.681] (-844.684) * [-845.453] (-845.701) (-846.953) (-844.561) -- 0:00:42
      351000 -- (-844.836) [-844.792] (-846.942) (-845.770) * (-846.897) [-849.147] (-845.426) (-844.409) -- 0:00:42
      351500 -- (-845.477) (-846.470) [-845.686] (-845.642) * (-845.932) [-849.296] (-845.344) (-848.625) -- 0:00:42
      352000 -- (-846.726) (-847.765) (-845.312) [-848.431] * [-845.181] (-847.537) (-845.627) (-846.664) -- 0:00:42
      352500 -- (-845.544) [-847.793] (-844.819) (-844.548) * (-846.770) (-846.898) (-849.255) [-845.669] -- 0:00:42
      353000 -- (-844.247) (-847.307) (-846.870) [-844.604] * (-845.083) [-845.096] (-846.589) (-844.423) -- 0:00:42
      353500 -- (-846.012) (-846.074) [-844.216] (-847.224) * [-846.857] (-846.177) (-846.668) (-847.608) -- 0:00:42
      354000 -- (-847.561) [-847.159] (-846.547) (-847.195) * (-845.837) [-845.779] (-848.535) (-848.055) -- 0:00:41
      354500 -- [-845.350] (-846.257) (-845.653) (-845.766) * (-845.688) (-846.980) (-847.849) [-846.554] -- 0:00:41
      355000 -- (-845.410) (-844.658) [-844.518] (-846.080) * (-846.090) (-846.380) (-849.574) [-846.253] -- 0:00:41

      Average standard deviation of split frequencies: 0.011991

      355500 -- (-849.374) (-846.440) (-849.613) [-845.700] * (-848.899) (-845.490) (-847.437) [-846.333] -- 0:00:41
      356000 -- (-846.644) (-847.773) (-845.763) [-845.658] * [-846.264] (-845.731) (-847.420) (-844.689) -- 0:00:41
      356500 -- (-846.536) (-849.019) (-848.768) [-846.605] * (-850.240) (-844.436) (-852.221) [-848.051] -- 0:00:41
      357000 -- (-846.926) (-846.488) (-849.667) [-844.197] * [-844.740] (-844.241) (-852.052) (-846.984) -- 0:00:41
      357500 -- (-847.902) (-846.316) (-846.707) [-847.577] * [-846.557] (-846.597) (-850.750) (-846.877) -- 0:00:41
      358000 -- (-845.151) (-845.269) (-844.268) [-846.891] * [-844.693] (-847.310) (-844.686) (-846.004) -- 0:00:41
      358500 -- [-846.513] (-847.129) (-845.328) (-847.639) * (-850.466) [-848.053] (-846.686) (-845.696) -- 0:00:41
      359000 -- [-844.782] (-846.231) (-846.587) (-846.016) * (-844.746) (-845.587) (-847.059) [-844.769] -- 0:00:41
      359500 -- (-849.330) [-844.834] (-845.377) (-847.750) * [-845.090] (-844.763) (-846.067) (-846.734) -- 0:00:40
      360000 -- (-845.892) (-845.111) [-848.683] (-847.797) * [-849.597] (-844.276) (-847.878) (-845.414) -- 0:00:42

      Average standard deviation of split frequencies: 0.010747

      360500 -- (-846.264) (-846.090) [-845.176] (-844.935) * (-846.081) (-845.032) (-845.808) [-845.352] -- 0:00:42
      361000 -- (-847.471) (-846.429) [-845.023] (-846.349) * (-845.837) (-845.707) (-844.819) [-848.046] -- 0:00:42
      361500 -- (-846.519) (-848.000) [-845.448] (-845.045) * (-850.900) (-845.721) [-844.823] (-845.559) -- 0:00:42
      362000 -- (-845.330) [-848.083] (-845.305) (-846.188) * (-846.459) (-848.461) [-848.522] (-845.052) -- 0:00:42
      362500 -- (-847.449) (-848.622) (-849.220) [-846.727] * (-846.828) (-845.085) [-844.691] (-845.370) -- 0:00:42
      363000 -- (-846.234) (-846.179) (-846.854) [-846.106] * (-852.550) [-845.087] (-845.189) (-845.954) -- 0:00:42
      363500 -- (-845.057) (-846.208) (-846.954) [-844.330] * (-846.066) [-845.514] (-844.433) (-847.094) -- 0:00:42
      364000 -- (-846.653) [-848.497] (-846.579) (-845.534) * (-847.276) (-847.634) [-849.128] (-847.715) -- 0:00:41
      364500 -- (-847.570) (-844.600) [-846.794] (-846.105) * (-848.485) [-849.006] (-848.827) (-848.178) -- 0:00:41
      365000 -- [-846.001] (-845.230) (-851.782) (-845.890) * [-844.861] (-844.523) (-845.675) (-847.282) -- 0:00:41

      Average standard deviation of split frequencies: 0.011377

      365500 -- [-849.827] (-846.448) (-846.374) (-852.834) * (-849.115) (-845.099) (-848.873) [-847.132] -- 0:00:41
      366000 -- (-845.238) [-845.344] (-847.362) (-849.997) * (-848.910) (-845.159) [-846.314] (-848.213) -- 0:00:41
      366500 -- (-846.217) (-845.458) (-845.510) [-849.974] * (-846.549) (-845.902) [-846.259] (-845.694) -- 0:00:41
      367000 -- (-845.764) [-846.970] (-847.242) (-847.661) * (-845.297) (-845.304) [-845.762] (-849.250) -- 0:00:41
      367500 -- [-845.420] (-844.813) (-846.780) (-847.463) * (-847.817) [-844.971] (-846.691) (-844.813) -- 0:00:41
      368000 -- (-849.211) [-845.556] (-847.076) (-846.978) * (-850.024) (-853.872) (-845.886) [-849.022] -- 0:00:41
      368500 -- (-847.157) (-845.632) (-845.709) [-844.678] * (-846.673) (-844.605) (-848.123) [-851.162] -- 0:00:41
      369000 -- (-845.666) (-845.206) [-846.092] (-847.424) * (-847.127) (-845.499) (-845.837) [-846.180] -- 0:00:41
      369500 -- (-845.039) (-845.333) [-846.078] (-846.669) * (-851.446) (-845.720) (-845.286) [-848.705] -- 0:00:40
      370000 -- (-844.501) (-848.312) [-845.737] (-849.877) * (-847.990) (-845.197) [-844.912] (-848.303) -- 0:00:40

      Average standard deviation of split frequencies: 0.011446

      370500 -- [-847.119] (-845.992) (-850.553) (-849.764) * (-847.183) (-847.482) (-846.893) [-846.630] -- 0:00:40
      371000 -- (-849.169) [-847.077] (-846.008) (-851.981) * [-848.210] (-849.690) (-847.046) (-849.621) -- 0:00:40
      371500 -- (-845.824) (-849.591) (-844.443) [-844.381] * (-845.744) [-849.521] (-846.094) (-849.327) -- 0:00:40
      372000 -- [-848.324] (-848.810) (-848.628) (-844.673) * (-846.874) [-844.672] (-847.186) (-851.846) -- 0:00:40
      372500 -- (-844.902) [-846.650] (-850.656) (-847.408) * (-845.838) (-844.665) (-849.151) [-847.241] -- 0:00:40
      373000 -- (-845.088) (-844.574) (-849.978) [-850.733] * (-847.091) [-844.844] (-846.344) (-845.116) -- 0:00:40
      373500 -- [-844.695] (-844.834) (-845.483) (-848.238) * (-845.819) [-844.524] (-844.683) (-845.682) -- 0:00:40
      374000 -- (-845.560) [-849.600] (-844.764) (-846.660) * (-845.486) (-844.343) [-845.086] (-845.537) -- 0:00:40
      374500 -- (-846.188) (-845.347) [-847.205] (-844.376) * [-847.124] (-844.763) (-846.045) (-844.498) -- 0:00:40
      375000 -- [-844.751] (-848.368) (-844.895) (-850.082) * [-844.654] (-850.043) (-850.657) (-847.042) -- 0:00:40

      Average standard deviation of split frequencies: 0.011562

      375500 -- [-846.510] (-846.017) (-846.975) (-846.384) * (-853.624) (-847.900) [-847.002] (-847.396) -- 0:00:39
      376000 -- (-848.684) (-847.603) [-846.376] (-846.792) * (-847.425) (-845.107) (-847.630) [-845.848] -- 0:00:39
      376500 -- (-846.909) (-847.258) [-850.357] (-848.477) * [-847.515] (-845.969) (-847.764) (-844.758) -- 0:00:41
      377000 -- (-846.180) (-846.556) (-844.781) [-846.288] * (-847.203) (-845.777) (-846.937) [-845.740] -- 0:00:41
      377500 -- [-846.146] (-847.333) (-848.269) (-845.720) * (-845.495) (-848.316) [-845.804] (-845.841) -- 0:00:41
      378000 -- (-845.272) (-846.368) (-845.591) [-845.721] * (-845.595) (-845.854) [-844.840] (-844.073) -- 0:00:41
      378500 -- [-844.849] (-848.793) (-845.670) (-851.289) * (-845.777) (-846.023) [-845.068] (-844.322) -- 0:00:41
      379000 -- (-847.337) (-845.568) (-845.673) [-848.774] * [-846.054] (-845.292) (-844.836) (-844.907) -- 0:00:40
      379500 -- (-848.381) (-848.435) [-848.524] (-852.944) * (-845.487) (-845.523) (-844.303) [-845.676] -- 0:00:40
      380000 -- (-847.195) (-848.049) (-843.905) [-846.543] * (-845.515) (-845.585) [-845.215] (-845.676) -- 0:00:40

      Average standard deviation of split frequencies: 0.011218

      380500 -- (-845.825) (-844.208) (-846.732) [-851.628] * (-846.544) [-845.624] (-848.614) (-845.947) -- 0:00:40
      381000 -- (-847.146) [-846.664] (-844.868) (-847.440) * (-849.150) (-846.370) [-846.231] (-848.644) -- 0:00:40
      381500 -- (-848.105) [-845.609] (-845.523) (-848.018) * (-846.552) (-846.132) (-849.790) [-848.896] -- 0:00:40
      382000 -- (-848.309) [-845.099] (-844.052) (-850.216) * (-845.485) (-845.895) [-844.885] (-845.709) -- 0:00:40
      382500 -- (-845.964) [-844.046] (-845.416) (-845.238) * [-847.687] (-845.783) (-848.246) (-845.495) -- 0:00:40
      383000 -- [-845.449] (-846.441) (-846.879) (-844.991) * (-845.894) [-846.699] (-848.889) (-847.084) -- 0:00:40
      383500 -- (-849.785) [-845.480] (-846.948) (-844.250) * (-849.696) (-844.521) [-848.232] (-848.322) -- 0:00:40
      384000 -- (-847.947) (-844.481) [-846.247] (-848.182) * (-845.964) (-847.317) [-848.328] (-846.724) -- 0:00:40
      384500 -- [-844.343] (-847.177) (-849.294) (-846.106) * (-847.364) (-847.204) [-847.753] (-846.245) -- 0:00:40
      385000 -- (-844.469) [-846.080] (-845.427) (-848.221) * [-845.075] (-846.270) (-844.263) (-846.841) -- 0:00:39

      Average standard deviation of split frequencies: 0.011350

      385500 -- (-847.265) [-846.925] (-846.755) (-845.246) * (-846.300) (-845.993) [-844.821] (-846.540) -- 0:00:39
      386000 -- [-845.132] (-846.318) (-848.200) (-845.250) * (-846.212) (-847.894) (-847.143) [-845.306] -- 0:00:39
      386500 -- (-844.940) [-845.939] (-848.293) (-844.278) * (-845.893) (-844.600) (-845.057) [-845.787] -- 0:00:39
      387000 -- (-845.244) (-847.623) (-845.687) [-847.220] * [-844.677] (-846.398) (-845.057) (-846.895) -- 0:00:39
      387500 -- (-844.565) (-844.307) (-845.384) [-847.044] * (-844.992) (-846.291) (-844.882) [-845.905] -- 0:00:39
      388000 -- (-848.330) (-845.390) (-845.127) [-848.715] * (-847.451) [-848.492] (-846.290) (-847.805) -- 0:00:39
      388500 -- (-845.131) [-845.215] (-846.112) (-847.190) * (-844.487) (-847.151) [-846.775] (-844.711) -- 0:00:39
      389000 -- [-846.790] (-844.795) (-846.984) (-844.373) * (-845.252) (-847.705) [-846.433] (-844.426) -- 0:00:39
      389500 -- (-846.449) (-845.279) [-845.974] (-844.582) * [-845.168] (-845.123) (-844.391) (-845.702) -- 0:00:39
      390000 -- (-844.751) (-844.000) (-846.097) [-844.649] * (-845.139) [-847.099] (-846.622) (-849.313) -- 0:00:39

      Average standard deviation of split frequencies: 0.011357

      390500 -- (-845.339) (-845.735) (-846.668) [-846.025] * (-848.219) (-847.090) [-845.507] (-852.393) -- 0:00:39
      391000 -- [-845.718] (-847.457) (-847.357) (-847.294) * (-846.670) (-850.939) [-844.405] (-848.904) -- 0:00:38
      391500 -- (-845.070) (-844.203) (-847.013) [-850.691] * (-849.570) (-844.057) [-850.660] (-844.910) -- 0:00:38
      392000 -- [-846.264] (-845.880) (-846.844) (-848.262) * (-847.888) (-846.900) [-845.751] (-844.797) -- 0:00:38
      392500 -- (-846.996) (-846.216) (-846.868) [-847.120] * (-850.397) (-849.152) (-847.658) [-844.859] -- 0:00:38
      393000 -- (-845.330) [-848.716] (-848.499) (-845.514) * (-846.423) (-846.795) [-845.836] (-845.764) -- 0:00:40
      393500 -- [-847.215] (-845.734) (-844.495) (-846.717) * (-852.688) (-847.254) [-848.506] (-844.381) -- 0:00:40
      394000 -- (-847.250) (-845.405) (-849.438) [-850.480] * [-851.400] (-846.233) (-846.533) (-845.718) -- 0:00:39
      394500 -- (-846.343) [-845.088] (-847.295) (-847.112) * (-847.833) (-846.644) [-845.515] (-852.479) -- 0:00:39
      395000 -- [-844.932] (-848.583) (-848.605) (-848.910) * [-849.143] (-845.904) (-845.096) (-847.728) -- 0:00:39

      Average standard deviation of split frequencies: 0.010574

      395500 -- (-846.312) [-847.867] (-845.882) (-848.736) * (-845.335) (-846.737) (-845.129) [-845.721] -- 0:00:39
      396000 -- [-846.277] (-848.267) (-845.828) (-846.995) * [-848.259] (-844.425) (-845.663) (-846.285) -- 0:00:39
      396500 -- [-845.157] (-846.657) (-847.609) (-849.714) * [-845.968] (-848.044) (-848.710) (-847.830) -- 0:00:39
      397000 -- (-845.572) [-845.979] (-849.465) (-847.729) * (-846.967) (-848.966) (-846.573) [-845.367] -- 0:00:39
      397500 -- (-847.656) (-845.607) (-846.986) [-847.135] * (-846.226) (-847.537) (-853.449) [-844.265] -- 0:00:39
      398000 -- (-846.603) (-844.259) [-846.760] (-849.050) * (-846.585) [-853.554] (-845.394) (-846.452) -- 0:00:39
      398500 -- (-847.640) [-846.812] (-846.100) (-845.316) * (-845.656) (-846.792) (-848.874) [-848.565] -- 0:00:39
      399000 -- (-851.175) (-847.890) (-845.493) [-845.240] * (-846.287) [-846.412] (-847.662) (-846.376) -- 0:00:39
      399500 -- (-846.403) [-844.859] (-844.532) (-846.320) * [-845.516] (-848.596) (-846.223) (-846.737) -- 0:00:39
      400000 -- (-847.758) (-847.190) [-844.061] (-846.885) * (-846.716) (-844.447) (-846.362) [-846.748] -- 0:00:39

      Average standard deviation of split frequencies: 0.010442

      400500 -- (-845.660) (-847.160) (-851.503) [-846.300] * (-850.186) [-846.344] (-846.098) (-847.369) -- 0:00:38
      401000 -- (-846.722) (-846.884) (-848.052) [-846.404] * (-845.388) [-846.393] (-848.934) (-853.306) -- 0:00:38
      401500 -- [-844.847] (-846.497) (-845.886) (-846.076) * [-847.246] (-850.075) (-845.173) (-848.149) -- 0:00:38
      402000 -- (-845.566) (-848.866) [-846.128] (-850.886) * [-846.884] (-845.954) (-845.429) (-846.346) -- 0:00:38
      402500 -- [-844.969] (-845.309) (-845.408) (-845.579) * (-845.776) (-845.923) [-847.139] (-845.485) -- 0:00:38
      403000 -- (-846.364) (-846.029) [-847.214] (-846.541) * [-846.617] (-853.105) (-846.951) (-846.819) -- 0:00:38
      403500 -- (-846.560) [-846.917] (-848.418) (-845.841) * (-847.394) (-846.973) [-851.668] (-847.824) -- 0:00:38
      404000 -- (-846.736) (-845.930) (-847.506) [-845.486] * (-848.837) (-846.035) [-845.104] (-846.740) -- 0:00:38
      404500 -- (-845.471) (-847.321) (-846.699) [-845.760] * (-846.878) (-846.034) [-848.458] (-844.486) -- 0:00:38
      405000 -- (-845.645) (-845.500) [-845.645] (-846.134) * [-846.479] (-846.020) (-847.712) (-845.885) -- 0:00:38

      Average standard deviation of split frequencies: 0.009797

      405500 -- (-851.334) (-845.064) (-844.739) [-845.894] * [-845.038] (-848.282) (-847.616) (-843.982) -- 0:00:38
      406000 -- (-849.671) [-845.155] (-845.697) (-847.660) * (-849.797) [-845.304] (-850.802) (-847.281) -- 0:00:38
      406500 -- (-847.036) [-844.060] (-845.622) (-847.438) * (-845.374) (-844.381) [-852.014] (-845.578) -- 0:00:37
      407000 -- (-844.431) (-848.067) (-845.923) [-845.383] * (-846.232) (-846.080) [-845.989] (-846.913) -- 0:00:37
      407500 -- (-847.012) [-846.432] (-848.340) (-845.941) * (-846.356) (-844.666) (-845.905) [-846.477] -- 0:00:37
      408000 -- (-847.063) (-848.639) [-847.594] (-844.763) * [-845.025] (-845.884) (-846.684) (-848.259) -- 0:00:37
      408500 -- (-851.741) (-846.587) [-845.110] (-847.770) * (-845.935) (-850.467) (-848.637) [-844.767] -- 0:00:37
      409000 -- (-848.499) [-845.713] (-848.581) (-847.161) * [-845.839] (-848.252) (-848.225) (-847.871) -- 0:00:37
      409500 -- (-847.379) (-846.553) [-847.345] (-850.864) * (-845.535) [-847.525] (-846.462) (-847.037) -- 0:00:38
      410000 -- (-845.260) [-844.324] (-845.439) (-848.850) * (-845.087) (-846.259) (-846.019) [-851.003] -- 0:00:38

      Average standard deviation of split frequencies: 0.009972

      410500 -- (-848.146) (-845.055) [-845.948] (-844.997) * [-845.298] (-846.489) (-848.202) (-844.788) -- 0:00:38
      411000 -- (-847.632) (-844.541) [-845.188] (-844.260) * (-846.774) (-848.195) [-847.314] (-846.347) -- 0:00:38
      411500 -- (-852.838) (-847.326) (-845.177) [-845.590] * (-847.480) [-847.480] (-846.715) (-846.245) -- 0:00:38
      412000 -- (-849.827) (-845.949) [-846.957] (-845.089) * (-846.760) [-847.418] (-846.136) (-848.296) -- 0:00:38
      412500 -- (-850.176) (-848.475) (-847.409) [-846.522] * (-845.854) (-848.099) (-846.316) [-846.970] -- 0:00:38
      413000 -- [-848.061] (-847.867) (-849.948) (-844.649) * (-847.246) [-845.814] (-845.292) (-845.218) -- 0:00:38
      413500 -- [-845.949] (-848.904) (-845.489) (-845.199) * (-850.511) [-847.114] (-847.468) (-847.091) -- 0:00:38
      414000 -- [-844.618] (-845.131) (-844.667) (-852.580) * (-849.729) [-845.959] (-844.295) (-846.003) -- 0:00:38
      414500 -- (-846.640) [-847.335] (-846.984) (-851.980) * (-849.579) (-845.588) [-844.954] (-845.583) -- 0:00:38
      415000 -- (-846.388) [-846.179] (-849.983) (-851.989) * [-849.452] (-846.562) (-845.076) (-847.261) -- 0:00:38

      Average standard deviation of split frequencies: 0.009845

      415500 -- [-852.710] (-846.809) (-846.076) (-847.341) * (-845.279) (-848.951) (-846.584) [-847.705] -- 0:00:37
      416000 -- (-847.020) (-846.085) (-848.815) [-846.468] * (-844.272) (-846.617) [-844.603] (-845.188) -- 0:00:37
      416500 -- (-848.994) (-845.772) (-844.407) [-846.215] * (-845.434) [-846.578] (-846.731) (-845.816) -- 0:00:37
      417000 -- (-848.169) (-844.804) [-845.366] (-849.543) * (-852.264) (-847.134) (-844.607) [-844.745] -- 0:00:37
      417500 -- [-844.474] (-847.642) (-847.787) (-853.263) * (-846.149) (-847.843) [-845.156] (-844.349) -- 0:00:37
      418000 -- [-845.212] (-844.745) (-846.659) (-848.196) * (-844.578) (-851.040) [-845.775] (-844.440) -- 0:00:37
      418500 -- (-847.929) (-845.614) (-846.642) [-847.488] * (-846.613) (-846.798) (-848.362) [-845.116] -- 0:00:37
      419000 -- [-844.759] (-845.628) (-850.296) (-848.140) * (-845.884) (-848.565) (-848.346) [-845.556] -- 0:00:37
      419500 -- (-844.965) (-844.730) [-848.831] (-846.861) * (-847.273) (-846.350) (-848.927) [-847.246] -- 0:00:37
      420000 -- (-845.474) (-844.403) [-847.590] (-844.850) * (-848.217) (-845.204) (-848.478) [-844.644] -- 0:00:37

      Average standard deviation of split frequencies: 0.009245

      420500 -- (-846.340) [-846.989] (-848.304) (-844.363) * (-844.344) (-847.339) [-844.352] (-847.432) -- 0:00:37
      421000 -- (-846.713) [-844.760] (-847.531) (-845.005) * (-845.926) (-847.646) [-844.660] (-845.759) -- 0:00:37
      421500 -- [-844.530] (-845.970) (-847.376) (-844.664) * (-848.242) (-845.185) [-844.827] (-845.103) -- 0:00:37
      422000 -- (-847.596) (-847.261) [-844.640] (-845.086) * (-845.786) [-845.059] (-844.115) (-845.042) -- 0:00:36
      422500 -- (-848.398) (-847.619) (-844.884) [-845.769] * (-845.036) [-846.314] (-844.803) (-846.356) -- 0:00:36
      423000 -- (-846.315) (-844.807) [-845.691] (-846.876) * (-844.465) (-845.985) (-848.012) [-845.861] -- 0:00:36
      423500 -- [-846.826] (-847.991) (-849.265) (-846.036) * (-844.965) [-849.076] (-846.980) (-844.944) -- 0:00:36
      424000 -- [-846.958] (-846.339) (-846.509) (-849.799) * (-847.021) (-849.621) (-847.374) [-846.950] -- 0:00:36
      424500 -- (-846.010) (-847.006) (-844.901) [-850.754] * [-845.837] (-847.109) (-847.405) (-844.021) -- 0:00:36
      425000 -- (-844.935) [-849.455] (-848.658) (-846.098) * (-845.938) (-846.030) (-844.520) [-844.014] -- 0:00:36

      Average standard deviation of split frequencies: 0.009198

      425500 -- (-845.266) (-846.547) [-844.524] (-846.908) * [-845.294] (-846.164) (-845.523) (-844.503) -- 0:00:36
      426000 -- (-851.990) [-845.391] (-845.545) (-845.467) * (-845.656) [-845.339] (-845.858) (-846.477) -- 0:00:37
      426500 -- (-850.990) [-847.407] (-844.795) (-848.430) * (-844.657) (-847.345) (-844.990) [-845.535] -- 0:00:37
      427000 -- (-844.634) [-847.585] (-846.244) (-850.780) * [-846.653] (-849.537) (-849.079) (-844.536) -- 0:00:37
      427500 -- (-849.677) [-844.805] (-851.414) (-844.757) * (-846.831) [-847.317] (-847.212) (-844.063) -- 0:00:37
      428000 -- (-844.642) [-846.286] (-855.973) (-846.828) * (-844.514) [-848.258] (-847.716) (-844.072) -- 0:00:37
      428500 -- (-847.766) (-846.934) [-850.949] (-845.748) * [-845.304] (-845.618) (-848.926) (-844.871) -- 0:00:37
      429000 -- [-845.414] (-847.174) (-847.257) (-847.910) * (-846.089) (-844.304) (-845.175) [-845.333] -- 0:00:37
      429500 -- [-846.505] (-847.111) (-846.949) (-846.420) * [-844.275] (-845.910) (-847.357) (-845.816) -- 0:00:37
      430000 -- [-844.860] (-845.682) (-847.234) (-844.525) * (-845.420) [-846.926] (-848.781) (-847.201) -- 0:00:37

      Average standard deviation of split frequencies: 0.009099

      430500 -- (-854.539) (-849.424) [-844.798] (-846.192) * (-844.948) (-846.033) [-848.946] (-845.512) -- 0:00:37
      431000 -- (-845.920) [-845.284] (-847.305) (-848.378) * (-846.332) (-848.046) [-846.183] (-845.546) -- 0:00:36
      431500 -- (-846.922) (-844.952) (-851.595) [-847.146] * (-848.848) [-845.739] (-846.257) (-846.985) -- 0:00:36
      432000 -- (-846.432) (-845.429) (-848.995) [-845.640] * [-849.843] (-848.592) (-849.571) (-846.346) -- 0:00:36
      432500 -- (-847.498) [-844.421] (-846.377) (-847.953) * (-845.328) (-845.823) [-845.316] (-847.091) -- 0:00:36
      433000 -- (-845.747) (-846.206) (-847.835) [-850.652] * (-844.778) (-846.161) [-847.280] (-846.650) -- 0:00:36
      433500 -- [-845.236] (-846.730) (-846.357) (-845.269) * (-845.756) (-847.285) (-847.028) [-845.693] -- 0:00:36
      434000 -- (-848.775) (-846.810) [-845.548] (-845.890) * (-845.007) [-849.059] (-847.266) (-846.361) -- 0:00:36
      434500 -- (-844.960) [-844.855] (-846.140) (-844.368) * (-847.311) (-849.041) [-851.998] (-847.626) -- 0:00:36
      435000 -- (-849.554) (-844.508) (-848.019) [-844.224] * (-849.053) [-847.036] (-844.586) (-845.399) -- 0:00:36

      Average standard deviation of split frequencies: 0.009922

      435500 -- [-845.512] (-849.325) (-848.999) (-844.598) * (-845.354) (-848.045) (-848.796) [-847.830] -- 0:00:36
      436000 -- (-846.242) [-845.204] (-846.124) (-844.459) * (-846.880) [-846.564] (-846.385) (-845.421) -- 0:00:36
      436500 -- (-845.066) [-845.731] (-846.682) (-846.380) * (-846.780) [-846.192] (-844.735) (-845.563) -- 0:00:36
      437000 -- (-845.427) [-847.942] (-844.830) (-848.227) * (-845.523) (-847.404) [-845.444] (-844.964) -- 0:00:36
      437500 -- (-849.248) (-847.021) (-848.579) [-845.259] * (-849.967) (-845.031) (-846.867) [-844.460] -- 0:00:36
      438000 -- (-847.786) (-845.457) [-845.855] (-847.462) * (-847.995) [-846.063] (-845.113) (-846.913) -- 0:00:35
      438500 -- (-846.761) (-847.101) (-844.673) [-847.946] * (-847.197) (-845.945) [-847.464] (-845.315) -- 0:00:35
      439000 -- (-845.982) (-850.394) (-847.792) [-845.505] * (-846.013) (-849.987) [-846.558] (-845.315) -- 0:00:35
      439500 -- (-843.998) (-848.293) [-845.106] (-845.044) * (-846.067) (-846.515) [-846.631] (-846.647) -- 0:00:35
      440000 -- (-846.336) (-849.237) [-844.369] (-845.071) * (-845.442) (-845.267) [-846.419] (-844.098) -- 0:00:35

      Average standard deviation of split frequencies: 0.008936

      440500 -- (-845.625) (-848.169) [-844.663] (-845.519) * (-844.428) (-846.876) (-849.745) [-845.105] -- 0:00:35
      441000 -- (-844.998) (-854.101) (-846.069) [-851.475] * (-844.549) (-847.059) [-844.496] (-846.339) -- 0:00:35
      441500 -- [-847.887] (-845.804) (-847.366) (-846.488) * (-847.081) [-845.547] (-844.428) (-849.446) -- 0:00:35
      442000 -- [-845.701] (-847.105) (-847.786) (-845.033) * (-846.475) [-847.782] (-845.042) (-849.218) -- 0:00:35
      442500 -- (-847.704) (-847.031) (-846.239) [-844.821] * (-847.088) (-848.280) (-845.138) [-845.229] -- 0:00:36
      443000 -- (-848.063) [-845.093] (-845.879) (-847.014) * (-847.355) (-849.297) (-844.989) [-848.013] -- 0:00:36
      443500 -- [-847.358] (-845.264) (-845.168) (-846.653) * (-845.194) (-848.753) [-844.629] (-848.191) -- 0:00:36
      444000 -- (-846.615) (-845.304) [-844.653] (-851.265) * (-844.434) (-847.950) [-847.299] (-848.396) -- 0:00:36
      444500 -- (-846.105) (-846.298) [-849.932] (-848.343) * (-848.558) (-847.153) [-849.976] (-849.937) -- 0:00:36
      445000 -- (-845.976) [-845.809] (-847.338) (-849.417) * (-846.561) (-847.248) (-848.042) [-847.849] -- 0:00:36

      Average standard deviation of split frequencies: 0.008145

      445500 -- (-845.920) (-844.941) (-852.643) [-845.258] * (-845.857) [-845.179] (-845.925) (-847.961) -- 0:00:36
      446000 -- [-845.712] (-844.773) (-847.786) (-846.409) * [-847.240] (-847.471) (-844.824) (-844.769) -- 0:00:36
      446500 -- (-845.615) (-844.206) (-845.606) [-844.839] * (-846.009) [-844.829] (-844.376) (-844.501) -- 0:00:35
      447000 -- (-846.856) (-847.419) [-844.505] (-847.059) * (-847.696) (-846.771) [-844.381] (-844.712) -- 0:00:35
      447500 -- (-847.439) (-849.451) (-846.360) [-845.153] * (-845.971) (-850.229) (-844.451) [-844.477] -- 0:00:35
      448000 -- [-846.348] (-849.517) (-846.534) (-853.199) * (-846.356) (-849.786) (-844.329) [-847.114] -- 0:00:35
      448500 -- (-844.807) (-847.447) [-849.364] (-845.509) * (-845.974) (-847.032) [-845.269] (-847.692) -- 0:00:35
      449000 -- [-850.153] (-847.217) (-847.088) (-845.287) * (-846.758) (-850.316) (-849.889) [-844.937] -- 0:00:35
      449500 -- (-848.242) [-844.492] (-848.961) (-844.655) * (-850.947) [-844.746] (-846.173) (-845.122) -- 0:00:35
      450000 -- (-846.900) (-846.178) (-847.764) [-845.492] * (-844.049) [-845.462] (-845.201) (-849.987) -- 0:00:35

      Average standard deviation of split frequencies: 0.007630

      450500 -- [-844.934] (-847.216) (-846.770) (-846.584) * (-844.747) (-845.113) (-845.710) [-845.726] -- 0:00:35
      451000 -- (-845.750) [-845.823] (-852.066) (-844.534) * (-845.639) (-845.684) (-845.298) [-845.502] -- 0:00:35
      451500 -- (-845.058) [-845.071] (-846.664) (-845.579) * [-845.165] (-845.777) (-848.930) (-846.764) -- 0:00:35
      452000 -- (-846.965) (-847.468) [-847.867] (-844.445) * (-845.221) [-846.107] (-845.639) (-844.973) -- 0:00:35
      452500 -- (-846.351) (-846.612) [-851.491] (-850.674) * (-845.441) (-845.924) [-846.035] (-847.632) -- 0:00:35
      453000 -- [-847.824] (-844.504) (-846.055) (-845.879) * (-845.334) [-847.218] (-847.672) (-845.486) -- 0:00:35
      453500 -- (-852.943) (-845.406) (-850.539) [-848.359] * (-844.929) [-847.368] (-847.605) (-844.487) -- 0:00:34
      454000 -- (-845.770) (-846.078) [-844.478] (-846.303) * (-847.349) [-846.122] (-848.067) (-847.246) -- 0:00:34
      454500 -- (-847.100) [-847.901] (-845.902) (-845.109) * (-848.260) (-846.735) [-847.191] (-847.577) -- 0:00:34
      455000 -- [-845.737] (-846.997) (-845.628) (-845.351) * (-844.470) (-845.249) [-849.088] (-846.303) -- 0:00:34

      Average standard deviation of split frequencies: 0.007541

      455500 -- (-850.865) (-846.162) (-844.101) [-844.713] * (-845.351) (-846.010) [-845.589] (-846.221) -- 0:00:34
      456000 -- (-847.035) (-847.241) [-844.223] (-844.572) * (-845.248) (-845.393) (-847.124) [-845.309] -- 0:00:34
      456500 -- [-847.333] (-846.050) (-844.717) (-844.343) * (-844.551) (-846.318) (-846.622) [-846.431] -- 0:00:34
      457000 -- (-846.783) (-845.468) (-847.937) [-844.635] * (-848.383) (-845.476) (-844.390) [-844.729] -- 0:00:34
      457500 -- (-852.472) (-845.241) (-850.441) [-846.854] * (-846.216) (-844.634) (-845.402) [-845.198] -- 0:00:34
      458000 -- [-844.232] (-846.887) (-850.999) (-847.539) * [-846.910] (-844.554) (-845.633) (-849.668) -- 0:00:34
      458500 -- (-843.961) (-845.094) (-844.576) [-844.043] * (-846.229) (-847.763) [-846.757] (-846.572) -- 0:00:34
      459000 -- (-844.395) (-845.544) [-846.005] (-844.739) * (-847.092) (-846.486) [-848.367] (-846.553) -- 0:00:35
      459500 -- [-853.344] (-844.656) (-846.365) (-848.446) * (-850.383) (-848.153) (-846.661) [-847.395] -- 0:00:35
      460000 -- (-848.284) (-844.289) [-847.304] (-848.384) * (-846.302) [-845.609] (-844.992) (-846.421) -- 0:00:35

      Average standard deviation of split frequencies: 0.008427

      460500 -- (-847.837) (-845.665) [-845.081] (-851.238) * (-846.246) (-844.820) [-850.033] (-845.587) -- 0:00:35
      461000 -- (-849.349) (-850.523) [-845.769] (-847.301) * (-845.600) [-845.975] (-847.818) (-849.681) -- 0:00:35
      461500 -- (-847.173) (-847.617) [-846.156] (-846.825) * [-846.185] (-844.869) (-847.681) (-849.920) -- 0:00:35
      462000 -- (-845.149) [-845.573] (-845.136) (-846.032) * (-844.327) [-844.478] (-845.258) (-848.768) -- 0:00:34
      462500 -- [-847.263] (-844.697) (-845.590) (-844.440) * (-845.229) (-845.222) (-845.292) [-847.381] -- 0:00:34
      463000 -- [-848.519] (-846.401) (-848.277) (-848.167) * (-846.845) [-844.623] (-845.627) (-847.969) -- 0:00:34
      463500 -- [-845.574] (-846.170) (-845.648) (-847.507) * (-849.475) (-844.511) [-847.014] (-847.422) -- 0:00:34
      464000 -- (-844.281) (-846.729) [-844.799] (-844.787) * [-850.572] (-846.611) (-846.175) (-848.927) -- 0:00:34
      464500 -- (-845.584) [-846.650] (-845.094) (-844.978) * (-849.881) [-850.011] (-849.245) (-848.593) -- 0:00:34
      465000 -- (-849.030) (-848.899) [-847.902] (-845.161) * (-846.279) [-845.902] (-849.321) (-846.413) -- 0:00:34

      Average standard deviation of split frequencies: 0.009045

      465500 -- [-850.188] (-844.904) (-845.287) (-846.037) * (-845.809) (-847.167) (-847.049) [-844.962] -- 0:00:34
      466000 -- [-846.824] (-844.489) (-844.096) (-849.254) * [-845.434] (-847.781) (-846.252) (-844.714) -- 0:00:34
      466500 -- (-847.725) (-844.105) [-848.226] (-846.447) * [-846.540] (-851.918) (-851.044) (-851.934) -- 0:00:34
      467000 -- [-844.972] (-844.418) (-847.611) (-848.371) * [-844.580] (-851.159) (-848.946) (-847.481) -- 0:00:34
      467500 -- [-844.794] (-845.251) (-846.974) (-845.087) * [-845.074] (-848.584) (-846.304) (-846.142) -- 0:00:34
      468000 -- (-844.391) [-845.398] (-849.587) (-845.154) * (-846.026) (-846.354) (-848.557) [-846.189] -- 0:00:34
      468500 -- (-844.258) [-848.137] (-844.372) (-846.534) * (-845.198) [-846.100] (-846.325) (-848.148) -- 0:00:34
      469000 -- (-844.261) (-845.466) [-847.732] (-844.768) * (-847.281) (-849.973) [-847.092] (-846.742) -- 0:00:33
      469500 -- (-846.645) (-844.647) [-844.995] (-844.734) * (-848.732) (-847.061) (-846.405) [-846.797] -- 0:00:33
      470000 -- (-845.576) (-844.685) (-852.938) [-846.128] * (-848.029) [-847.520] (-845.524) (-846.551) -- 0:00:33

      Average standard deviation of split frequencies: 0.009014

      470500 -- [-844.857] (-848.975) (-847.575) (-844.870) * [-846.132] (-849.262) (-848.698) (-845.628) -- 0:00:33
      471000 -- [-844.976] (-854.057) (-846.987) (-844.894) * (-845.917) (-845.493) [-845.118] (-845.540) -- 0:00:33
      471500 -- (-850.567) [-850.369] (-845.596) (-846.899) * (-848.464) [-845.338] (-845.910) (-846.087) -- 0:00:33
      472000 -- (-844.285) [-845.836] (-845.350) (-847.701) * (-850.775) (-846.904) (-844.721) [-848.089] -- 0:00:33
      472500 -- (-845.954) [-844.903] (-847.428) (-844.366) * (-849.266) (-846.888) [-844.341] (-845.987) -- 0:00:33
      473000 -- (-847.087) (-845.620) [-846.010] (-846.041) * (-850.739) (-848.036) (-847.889) [-846.590] -- 0:00:33
      473500 -- (-844.656) [-845.116] (-845.703) (-846.014) * [-845.456] (-845.570) (-850.024) (-846.398) -- 0:00:33
      474000 -- (-845.535) [-846.898] (-848.522) (-844.970) * (-846.014) (-845.396) (-847.157) [-844.858] -- 0:00:33
      474500 -- (-844.543) (-847.226) (-849.714) [-844.719] * (-849.737) (-847.676) (-845.463) [-844.678] -- 0:00:33
      475000 -- (-846.046) (-847.219) (-849.316) [-846.178] * (-845.292) (-844.314) [-844.683] (-847.891) -- 0:00:33

      Average standard deviation of split frequencies: 0.008272

      475500 -- [-845.734] (-845.932) (-846.581) (-849.637) * [-844.458] (-844.610) (-845.752) (-849.032) -- 0:00:34
      476000 -- (-845.107) [-846.231] (-850.765) (-846.019) * [-844.732] (-845.025) (-845.932) (-847.125) -- 0:00:34
      476500 -- (-848.154) (-845.438) (-847.679) [-846.012] * [-845.495] (-846.084) (-844.254) (-846.736) -- 0:00:34
      477000 -- (-849.125) (-845.115) (-844.577) [-844.132] * (-845.908) (-851.108) [-844.363] (-852.135) -- 0:00:33
      477500 -- (-849.830) (-845.065) [-846.021] (-847.519) * (-851.223) (-849.741) (-844.773) [-845.458] -- 0:00:33
      478000 -- (-845.072) (-845.684) [-847.922] (-848.601) * (-846.826) [-848.386] (-849.205) (-845.222) -- 0:00:33
      478500 -- (-847.050) (-850.240) (-845.629) [-845.320] * (-846.891) [-848.401] (-852.824) (-846.704) -- 0:00:33
      479000 -- [-846.159] (-846.285) (-848.497) (-845.530) * (-847.534) (-847.538) [-850.665] (-846.383) -- 0:00:33
      479500 -- [-845.114] (-846.762) (-848.877) (-847.497) * (-846.542) [-844.897] (-846.512) (-845.131) -- 0:00:33
      480000 -- (-845.756) (-846.595) (-847.415) [-846.162] * (-846.840) [-845.393] (-845.762) (-846.463) -- 0:00:33

      Average standard deviation of split frequencies: 0.007557

      480500 -- (-844.758) [-847.926] (-845.839) (-851.703) * (-845.220) (-846.082) (-845.742) [-844.987] -- 0:00:33
      481000 -- [-844.728] (-844.927) (-847.960) (-848.073) * (-847.524) (-845.076) (-846.055) [-845.235] -- 0:00:33
      481500 -- (-845.793) (-847.920) (-850.004) [-846.556] * (-846.546) [-846.363] (-846.920) (-845.234) -- 0:00:33
      482000 -- (-844.694) (-848.005) [-845.244] (-846.752) * (-845.139) [-850.310] (-846.530) (-844.631) -- 0:00:33
      482500 -- [-844.034] (-847.927) (-846.297) (-849.015) * (-848.005) (-847.771) [-846.066] (-850.351) -- 0:00:33
      483000 -- (-844.040) (-850.200) (-846.806) [-848.463] * [-845.096] (-848.504) (-844.383) (-848.193) -- 0:00:33
      483500 -- (-844.040) (-847.219) (-846.620) [-845.187] * (-844.499) (-848.904) (-847.283) [-845.228] -- 0:00:33
      484000 -- [-843.953] (-846.357) (-845.135) (-848.606) * (-850.442) (-847.346) [-845.232] (-845.326) -- 0:00:33
      484500 -- (-845.206) (-844.039) (-846.142) [-846.689] * (-845.042) [-845.746] (-846.077) (-845.882) -- 0:00:32
      485000 -- (-845.520) [-846.804] (-845.627) (-846.768) * (-846.763) [-844.756] (-846.428) (-845.844) -- 0:00:32

      Average standard deviation of split frequencies: 0.008083

      485500 -- (-846.083) (-847.954) (-845.296) [-846.751] * (-847.774) [-846.565] (-846.394) (-847.104) -- 0:00:32
      486000 -- (-851.824) [-844.379] (-844.275) (-847.914) * (-848.174) (-850.716) [-846.693] (-845.901) -- 0:00:32
      486500 -- [-847.088] (-844.314) (-844.383) (-849.765) * [-848.038] (-846.054) (-848.538) (-848.341) -- 0:00:32
      487000 -- (-848.193) (-844.312) (-845.233) [-848.113] * (-846.297) (-844.811) [-846.480] (-852.777) -- 0:00:32
      487500 -- (-845.438) [-846.613] (-845.601) (-847.312) * (-852.709) (-849.437) [-846.071] (-845.380) -- 0:00:32
      488000 -- (-845.390) (-848.992) (-846.351) [-847.788] * (-848.086) (-845.234) (-847.754) [-845.516] -- 0:00:32
      488500 -- [-847.033] (-852.535) (-846.203) (-846.540) * [-844.996] (-847.861) (-845.455) (-846.143) -- 0:00:32
      489000 -- (-845.759) (-850.636) (-844.373) [-847.171] * (-845.523) [-844.601] (-844.871) (-844.906) -- 0:00:32
      489500 -- (-846.672) (-844.378) [-846.364] (-845.402) * (-848.816) (-844.897) [-850.275] (-845.210) -- 0:00:32
      490000 -- [-849.102] (-849.205) (-846.460) (-845.974) * [-844.420] (-845.320) (-845.174) (-845.403) -- 0:00:32

      Average standard deviation of split frequencies: 0.007686

      490500 -- (-848.219) (-849.393) [-846.638] (-845.934) * (-845.725) (-845.052) (-844.700) [-848.207] -- 0:00:32
      491000 -- (-847.116) (-847.802) [-847.232] (-847.146) * [-845.821] (-846.755) (-844.387) (-846.259) -- 0:00:32
      491500 -- (-845.805) (-848.117) [-845.839] (-846.105) * (-846.803) [-846.865] (-847.085) (-845.615) -- 0:00:32
      492000 -- (-845.819) (-845.953) [-845.203] (-846.989) * (-849.063) [-844.478] (-846.593) (-845.055) -- 0:00:32
      492500 -- (-850.450) (-846.520) [-846.203] (-846.665) * [-847.189] (-857.378) (-846.208) (-845.875) -- 0:00:32
      493000 -- (-847.405) (-846.290) [-845.846] (-844.949) * [-846.954] (-850.554) (-846.258) (-846.326) -- 0:00:32
      493500 -- (-847.485) (-847.039) (-846.452) [-844.955] * (-845.794) (-849.319) [-846.793] (-845.713) -- 0:00:32
      494000 -- (-846.387) [-845.567] (-848.685) (-844.682) * (-847.759) (-848.184) (-846.115) [-846.566] -- 0:00:32
      494500 -- [-846.889] (-847.878) (-845.633) (-844.432) * (-846.835) (-848.720) [-845.698] (-844.793) -- 0:00:32
      495000 -- (-847.065) (-847.127) [-847.228] (-847.422) * [-846.941] (-852.112) (-844.207) (-848.008) -- 0:00:32

      Average standard deviation of split frequencies: 0.007324

      495500 -- (-845.072) (-846.732) (-844.834) [-845.524] * (-848.065) [-846.839] (-851.023) (-846.451) -- 0:00:32
      496000 -- (-845.408) (-850.264) (-845.464) [-846.149] * [-846.765] (-846.474) (-848.124) (-847.049) -- 0:00:32
      496500 -- (-846.058) [-846.016] (-845.239) (-844.893) * (-846.414) (-844.455) (-846.390) [-844.165] -- 0:00:32
      497000 -- (-845.095) (-847.698) (-846.988) [-846.759] * (-848.777) (-847.469) [-846.849] (-845.220) -- 0:00:32
      497500 -- (-845.168) (-850.651) (-847.675) [-846.006] * [-848.442] (-844.480) (-847.178) (-845.663) -- 0:00:32
      498000 -- [-850.430] (-849.911) (-846.453) (-847.075) * (-848.210) (-845.348) [-846.140] (-845.375) -- 0:00:32
      498500 -- (-845.698) (-851.136) (-849.397) [-844.821] * (-845.856) (-846.120) [-845.632] (-845.576) -- 0:00:32
      499000 -- (-848.009) (-848.159) [-844.841] (-845.516) * (-844.550) (-846.310) (-844.374) [-847.595] -- 0:00:32
      499500 -- (-846.298) (-848.783) [-843.991] (-845.771) * (-845.097) (-845.857) [-845.051] (-848.710) -- 0:00:32
      500000 -- (-846.371) (-850.556) (-845.264) [-846.570] * [-844.395] (-847.344) (-849.554) (-847.482) -- 0:00:32

      Average standard deviation of split frequencies: 0.007366

      500500 -- [-846.482] (-847.477) (-844.120) (-846.684) * [-846.491] (-844.691) (-845.125) (-846.090) -- 0:00:31
      501000 -- [-847.589] (-846.438) (-844.267) (-846.766) * (-846.946) [-846.824] (-845.098) (-847.337) -- 0:00:31
      501500 -- (-844.793) (-845.362) [-845.806] (-847.133) * (-844.613) [-845.012] (-848.395) (-845.748) -- 0:00:31
      502000 -- (-846.710) [-844.760] (-845.302) (-847.790) * (-845.714) [-847.976] (-846.297) (-848.891) -- 0:00:31
      502500 -- (-849.405) (-849.094) [-845.805] (-845.182) * (-847.188) (-847.650) (-848.951) [-849.023] -- 0:00:31
      503000 -- (-847.150) [-844.084] (-845.336) (-846.297) * (-849.295) (-845.785) [-849.980] (-853.155) -- 0:00:31
      503500 -- [-844.482] (-844.720) (-844.065) (-846.093) * [-844.866] (-845.500) (-845.469) (-846.997) -- 0:00:31
      504000 -- [-846.014] (-844.945) (-844.106) (-845.361) * [-848.905] (-844.748) (-850.957) (-854.037) -- 0:00:31
      504500 -- (-846.133) [-845.576] (-845.513) (-850.201) * (-847.019) [-845.147] (-846.465) (-852.908) -- 0:00:31
      505000 -- (-845.505) [-845.287] (-844.835) (-844.416) * (-844.333) (-848.777) [-846.421] (-848.369) -- 0:00:31

      Average standard deviation of split frequencies: 0.007782

      505500 -- (-844.450) (-847.623) (-845.144) [-844.961] * (-846.131) (-845.224) (-846.698) [-844.516] -- 0:00:31
      506000 -- (-847.289) (-845.679) [-848.439] (-845.474) * (-845.545) [-845.220] (-846.206) (-846.219) -- 0:00:31
      506500 -- (-845.045) (-845.527) [-846.123] (-850.262) * (-846.198) (-845.220) [-844.943] (-847.707) -- 0:00:31
      507000 -- (-848.469) (-845.509) (-846.153) [-851.410] * (-849.177) (-845.838) (-845.941) [-844.818] -- 0:00:31
      507500 -- (-849.507) (-845.094) (-845.660) [-848.175] * (-845.784) (-846.262) [-845.400] (-849.560) -- 0:00:31
      508000 -- (-846.229) (-844.874) (-845.391) [-845.095] * (-846.441) (-849.404) (-846.379) [-845.719] -- 0:00:30
      508500 -- (-846.917) (-846.503) [-846.669] (-846.002) * [-847.936] (-850.701) (-844.709) (-845.589) -- 0:00:30
      509000 -- (-845.813) (-845.076) (-846.023) [-848.775] * (-846.719) (-846.055) [-845.217] (-845.187) -- 0:00:31
      509500 -- (-845.246) (-845.389) [-845.904] (-849.457) * (-847.427) (-845.937) (-845.161) [-844.841] -- 0:00:31
      510000 -- (-847.823) (-849.160) (-847.404) [-845.435] * (-847.848) (-845.082) (-844.576) [-849.278] -- 0:00:31

      Average standard deviation of split frequencies: 0.007548

      510500 -- [-846.097] (-845.401) (-845.580) (-847.240) * (-848.913) (-844.283) [-845.849] (-846.034) -- 0:00:31
      511000 -- (-845.514) (-845.239) (-848.875) [-846.101] * (-848.426) (-844.202) [-846.163] (-844.647) -- 0:00:31
      511500 -- (-847.158) (-850.120) [-846.965] (-846.327) * (-846.545) (-848.574) (-849.786) [-846.605] -- 0:00:31
      512000 -- [-845.491] (-847.496) (-849.725) (-853.282) * [-844.576] (-846.306) (-846.309) (-844.895) -- 0:00:31
      512500 -- (-847.245) (-845.737) [-845.564] (-848.665) * (-844.588) [-846.141] (-849.056) (-845.652) -- 0:00:31
      513000 -- (-846.277) [-845.558] (-846.221) (-846.142) * (-845.816) [-847.204] (-846.385) (-847.947) -- 0:00:31
      513500 -- [-844.223] (-850.802) (-850.182) (-846.244) * (-845.312) [-846.745] (-845.980) (-845.576) -- 0:00:31
      514000 -- (-845.319) (-845.763) (-850.171) [-846.044] * (-844.955) (-846.228) [-845.797] (-847.472) -- 0:00:31
      514500 -- (-845.346) (-846.870) (-852.098) [-845.845] * (-845.979) [-846.114] (-844.736) (-844.637) -- 0:00:31
      515000 -- (-846.715) [-844.982] (-848.054) (-845.486) * (-845.401) [-845.546] (-846.102) (-844.637) -- 0:00:31

      Average standard deviation of split frequencies: 0.006932

      515500 -- [-844.624] (-847.605) (-850.671) (-845.533) * (-849.308) (-845.741) (-846.842) [-845.169] -- 0:00:31
      516000 -- (-844.616) [-846.212] (-849.196) (-847.285) * (-853.804) (-844.900) [-845.297] (-846.349) -- 0:00:30
      516500 -- (-846.275) [-846.126] (-846.187) (-844.944) * (-847.619) (-846.404) (-844.178) [-846.283] -- 0:00:30
      517000 -- (-847.310) (-847.454) (-845.628) [-845.810] * (-850.881) (-845.993) [-844.204] (-848.285) -- 0:00:30
      517500 -- (-848.375) (-847.272) (-848.727) [-845.736] * (-852.375) (-846.310) [-847.875] (-845.221) -- 0:00:30
      518000 -- (-846.735) (-844.075) [-847.012] (-845.998) * (-845.080) (-847.776) [-848.569] (-845.395) -- 0:00:30
      518500 -- (-852.580) (-848.378) [-845.353] (-845.771) * (-845.378) [-845.605] (-847.355) (-848.414) -- 0:00:30
      519000 -- (-845.975) [-848.077] (-851.885) (-846.812) * (-845.629) (-846.170) (-848.770) [-851.137] -- 0:00:30
      519500 -- (-845.246) (-847.459) [-848.533] (-847.002) * (-849.705) (-845.647) [-847.916] (-847.045) -- 0:00:30
      520000 -- [-845.316] (-848.782) (-849.290) (-845.367) * (-849.333) [-844.869] (-847.363) (-847.544) -- 0:00:30

      Average standard deviation of split frequencies: 0.007243

      520500 -- [-846.398] (-847.628) (-849.407) (-848.779) * (-844.857) [-848.678] (-847.117) (-846.068) -- 0:00:30
      521000 -- (-848.259) (-847.850) [-845.951] (-854.402) * (-849.027) (-849.816) (-845.681) [-845.959] -- 0:00:30
      521500 -- (-844.852) (-848.190) (-847.274) [-845.681] * (-847.411) (-847.447) (-851.983) [-845.294] -- 0:00:30
      522000 -- (-844.710) (-852.524) (-846.961) [-846.423] * (-847.621) (-847.086) (-845.090) [-847.736] -- 0:00:30
      522500 -- [-846.791] (-846.366) (-845.824) (-845.721) * [-845.175] (-845.072) (-845.452) (-849.867) -- 0:00:30
      523000 -- (-845.567) (-846.425) [-845.295] (-846.668) * (-848.325) [-848.432] (-844.198) (-847.346) -- 0:00:30
      523500 -- (-844.495) [-849.171] (-844.279) (-847.904) * [-848.286] (-845.757) (-845.703) (-846.293) -- 0:00:30
      524000 -- (-845.058) [-846.311] (-845.581) (-844.680) * (-846.653) (-845.691) (-846.069) [-845.354] -- 0:00:29
      524500 -- (-845.762) (-845.530) (-846.639) [-845.498] * (-845.762) (-845.224) (-848.397) [-846.791] -- 0:00:29
      525000 -- (-847.200) (-852.141) (-844.931) [-847.648] * (-845.836) (-845.830) [-845.444] (-848.724) -- 0:00:29

      Average standard deviation of split frequencies: 0.008016

      525500 -- [-848.240] (-845.106) (-844.585) (-850.382) * (-845.852) (-844.567) (-848.385) [-849.611] -- 0:00:30
      526000 -- (-846.590) (-846.782) [-847.950] (-851.940) * (-845.648) (-847.556) [-851.041] (-846.211) -- 0:00:30
      526500 -- (-844.489) (-846.286) (-851.189) [-845.963] * [-845.821] (-846.064) (-845.133) (-846.151) -- 0:00:30
      527000 -- (-848.084) (-847.436) (-849.510) [-849.063] * (-847.973) [-846.298] (-845.074) (-848.028) -- 0:00:30
      527500 -- (-846.185) (-846.540) (-849.639) [-846.132] * (-844.450) (-848.316) (-847.617) [-844.189] -- 0:00:30
      528000 -- (-847.669) [-846.047] (-846.176) (-847.002) * (-846.118) [-847.303] (-850.335) (-847.792) -- 0:00:30
      528500 -- (-845.947) (-847.075) [-849.223] (-845.767) * [-844.969] (-846.818) (-845.217) (-847.879) -- 0:00:30
      529000 -- (-845.383) [-852.338] (-845.939) (-847.155) * (-844.787) (-846.672) (-846.098) [-845.357] -- 0:00:30
      529500 -- (-846.413) (-846.466) (-847.276) [-845.470] * (-847.391) (-847.900) [-845.430] (-845.657) -- 0:00:30
      530000 -- [-845.645] (-846.191) (-847.770) (-846.044) * (-847.125) (-849.126) (-845.275) [-845.398] -- 0:00:30

      Average standard deviation of split frequencies: 0.007838

      530500 -- (-847.541) (-845.287) [-845.061] (-845.698) * [-846.272] (-844.892) (-846.217) (-845.407) -- 0:00:30
      531000 -- (-849.455) (-844.673) [-844.216] (-847.026) * (-846.019) [-844.974] (-846.949) (-848.826) -- 0:00:30
      531500 -- (-847.305) (-845.465) (-845.640) [-846.116] * [-845.028] (-844.576) (-845.719) (-847.029) -- 0:00:29
      532000 -- [-846.103] (-845.368) (-844.889) (-846.535) * (-846.948) (-846.639) [-845.417] (-844.466) -- 0:00:29
      532500 -- [-845.191] (-849.020) (-848.100) (-848.059) * (-848.361) [-845.056] (-845.109) (-844.393) -- 0:00:29
      533000 -- (-845.527) (-845.806) (-846.576) [-848.603] * [-847.379] (-846.963) (-844.919) (-848.676) -- 0:00:29
      533500 -- (-845.299) [-847.310] (-849.704) (-847.770) * (-845.298) [-845.460] (-846.608) (-845.163) -- 0:00:29
      534000 -- (-848.679) (-847.924) [-850.732] (-846.693) * (-846.856) (-846.213) (-847.733) [-845.469] -- 0:00:29
      534500 -- (-847.459) [-844.312] (-845.255) (-847.318) * (-848.470) (-845.825) (-845.936) [-844.320] -- 0:00:29
      535000 -- [-845.149] (-845.587) (-845.483) (-846.445) * (-844.719) (-848.886) (-847.216) [-847.191] -- 0:00:29

      Average standard deviation of split frequencies: 0.008019

      535500 -- (-848.205) (-850.800) (-846.801) [-844.965] * (-845.794) (-845.886) (-851.448) [-847.397] -- 0:00:29
      536000 -- (-845.472) (-845.302) [-847.189] (-847.788) * (-845.096) [-846.815] (-846.448) (-846.470) -- 0:00:29
      536500 -- [-846.032] (-848.134) (-845.178) (-848.469) * (-844.221) (-846.744) (-846.161) [-845.219] -- 0:00:29
      537000 -- [-845.464] (-846.121) (-845.697) (-849.579) * (-845.584) (-845.865) (-846.097) [-845.499] -- 0:00:29
      537500 -- (-846.593) (-846.742) [-846.475] (-849.111) * [-849.274] (-847.517) (-845.643) (-845.469) -- 0:00:29
      538000 -- (-845.480) (-847.262) (-844.687) [-845.874] * (-851.749) [-845.043] (-845.509) (-848.336) -- 0:00:29
      538500 -- (-845.804) [-844.809] (-845.117) (-844.538) * (-847.221) [-845.399] (-846.498) (-848.173) -- 0:00:29
      539000 -- (-848.468) [-848.182] (-844.700) (-847.589) * (-845.059) (-846.192) [-845.230] (-844.757) -- 0:00:29
      539500 -- (-847.582) (-852.582) [-846.320] (-846.189) * (-846.440) (-845.976) (-844.431) [-847.045] -- 0:00:29
      540000 -- (-847.166) (-846.233) (-845.365) [-845.717] * (-847.271) (-846.964) [-846.673] (-846.382) -- 0:00:28

      Average standard deviation of split frequencies: 0.008309

      540500 -- (-845.662) [-845.208] (-845.112) (-845.633) * (-844.926) (-846.725) [-846.264] (-846.662) -- 0:00:28
      541000 -- (-846.916) (-846.741) [-846.852] (-846.558) * (-846.066) [-849.331] (-844.780) (-844.696) -- 0:00:28
      541500 -- [-845.736] (-846.774) (-847.102) (-847.968) * (-846.070) (-845.453) [-846.700] (-846.560) -- 0:00:28
      542000 -- (-846.804) (-846.769) (-847.049) [-849.113] * [-846.470] (-844.616) (-848.378) (-845.386) -- 0:00:28
      542500 -- (-844.701) [-845.629] (-845.322) (-845.059) * [-846.636] (-844.767) (-847.614) (-845.888) -- 0:00:29
      543000 -- [-845.697] (-844.799) (-844.803) (-845.811) * (-846.481) (-844.643) (-848.807) [-849.170] -- 0:00:29
      543500 -- (-844.583) (-850.557) [-844.984] (-846.045) * [-846.421] (-848.657) (-848.184) (-846.124) -- 0:00:29
      544000 -- [-845.302] (-846.883) (-845.167) (-848.935) * (-847.239) [-848.189] (-850.386) (-845.055) -- 0:00:29
      544500 -- (-847.805) [-845.323] (-847.055) (-844.626) * (-844.468) [-846.901] (-846.568) (-844.884) -- 0:00:29
      545000 -- (-845.043) (-844.903) [-845.174] (-846.054) * (-845.749) [-846.833] (-846.824) (-846.486) -- 0:00:29

      Average standard deviation of split frequencies: 0.008329

      545500 -- (-845.601) [-848.119] (-845.173) (-844.700) * (-845.280) (-843.991) [-848.348] (-845.392) -- 0:00:29
      546000 -- [-845.570] (-845.662) (-846.582) (-846.917) * (-847.160) (-844.940) (-846.977) [-845.278] -- 0:00:29
      546500 -- [-846.465] (-846.426) (-845.922) (-847.411) * [-846.459] (-847.332) (-844.257) (-845.435) -- 0:00:29
      547000 -- [-845.315] (-846.628) (-845.203) (-848.366) * [-844.923] (-847.044) (-844.339) (-847.766) -- 0:00:28
      547500 -- (-845.260) (-847.394) [-846.231] (-847.019) * (-846.715) (-844.604) [-845.231] (-848.222) -- 0:00:28
      548000 -- (-845.277) (-845.875) (-844.974) [-845.372] * (-847.179) [-844.550] (-849.277) (-845.221) -- 0:00:28
      548500 -- (-847.578) (-845.998) [-845.993] (-845.493) * (-846.927) (-853.636) (-851.481) [-847.333] -- 0:00:28
      549000 -- (-849.228) [-846.229] (-847.388) (-845.146) * (-846.449) [-845.450] (-846.252) (-846.298) -- 0:00:28
      549500 -- (-848.876) [-845.466] (-845.802) (-846.282) * (-846.824) (-845.750) [-846.290] (-848.820) -- 0:00:28
      550000 -- (-848.132) [-844.520] (-845.180) (-845.168) * (-850.303) [-850.389] (-847.800) (-847.887) -- 0:00:28

      Average standard deviation of split frequencies: 0.008359

      550500 -- (-845.374) (-846.847) [-844.052] (-845.103) * (-852.122) (-846.529) [-846.695] (-848.724) -- 0:00:28
      551000 -- (-846.976) (-846.933) (-845.670) [-847.115] * [-846.981] (-846.254) (-846.427) (-845.480) -- 0:00:28
      551500 -- (-846.344) (-845.513) [-844.926] (-848.049) * (-847.348) (-848.408) (-845.613) [-847.417] -- 0:00:28
      552000 -- (-846.233) (-848.095) [-844.135] (-845.634) * (-847.351) (-847.748) (-844.762) [-846.048] -- 0:00:28
      552500 -- [-845.879] (-847.858) (-843.924) (-844.345) * [-846.021] (-846.837) (-844.322) (-844.814) -- 0:00:28
      553000 -- [-845.185] (-846.427) (-845.609) (-846.007) * [-844.812] (-845.100) (-846.876) (-844.705) -- 0:00:28
      553500 -- (-848.865) [-844.769] (-846.768) (-845.500) * (-846.200) (-848.250) (-844.461) [-845.908] -- 0:00:28
      554000 -- (-844.914) (-848.424) (-845.550) [-844.527] * (-846.212) [-844.656] (-848.206) (-845.531) -- 0:00:28
      554500 -- (-844.957) (-846.273) (-844.351) [-847.366] * (-846.048) (-849.473) [-846.291] (-847.893) -- 0:00:28
      555000 -- (-845.501) (-846.919) [-844.921] (-844.956) * (-848.146) [-847.962] (-847.034) (-847.116) -- 0:00:28

      Average standard deviation of split frequencies: 0.008778

      555500 -- (-845.736) (-845.564) (-848.135) [-846.462] * (-846.561) (-846.709) (-846.910) [-846.431] -- 0:00:28
      556000 -- (-844.121) [-846.835] (-845.262) (-849.358) * (-845.890) [-847.068] (-846.400) (-846.275) -- 0:00:27
      556500 -- (-844.097) (-845.318) (-845.453) [-845.339] * (-845.338) [-845.026] (-846.490) (-846.402) -- 0:00:27
      557000 -- [-848.412] (-846.936) (-849.959) (-844.709) * (-845.489) (-846.640) [-845.997] (-847.023) -- 0:00:27
      557500 -- (-848.941) [-844.911] (-848.234) (-849.169) * (-848.451) [-850.203] (-845.058) (-844.693) -- 0:00:27
      558000 -- (-846.013) [-845.149] (-846.472) (-846.160) * (-848.796) (-846.040) [-847.504] (-844.249) -- 0:00:27
      558500 -- [-845.524] (-844.461) (-848.928) (-846.315) * (-845.457) [-845.766] (-849.212) (-845.261) -- 0:00:27
      559000 -- [-845.536] (-845.228) (-845.672) (-850.967) * [-850.085] (-846.343) (-844.644) (-847.411) -- 0:00:28
      559500 -- (-846.675) (-844.964) (-845.796) [-845.218] * (-850.602) [-846.347] (-844.217) (-847.553) -- 0:00:28
      560000 -- (-846.589) (-845.608) (-847.148) [-846.091] * (-846.330) (-844.790) (-844.160) [-846.016] -- 0:00:28

      Average standard deviation of split frequencies: 0.008754

      560500 -- (-846.687) (-846.179) (-851.695) [-847.744] * (-848.015) (-846.036) [-844.209] (-848.436) -- 0:00:28
      561000 -- (-845.171) (-847.840) (-846.724) [-846.009] * (-845.846) (-850.289) (-848.070) [-845.495] -- 0:00:28
      561500 -- (-847.917) (-847.457) [-847.149] (-846.374) * (-846.428) (-845.795) (-850.484) [-844.346] -- 0:00:28
      562000 -- (-845.927) (-849.705) [-844.407] (-847.172) * (-845.632) [-845.544] (-848.720) (-848.613) -- 0:00:28
      562500 -- (-850.805) (-847.844) (-845.237) [-845.783] * (-845.604) (-845.924) [-849.233] (-849.916) -- 0:00:28
      563000 -- (-845.621) [-845.172] (-845.321) (-849.197) * (-846.237) (-845.016) (-846.864) [-846.135] -- 0:00:27
      563500 -- (-845.865) (-846.176) [-846.276] (-849.314) * (-845.487) [-846.763] (-844.869) (-846.660) -- 0:00:27
      564000 -- (-846.535) (-848.819) (-845.268) [-846.632] * [-845.105] (-849.310) (-845.922) (-846.361) -- 0:00:27
      564500 -- (-845.312) (-844.817) [-844.506] (-848.759) * (-844.400) (-846.881) (-845.716) [-846.151] -- 0:00:27
      565000 -- (-845.923) (-844.323) [-844.731] (-844.748) * (-844.086) [-847.616] (-846.446) (-849.713) -- 0:00:27

      Average standard deviation of split frequencies: 0.009358

      565500 -- (-846.862) [-845.641] (-845.799) (-847.908) * (-845.153) [-845.391] (-846.922) (-849.448) -- 0:00:27
      566000 -- (-844.538) (-845.319) [-846.942] (-846.455) * [-844.824] (-844.738) (-847.860) (-847.385) -- 0:00:27
      566500 -- (-847.100) (-846.892) [-847.980] (-847.091) * (-845.425) [-845.585] (-845.962) (-848.793) -- 0:00:27
      567000 -- (-844.889) (-849.210) [-845.566] (-845.083) * (-844.666) (-847.421) [-843.880] (-846.503) -- 0:00:27
      567500 -- (-845.978) (-846.146) [-844.427] (-846.138) * [-846.854] (-844.956) (-848.659) (-845.869) -- 0:00:27
      568000 -- (-847.491) [-847.961] (-847.374) (-845.462) * (-845.725) (-844.510) (-845.774) [-846.869] -- 0:00:27
      568500 -- (-845.645) [-847.256] (-845.579) (-845.528) * [-846.828] (-844.510) (-845.769) (-847.548) -- 0:00:27
      569000 -- [-846.896] (-847.222) (-845.109) (-844.388) * (-846.571) (-845.199) (-844.628) [-845.701] -- 0:00:27
      569500 -- (-848.328) (-845.417) [-845.233] (-844.771) * (-844.769) (-849.769) (-844.708) [-844.900] -- 0:00:27
      570000 -- (-846.529) [-845.659] (-848.585) (-849.954) * (-850.673) [-844.817] (-844.714) (-845.798) -- 0:00:27

      Average standard deviation of split frequencies: 0.009524

      570500 -- (-846.260) [-845.922] (-847.634) (-845.853) * (-850.306) (-844.739) (-845.133) [-844.461] -- 0:00:27
      571000 -- (-850.338) [-845.061] (-844.725) (-845.616) * (-845.961) [-846.219] (-846.314) (-846.602) -- 0:00:27
      571500 -- (-844.954) [-846.661] (-844.981) (-844.074) * (-845.863) (-845.516) [-845.597] (-844.815) -- 0:00:26
      572000 -- (-848.002) (-846.015) [-844.651] (-846.175) * (-845.953) (-846.026) (-845.197) [-844.382] -- 0:00:26
      572500 -- (-846.732) (-845.150) [-845.751] (-844.152) * (-846.046) (-846.269) [-846.918] (-847.851) -- 0:00:26
      573000 -- (-849.205) (-846.057) (-845.060) [-846.543] * (-844.979) (-848.537) [-845.975] (-846.736) -- 0:00:26
      573500 -- (-847.116) (-846.940) (-848.533) [-844.560] * (-847.262) [-849.517] (-848.846) (-845.755) -- 0:00:26
      574000 -- (-853.576) [-845.938] (-845.320) (-844.674) * (-845.589) (-847.588) [-844.737] (-846.240) -- 0:00:26
      574500 -- [-845.464] (-846.211) (-845.670) (-846.019) * (-845.571) [-845.224] (-846.059) (-845.028) -- 0:00:26
      575000 -- (-844.720) (-847.035) [-844.638] (-844.672) * [-845.093] (-849.144) (-850.301) (-845.059) -- 0:00:26

      Average standard deviation of split frequencies: 0.009388

      575500 -- (-847.275) (-846.477) (-845.373) [-846.790] * (-849.778) [-846.900] (-848.610) (-847.445) -- 0:00:27
      576000 -- (-848.618) (-845.946) [-848.697] (-846.643) * (-848.127) (-848.155) [-844.845] (-847.286) -- 0:00:27
      576500 -- (-846.950) [-845.100] (-846.096) (-848.626) * (-846.003) [-846.166] (-847.816) (-845.539) -- 0:00:27
      577000 -- (-847.585) (-844.771) (-846.660) [-850.603] * (-845.061) [-845.075] (-847.900) (-847.505) -- 0:00:27
      577500 -- (-846.115) (-844.824) (-845.854) [-845.458] * (-844.505) (-848.876) [-844.778] (-850.647) -- 0:00:27
      578000 -- (-850.634) [-845.683] (-846.334) (-845.455) * (-844.795) (-847.334) (-846.828) [-844.882] -- 0:00:27
      578500 -- (-848.537) (-846.714) [-846.144] (-845.754) * (-846.430) (-846.540) [-847.852] (-844.582) -- 0:00:26
      579000 -- (-846.536) (-849.492) [-845.499] (-848.947) * (-846.380) [-851.384] (-849.694) (-844.887) -- 0:00:26
      579500 -- [-846.129] (-846.117) (-846.118) (-844.853) * [-845.040] (-849.012) (-847.976) (-848.854) -- 0:00:26
      580000 -- (-846.223) (-846.921) [-845.206] (-844.711) * (-844.728) (-845.639) [-848.326] (-846.472) -- 0:00:26

      Average standard deviation of split frequencies: 0.008930

      580500 -- [-845.361] (-846.333) (-846.224) (-845.689) * (-844.562) (-845.445) [-846.397] (-851.542) -- 0:00:26
      581000 -- (-844.377) (-846.260) [-846.608] (-845.026) * (-844.418) [-845.584] (-845.600) (-848.671) -- 0:00:26
      581500 -- (-844.331) (-848.594) [-849.150] (-844.894) * (-844.413) [-845.173] (-846.065) (-846.013) -- 0:00:26
      582000 -- (-844.834) [-845.439] (-846.638) (-849.492) * [-844.189] (-851.387) (-847.870) (-846.994) -- 0:00:26
      582500 -- (-844.357) [-846.306] (-848.393) (-846.724) * (-845.075) [-847.409] (-856.652) (-846.345) -- 0:00:26
      583000 -- (-847.784) [-845.695] (-847.825) (-845.898) * (-848.564) [-844.563] (-847.532) (-845.089) -- 0:00:26
      583500 -- (-846.878) (-845.163) [-846.029] (-845.171) * (-848.297) (-844.125) (-845.896) [-844.826] -- 0:00:26
      584000 -- (-849.754) (-846.779) (-846.588) [-845.406] * (-847.500) (-845.407) [-844.401] (-844.827) -- 0:00:26
      584500 -- (-848.997) [-853.169] (-847.217) (-845.858) * (-846.078) (-847.072) (-848.651) [-846.032] -- 0:00:26
      585000 -- [-846.021] (-846.257) (-844.410) (-848.546) * [-846.333] (-851.493) (-846.069) (-848.074) -- 0:00:26

      Average standard deviation of split frequencies: 0.009085

      585500 -- (-849.363) [-851.331] (-845.285) (-847.512) * (-848.095) [-849.608] (-845.506) (-847.732) -- 0:00:26
      586000 -- [-846.388] (-850.502) (-846.396) (-848.966) * (-844.841) (-849.458) (-845.803) [-845.131] -- 0:00:26
      586500 -- (-851.247) (-847.006) (-845.212) [-845.344] * (-846.106) [-849.315] (-845.316) (-845.235) -- 0:00:26
      587000 -- (-847.584) (-845.737) [-844.798] (-849.349) * (-846.033) (-847.730) (-847.929) [-844.638] -- 0:00:26
      587500 -- (-845.789) (-847.533) [-844.913] (-852.414) * [-844.340] (-846.896) (-846.306) (-847.410) -- 0:00:25
      588000 -- [-846.704] (-845.180) (-844.958) (-847.443) * [-848.894] (-845.706) (-845.045) (-844.987) -- 0:00:25
      588500 -- [-845.862] (-845.397) (-846.584) (-848.896) * (-848.492) (-844.552) [-846.107] (-847.709) -- 0:00:25
      589000 -- [-850.092] (-845.060) (-848.857) (-845.541) * (-847.104) [-849.777] (-845.677) (-846.197) -- 0:00:25
      589500 -- [-846.151] (-845.638) (-846.040) (-846.776) * [-845.519] (-847.780) (-844.878) (-848.152) -- 0:00:25
      590000 -- (-844.496) (-846.989) [-845.900] (-848.004) * [-844.956] (-851.793) (-845.486) (-845.436) -- 0:00:25

      Average standard deviation of split frequencies: 0.009155

      590500 -- (-846.985) [-845.565] (-844.759) (-845.334) * (-844.249) (-847.835) (-845.811) [-846.742] -- 0:00:25
      591000 -- [-846.972] (-846.712) (-845.856) (-844.445) * (-844.673) (-845.760) (-845.010) [-846.862] -- 0:00:25
      591500 -- (-844.711) (-846.919) [-845.887] (-846.035) * (-845.340) [-845.133] (-849.116) (-844.740) -- 0:00:25
      592000 -- (-846.716) (-847.991) [-846.945] (-846.958) * [-844.530] (-847.053) (-848.768) (-849.006) -- 0:00:26
      592500 -- (-851.929) [-845.735] (-846.474) (-848.239) * (-846.037) (-845.651) (-846.497) [-847.351] -- 0:00:26
      593000 -- (-845.681) (-846.269) (-846.081) [-845.557] * [-847.162] (-847.010) (-844.870) (-845.471) -- 0:00:26
      593500 -- (-846.887) (-845.879) [-848.267] (-844.288) * [-847.510] (-845.807) (-844.764) (-844.568) -- 0:00:26
      594000 -- (-845.943) (-846.994) [-848.087] (-844.816) * (-845.288) (-846.879) (-846.577) [-845.932] -- 0:00:25
      594500 -- [-846.180] (-844.660) (-845.018) (-846.117) * (-849.034) (-845.600) (-845.338) [-845.351] -- 0:00:25
      595000 -- [-847.607] (-849.402) (-846.223) (-846.186) * (-848.303) (-845.649) [-844.379] (-846.991) -- 0:00:25

      Average standard deviation of split frequencies: 0.009026

      595500 -- (-846.579) (-846.953) (-846.284) [-846.029] * (-850.231) [-846.645] (-844.498) (-845.165) -- 0:00:25
      596000 -- (-845.121) (-848.386) [-847.408] (-845.322) * [-846.638] (-846.363) (-845.993) (-846.140) -- 0:00:25
      596500 -- (-846.635) [-845.914] (-853.070) (-845.285) * (-845.922) [-848.636] (-846.146) (-846.440) -- 0:00:25
      597000 -- (-846.741) (-847.139) (-847.890) [-845.326] * [-844.941] (-845.148) (-852.172) (-846.039) -- 0:00:25
      597500 -- (-851.285) [-846.920] (-849.880) (-848.092) * (-846.356) (-845.008) (-846.272) [-846.570] -- 0:00:25
      598000 -- (-848.369) (-845.897) (-844.504) [-845.256] * [-847.287] (-845.176) (-847.448) (-846.200) -- 0:00:25
      598500 -- (-844.905) (-847.478) [-844.757] (-846.868) * (-847.896) (-845.459) [-845.583] (-845.435) -- 0:00:25
      599000 -- [-846.664] (-849.419) (-848.996) (-846.711) * (-846.600) (-846.100) [-845.219] (-844.866) -- 0:00:25
      599500 -- (-845.808) (-851.746) (-846.085) [-850.339] * (-845.252) (-845.515) (-845.951) [-844.857] -- 0:00:25
      600000 -- (-844.560) (-847.570) (-845.519) [-845.044] * (-844.837) (-847.574) (-847.985) [-845.075] -- 0:00:25

      Average standard deviation of split frequencies: 0.009464

      600500 -- [-844.750] (-848.123) (-846.769) (-844.502) * (-845.323) (-845.484) (-848.473) [-845.830] -- 0:00:25
      601000 -- [-844.661] (-848.463) (-849.535) (-846.774) * [-845.580] (-846.500) (-846.947) (-847.003) -- 0:00:25
      601500 -- (-846.156) [-845.941] (-848.020) (-845.369) * (-847.815) (-845.252) (-846.433) [-849.083] -- 0:00:25
      602000 -- (-844.182) (-847.209) (-845.063) [-844.730] * (-845.667) [-848.904] (-844.947) (-847.567) -- 0:00:25
      602500 -- (-847.470) (-845.332) (-845.890) [-846.653] * (-846.641) [-845.245] (-848.546) (-846.260) -- 0:00:25
      603000 -- (-846.954) (-844.792) [-850.076] (-846.101) * [-846.465] (-846.310) (-847.138) (-846.005) -- 0:00:25
      603500 -- (-849.177) (-845.440) (-848.247) [-847.182] * (-846.213) [-846.518] (-847.913) (-847.332) -- 0:00:24
      604000 -- (-848.350) (-845.980) [-846.176] (-845.725) * (-846.661) (-846.527) (-845.451) [-847.861] -- 0:00:24
      604500 -- (-849.031) [-847.119] (-845.888) (-845.059) * [-846.819] (-845.134) (-845.534) (-851.243) -- 0:00:24
      605000 -- (-854.012) [-845.851] (-845.496) (-846.686) * (-846.456) (-846.347) [-845.433] (-847.225) -- 0:00:24

      Average standard deviation of split frequencies: 0.009747

      605500 -- (-849.659) (-845.268) [-844.483] (-847.219) * (-847.530) (-847.136) (-850.216) [-845.899] -- 0:00:24
      606000 -- [-847.795] (-845.214) (-846.236) (-844.440) * (-847.193) (-849.312) [-847.462] (-846.897) -- 0:00:24
      606500 -- (-845.187) (-848.296) (-845.362) [-846.321] * [-848.544] (-846.859) (-847.178) (-844.690) -- 0:00:24
      607000 -- (-849.862) [-847.420] (-851.932) (-845.480) * (-847.995) (-845.845) [-846.760] (-844.227) -- 0:00:24
      607500 -- (-844.599) (-846.876) [-845.561] (-850.641) * (-845.739) (-845.703) (-846.472) [-844.110] -- 0:00:24
      608000 -- (-845.741) (-846.296) (-845.645) [-845.483] * (-846.590) (-845.441) [-845.920] (-844.447) -- 0:00:25
      608500 -- (-844.994) [-846.241] (-844.289) (-847.266) * (-850.458) (-847.164) [-845.092] (-846.717) -- 0:00:25
      609000 -- (-846.203) (-844.540) (-844.223) [-846.016] * (-844.121) (-847.240) [-847.936] (-849.640) -- 0:00:25
      609500 -- (-844.710) [-844.766] (-847.210) (-847.284) * (-845.797) (-845.237) [-846.741] (-846.092) -- 0:00:24
      610000 -- [-845.534] (-845.609) (-847.427) (-846.167) * (-845.761) (-848.344) (-849.175) [-846.428] -- 0:00:24

      Average standard deviation of split frequencies: 0.009445

      610500 -- (-847.870) (-846.283) [-847.003] (-846.683) * (-845.256) (-846.070) (-848.134) [-847.287] -- 0:00:24
      611000 -- (-844.719) [-845.252] (-847.338) (-849.174) * [-845.462] (-844.511) (-850.059) (-850.531) -- 0:00:24
      611500 -- (-844.706) [-846.515] (-847.262) (-844.947) * (-845.587) [-846.049] (-845.574) (-846.541) -- 0:00:24
      612000 -- (-846.111) (-846.283) (-848.960) [-845.253] * (-847.141) [-844.863] (-846.365) (-846.823) -- 0:00:24
      612500 -- (-844.647) (-847.289) (-850.339) [-844.946] * (-846.964) [-845.631] (-845.986) (-848.133) -- 0:00:24
      613000 -- [-846.660] (-847.257) (-846.230) (-846.071) * (-844.674) (-844.529) [-845.465] (-849.662) -- 0:00:24
      613500 -- (-846.146) (-845.635) (-845.241) [-845.409] * (-847.522) (-844.531) [-845.655] (-850.895) -- 0:00:24
      614000 -- (-848.693) [-845.516] (-844.567) (-845.351) * [-845.715] (-845.842) (-845.279) (-847.780) -- 0:00:24
      614500 -- (-846.322) [-844.906] (-846.356) (-848.639) * [-844.249] (-846.254) (-846.230) (-850.263) -- 0:00:24
      615000 -- [-848.523] (-846.768) (-844.448) (-847.191) * (-845.293) (-854.844) (-855.291) [-849.040] -- 0:00:24

      Average standard deviation of split frequencies: 0.009408

      615500 -- (-848.853) (-845.408) (-845.181) [-844.814] * [-845.187] (-844.385) (-848.697) (-852.302) -- 0:00:24
      616000 -- (-847.709) (-847.180) [-847.918] (-845.635) * (-846.314) (-844.451) (-845.411) [-849.146] -- 0:00:24
      616500 -- (-849.124) (-849.603) (-845.462) [-847.322] * [-848.825] (-845.587) (-847.534) (-850.518) -- 0:00:24
      617000 -- (-846.531) [-846.723] (-847.428) (-848.526) * (-847.638) (-848.686) (-849.270) [-844.212] -- 0:00:24
      617500 -- [-847.564] (-847.245) (-846.788) (-846.340) * (-847.701) (-844.532) (-849.544) [-845.558] -- 0:00:24
      618000 -- (-846.820) (-846.205) [-846.157] (-847.384) * (-844.783) (-845.876) (-844.559) [-846.033] -- 0:00:24
      618500 -- [-846.065] (-850.360) (-844.820) (-847.542) * (-846.521) (-846.123) [-845.056] (-844.835) -- 0:00:24
      619000 -- [-847.970] (-847.006) (-848.961) (-849.017) * (-844.437) [-846.739] (-846.016) (-845.594) -- 0:00:24
      619500 -- (-846.134) (-847.163) (-845.073) [-844.615] * (-844.875) (-847.383) [-848.703] (-845.860) -- 0:00:23
      620000 -- (-845.311) [-845.534] (-848.821) (-844.618) * [-844.174] (-850.096) (-849.632) (-844.520) -- 0:00:23

      Average standard deviation of split frequencies: 0.009069

      620500 -- (-845.557) (-847.287) [-844.218] (-845.698) * (-846.236) (-844.807) [-844.995] (-845.391) -- 0:00:23
      621000 -- (-845.604) [-848.879] (-844.354) (-845.841) * [-846.137] (-846.368) (-845.137) (-846.413) -- 0:00:24
      621500 -- [-844.362] (-850.994) (-847.462) (-845.536) * [-845.984] (-849.033) (-846.173) (-847.652) -- 0:00:24
      622000 -- [-844.285] (-848.850) (-849.774) (-845.513) * (-845.007) (-855.723) [-844.558] (-845.651) -- 0:00:24
      622500 -- (-845.444) (-849.220) [-844.687] (-846.828) * (-844.125) [-847.544] (-844.095) (-846.224) -- 0:00:24
      623000 -- [-848.291] (-844.746) (-849.118) (-846.212) * (-849.556) (-847.942) (-848.537) [-845.953] -- 0:00:24
      623500 -- (-847.396) (-846.302) [-844.599] (-848.912) * (-846.570) (-847.243) (-850.778) [-846.397] -- 0:00:24
      624000 -- (-848.807) (-847.801) [-844.297] (-843.826) * [-844.417] (-845.015) (-844.372) (-847.285) -- 0:00:24
      624500 -- [-845.759] (-846.885) (-844.533) (-846.453) * (-847.043) (-846.517) [-848.255] (-848.461) -- 0:00:24
      625000 -- [-847.086] (-846.414) (-844.861) (-845.907) * [-845.874] (-845.047) (-845.120) (-846.466) -- 0:00:24

      Average standard deviation of split frequencies: 0.008859

      625500 -- (-849.447) [-846.800] (-844.798) (-845.839) * (-847.924) (-846.296) (-846.065) [-844.365] -- 0:00:23
      626000 -- (-848.076) (-846.508) [-845.320] (-850.039) * (-845.340) [-844.294] (-845.362) (-844.611) -- 0:00:23
      626500 -- [-846.494] (-844.725) (-844.659) (-844.989) * [-846.902] (-846.295) (-845.660) (-844.736) -- 0:00:23
      627000 -- (-845.630) [-850.969] (-844.657) (-844.546) * (-845.517) (-846.707) (-846.713) [-845.704] -- 0:00:23
      627500 -- (-848.769) [-845.622] (-844.877) (-846.128) * [-844.551] (-845.596) (-851.020) (-847.888) -- 0:00:23
      628000 -- [-846.630] (-846.385) (-847.495) (-847.815) * [-845.429] (-845.362) (-846.417) (-845.123) -- 0:00:23
      628500 -- (-846.924) [-845.365] (-844.312) (-845.161) * (-845.866) (-849.993) (-845.041) [-845.551] -- 0:00:23
      629000 -- (-845.462) (-845.300) (-848.188) [-844.776] * (-845.659) [-845.846] (-847.325) (-849.179) -- 0:00:23
      629500 -- (-848.202) (-851.857) [-844.353] (-845.102) * (-849.220) [-845.256] (-847.849) (-845.836) -- 0:00:23
      630000 -- (-846.582) [-845.811] (-845.017) (-844.876) * [-845.925] (-845.443) (-850.701) (-846.118) -- 0:00:23

      Average standard deviation of split frequencies: 0.008794

      630500 -- (-847.934) (-845.049) (-845.107) [-844.395] * [-844.779] (-847.467) (-846.730) (-846.984) -- 0:00:23
      631000 -- (-847.328) [-847.354] (-844.368) (-844.654) * (-846.463) (-846.243) [-847.130] (-845.704) -- 0:00:23
      631500 -- (-845.661) (-844.626) (-845.017) [-844.556] * [-844.384] (-847.323) (-846.841) (-845.635) -- 0:00:23
      632000 -- [-849.205] (-844.853) (-846.154) (-844.501) * (-845.241) (-849.779) [-845.209] (-845.662) -- 0:00:23
      632500 -- (-847.002) (-845.479) [-845.218] (-847.447) * [-846.430] (-844.801) (-846.796) (-848.492) -- 0:00:23
      633000 -- (-848.507) (-845.392) [-844.122] (-845.788) * (-845.557) (-844.439) [-849.692] (-846.814) -- 0:00:23
      633500 -- [-846.626] (-845.411) (-845.300) (-846.057) * (-847.361) (-844.442) (-850.463) [-848.742] -- 0:00:23
      634000 -- [-846.286] (-846.024) (-846.458) (-850.053) * [-845.034] (-844.972) (-847.749) (-847.510) -- 0:00:23
      634500 -- (-844.618) [-845.046] (-847.907) (-848.279) * (-844.297) (-847.027) [-847.806] (-845.809) -- 0:00:23
      635000 -- (-845.211) (-848.688) (-847.604) [-845.189] * (-845.345) (-845.749) (-846.438) [-847.264] -- 0:00:22

      Average standard deviation of split frequencies: 0.008415

      635500 -- (-848.083) (-845.565) (-847.915) [-845.379] * [-844.668] (-847.153) (-848.646) (-846.113) -- 0:00:22
      636000 -- (-846.310) (-845.228) (-846.366) [-845.137] * [-845.809] (-844.848) (-846.942) (-846.317) -- 0:00:22
      636500 -- (-846.413) (-844.328) [-847.975] (-845.468) * (-847.124) (-847.915) [-845.945] (-849.028) -- 0:00:23
      637000 -- [-847.007] (-846.204) (-846.907) (-845.623) * (-847.879) (-844.851) (-847.198) [-846.409] -- 0:00:23
      637500 -- (-847.433) (-848.771) (-846.612) [-847.197] * [-848.469] (-844.689) (-846.364) (-847.171) -- 0:00:23
      638000 -- (-845.514) [-845.936] (-844.147) (-844.949) * (-847.925) (-846.815) [-846.504] (-846.563) -- 0:00:23
      638500 -- (-847.171) (-845.272) [-845.586] (-846.977) * [-848.162] (-847.838) (-846.597) (-845.763) -- 0:00:23
      639000 -- (-845.684) [-845.669] (-844.063) (-846.277) * (-850.629) [-846.380] (-844.713) (-847.646) -- 0:00:23
      639500 -- (-845.257) (-844.983) (-845.972) [-847.593] * [-846.586] (-846.565) (-846.426) (-847.480) -- 0:00:23
      640000 -- [-845.556] (-845.267) (-845.119) (-846.589) * (-850.190) (-846.070) [-845.520] (-847.429) -- 0:00:23

      Average standard deviation of split frequencies: 0.008224

      640500 -- (-845.709) (-845.842) (-847.322) [-845.098] * [-844.718] (-851.219) (-845.493) (-857.297) -- 0:00:23
      641000 -- [-845.743] (-845.646) (-848.084) (-845.481) * (-845.291) (-845.182) (-846.497) [-851.187] -- 0:00:22
      641500 -- (-844.849) (-849.358) (-848.314) [-848.688] * (-846.656) [-844.578] (-846.152) (-845.887) -- 0:00:22
      642000 -- (-845.647) [-849.506] (-844.954) (-845.083) * (-851.179) [-848.756] (-848.865) (-844.044) -- 0:00:22
      642500 -- (-844.404) (-847.392) [-847.099] (-845.193) * (-846.616) (-847.214) (-844.746) [-846.483] -- 0:00:22
      643000 -- (-844.735) (-846.326) (-846.385) [-846.202] * (-845.639) [-845.436] (-847.935) (-845.564) -- 0:00:22
      643500 -- (-844.201) (-846.113) [-844.467] (-846.091) * (-845.989) (-848.835) (-848.754) [-845.167] -- 0:00:22
      644000 -- (-846.180) (-848.274) (-844.805) [-845.161] * (-849.840) (-849.479) (-846.686) [-845.568] -- 0:00:22
      644500 -- (-849.903) [-845.035] (-844.309) (-847.691) * (-848.050) [-849.282] (-849.443) (-847.049) -- 0:00:22
      645000 -- (-850.680) [-848.232] (-845.154) (-845.350) * (-846.231) (-847.929) [-845.786] (-846.086) -- 0:00:22

      Average standard deviation of split frequencies: 0.008199

      645500 -- (-848.134) (-844.703) (-845.017) [-847.565] * (-845.938) [-847.767] (-847.279) (-850.099) -- 0:00:22
      646000 -- (-845.224) (-845.339) [-844.893] (-845.562) * (-845.843) (-848.317) [-846.157] (-847.819) -- 0:00:22
      646500 -- [-844.782] (-847.578) (-847.284) (-844.141) * (-846.111) (-847.321) [-849.559] (-849.478) -- 0:00:22
      647000 -- [-845.333] (-846.896) (-849.425) (-846.705) * [-847.146] (-849.099) (-848.134) (-848.097) -- 0:00:22
      647500 -- (-847.273) [-847.638] (-849.092) (-844.290) * [-846.766] (-845.904) (-848.102) (-845.274) -- 0:00:22
      648000 -- (-844.552) (-850.257) (-847.042) [-845.530] * (-845.963) (-845.730) [-845.667] (-846.577) -- 0:00:22
      648500 -- (-844.680) [-847.144] (-846.220) (-852.454) * (-846.370) (-849.617) (-850.685) [-844.474] -- 0:00:22
      649000 -- (-844.464) [-845.102] (-850.281) (-845.603) * (-844.315) (-850.230) (-850.568) [-844.256] -- 0:00:22
      649500 -- (-845.864) [-844.395] (-845.104) (-845.095) * (-846.646) [-845.945] (-845.664) (-845.228) -- 0:00:22
      650000 -- (-844.487) (-846.536) [-844.829] (-846.539) * (-847.634) (-849.459) [-847.108] (-845.346) -- 0:00:22

      Average standard deviation of split frequencies: 0.008268

      650500 -- (-851.502) (-844.310) (-848.698) [-845.516] * (-845.358) (-845.215) [-845.339] (-852.449) -- 0:00:22
      651000 -- [-845.838] (-845.933) (-850.349) (-847.142) * (-846.502) [-847.627] (-847.456) (-845.807) -- 0:00:21
      651500 -- (-847.854) (-846.453) [-846.905] (-852.274) * (-844.563) (-848.305) [-844.383] (-845.813) -- 0:00:22
      652000 -- (-847.575) (-845.913) (-845.207) [-846.056] * (-845.155) (-846.720) [-847.351] (-845.773) -- 0:00:22
      652500 -- (-850.871) (-844.428) [-848.692] (-845.134) * [-845.878] (-847.681) (-848.119) (-847.286) -- 0:00:22
      653000 -- (-845.314) (-845.640) [-845.430] (-844.861) * (-845.166) (-845.519) (-847.187) [-845.170] -- 0:00:22
      653500 -- (-847.229) [-844.237] (-846.259) (-845.496) * (-846.272) (-845.067) [-845.482] (-844.372) -- 0:00:22
      654000 -- (-845.623) (-846.178) [-850.607] (-847.116) * (-845.662) (-846.224) [-846.216] (-844.414) -- 0:00:22
      654500 -- (-844.378) (-844.515) (-849.737) [-848.400] * [-845.509] (-846.010) (-844.934) (-845.252) -- 0:00:22
      655000 -- [-846.550] (-848.097) (-845.424) (-846.296) * [-845.464] (-845.518) (-846.290) (-846.197) -- 0:00:22

      Average standard deviation of split frequencies: 0.008496

      655500 -- [-847.905] (-850.601) (-845.890) (-848.234) * (-848.156) [-845.354] (-847.926) (-846.242) -- 0:00:22
      656000 -- (-847.649) [-846.762] (-849.594) (-851.190) * (-847.361) (-845.331) [-848.663] (-844.569) -- 0:00:22
      656500 -- (-845.327) (-846.220) [-845.870] (-845.707) * (-846.624) (-845.084) (-846.393) [-845.311] -- 0:00:21
      657000 -- (-844.878) (-847.356) (-851.562) [-844.883] * (-847.826) (-846.733) (-844.372) [-846.030] -- 0:00:21
      657500 -- (-846.442) (-845.787) [-846.483] (-848.944) * (-846.488) [-846.383] (-845.729) (-849.150) -- 0:00:21
      658000 -- (-851.227) [-844.622] (-847.082) (-854.650) * (-846.623) (-845.490) [-845.623] (-845.467) -- 0:00:21
      658500 -- (-845.875) (-846.290) [-846.070] (-846.219) * (-846.961) [-846.291] (-848.467) (-854.480) -- 0:00:21
      659000 -- (-849.482) (-847.560) (-848.181) [-846.418] * (-846.182) [-848.332] (-846.056) (-844.539) -- 0:00:21
      659500 -- (-850.714) (-845.394) (-845.736) [-847.231] * (-846.720) (-845.842) (-844.819) [-844.008] -- 0:00:21
      660000 -- (-846.073) (-844.819) [-845.376] (-846.885) * [-846.335] (-846.424) (-845.585) (-849.131) -- 0:00:21

      Average standard deviation of split frequencies: 0.008394

      660500 -- [-845.305] (-846.251) (-844.752) (-844.432) * (-845.439) (-845.713) [-845.879] (-846.031) -- 0:00:21
      661000 -- (-844.926) (-846.841) (-846.911) [-844.657] * (-844.999) [-848.850] (-844.719) (-845.296) -- 0:00:21
      661500 -- [-843.920] (-848.607) (-848.949) (-844.332) * (-844.472) (-851.743) [-845.221] (-845.940) -- 0:00:21
      662000 -- (-843.921) [-847.307] (-848.618) (-845.051) * (-845.167) [-846.030] (-845.354) (-845.025) -- 0:00:21
      662500 -- (-845.789) [-845.777] (-844.955) (-846.686) * [-844.412] (-847.191) (-844.921) (-844.971) -- 0:00:21
      663000 -- (-846.909) [-847.466] (-850.031) (-846.886) * (-844.179) (-846.901) (-844.958) [-846.736] -- 0:00:21
      663500 -- (-845.611) [-846.843] (-847.381) (-845.937) * (-846.789) [-848.067] (-847.981) (-847.701) -- 0:00:21
      664000 -- [-844.618] (-849.682) (-845.955) (-851.954) * [-846.116] (-845.889) (-844.972) (-846.278) -- 0:00:21
      664500 -- [-846.177] (-847.975) (-845.365) (-845.069) * (-846.671) (-846.230) [-845.331] (-846.492) -- 0:00:21
      665000 -- [-845.917] (-846.676) (-849.502) (-844.037) * (-844.729) (-844.984) [-847.930] (-846.012) -- 0:00:21

      Average standard deviation of split frequencies: 0.008036

      665500 -- (-846.514) [-848.100] (-846.610) (-844.192) * (-851.420) (-844.967) [-848.279] (-846.413) -- 0:00:21
      666000 -- [-846.740] (-848.938) (-850.080) (-848.376) * (-844.937) (-844.199) (-845.591) [-844.711] -- 0:00:21
      666500 -- (-846.884) (-847.533) [-848.063] (-844.492) * (-847.505) [-845.132] (-847.289) (-846.119) -- 0:00:21
      667000 -- [-844.064] (-845.861) (-845.893) (-847.458) * (-847.907) [-846.858] (-844.833) (-846.177) -- 0:00:20
      667500 -- (-846.157) [-844.465] (-847.088) (-844.770) * (-845.800) (-846.019) (-847.705) [-845.868] -- 0:00:21
      668000 -- [-845.204] (-845.055) (-846.276) (-848.091) * (-845.857) (-850.140) [-844.260] (-846.169) -- 0:00:21
      668500 -- (-844.901) [-845.681] (-845.979) (-847.440) * (-846.000) (-847.415) [-845.570] (-847.736) -- 0:00:21
      669000 -- (-847.314) [-844.927] (-845.864) (-845.728) * [-844.948] (-850.726) (-848.598) (-846.262) -- 0:00:21
      669500 -- (-846.669) (-844.908) (-847.136) [-846.191] * (-846.856) (-848.889) [-846.517] (-844.837) -- 0:00:21
      670000 -- (-846.591) [-846.159] (-844.866) (-848.735) * [-844.931] (-848.734) (-848.329) (-846.451) -- 0:00:21

      Average standard deviation of split frequencies: 0.007608

      670500 -- (-851.321) [-846.420] (-846.528) (-849.106) * (-844.556) [-847.942] (-847.985) (-846.677) -- 0:00:21
      671000 -- (-847.877) (-847.262) (-844.722) [-848.143] * (-845.584) [-844.213] (-845.977) (-848.324) -- 0:00:21
      671500 -- (-845.600) (-850.534) [-845.791] (-848.702) * [-845.377] (-846.585) (-846.416) (-847.489) -- 0:00:21
      672000 -- [-845.395] (-849.256) (-846.267) (-845.162) * (-846.797) (-844.883) (-847.541) [-847.357] -- 0:00:20
      672500 -- (-845.781) [-849.241] (-844.501) (-844.623) * [-847.736] (-846.226) (-846.033) (-848.231) -- 0:00:20
      673000 -- (-846.033) (-848.940) [-844.872] (-844.625) * (-845.038) [-845.106] (-847.084) (-849.624) -- 0:00:20
      673500 -- (-849.492) (-853.745) [-845.856] (-848.396) * [-845.549] (-845.841) (-848.823) (-846.452) -- 0:00:20
      674000 -- (-848.872) [-847.894] (-844.894) (-844.264) * (-847.004) (-845.564) [-846.732] (-848.613) -- 0:00:20
      674500 -- (-846.200) [-845.175] (-845.128) (-847.936) * (-851.966) (-845.173) [-848.008] (-846.191) -- 0:00:20
      675000 -- (-845.252) (-845.235) (-849.788) [-846.654] * (-854.340) [-844.954] (-845.321) (-845.467) -- 0:00:20

      Average standard deviation of split frequencies: 0.007235

      675500 -- (-846.585) [-845.036] (-845.935) (-848.963) * (-847.899) [-846.694] (-845.473) (-845.248) -- 0:00:20
      676000 -- [-847.363] (-846.110) (-847.134) (-849.212) * (-845.321) (-849.174) (-846.388) [-847.335] -- 0:00:20
      676500 -- (-845.007) (-846.420) (-845.917) [-848.793] * [-846.549] (-848.892) (-849.227) (-846.852) -- 0:00:20
      677000 -- [-845.026] (-847.123) (-846.965) (-848.399) * (-845.034) (-849.118) (-848.603) [-848.273] -- 0:00:20
      677500 -- [-845.630] (-846.843) (-846.965) (-845.916) * (-846.924) (-846.917) (-846.845) [-846.307] -- 0:00:20
      678000 -- [-844.636] (-847.257) (-846.666) (-844.951) * [-845.131] (-846.290) (-846.496) (-845.253) -- 0:00:20
      678500 -- (-845.101) (-848.798) (-848.153) [-844.749] * (-845.025) [-847.394] (-847.222) (-844.825) -- 0:00:20
      679000 -- (-848.887) (-849.833) (-846.151) [-845.042] * (-846.512) [-845.612] (-846.572) (-845.173) -- 0:00:20
      679500 -- (-845.617) (-845.394) [-845.949] (-844.581) * (-844.649) [-846.939] (-847.857) (-846.649) -- 0:00:20
      680000 -- (-846.233) (-845.747) [-850.158] (-845.809) * [-847.240] (-845.375) (-844.712) (-847.950) -- 0:00:20

      Average standard deviation of split frequencies: 0.006752

      680500 -- [-845.497] (-845.453) (-847.903) (-845.128) * (-846.960) (-847.212) (-849.485) [-845.282] -- 0:00:20
      681000 -- (-846.342) (-847.232) (-845.212) [-848.528] * (-847.959) (-851.343) [-845.600] (-846.038) -- 0:00:20
      681500 -- (-848.891) (-846.436) [-844.571] (-845.119) * [-844.320] (-845.931) (-844.739) (-851.344) -- 0:00:20
      682000 -- (-850.985) [-845.487] (-845.667) (-845.686) * (-848.945) [-846.283] (-846.371) (-848.448) -- 0:00:20
      682500 -- (-850.866) (-845.802) [-847.501] (-845.992) * (-847.175) (-849.375) [-846.049] (-849.493) -- 0:00:20
      683000 -- (-848.535) (-846.665) (-847.100) [-845.970] * (-846.108) (-846.431) [-844.648] (-845.552) -- 0:00:19
      683500 -- (-848.467) (-845.174) [-846.525] (-845.154) * (-847.758) (-845.982) [-847.602] (-845.085) -- 0:00:19
      684000 -- (-849.787) (-845.782) (-850.318) [-844.954] * (-845.146) [-845.699] (-847.414) (-844.664) -- 0:00:19
      684500 -- (-848.624) (-845.608) (-846.716) [-846.753] * [-847.577] (-848.861) (-846.266) (-845.775) -- 0:00:20
      685000 -- (-847.093) [-844.963] (-845.134) (-846.892) * (-849.055) [-848.943] (-847.466) (-845.174) -- 0:00:20

      Average standard deviation of split frequencies: 0.006700

      685500 -- [-846.312] (-846.237) (-846.452) (-845.298) * (-849.447) [-845.872] (-847.703) (-845.160) -- 0:00:20
      686000 -- (-845.348) [-846.948] (-846.781) (-847.55