--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:41:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0455/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -845.52 -849.49
2 -845.56 -848.38
--------------------------------------
TOTAL -845.54 -849.08
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900121 0.089120 0.359665 1.475860 0.869149 1473.58 1487.29 1.000
r(A<->C){all} 0.167782 0.020520 0.000033 0.456448 0.130462 149.23 184.53 1.000
r(A<->G){all} 0.178181 0.021186 0.000036 0.470541 0.141499 230.20 285.00 1.000
r(A<->T){all} 0.175981 0.019392 0.000030 0.455720 0.143948 302.12 330.15 1.000
r(C<->G){all} 0.166109 0.020683 0.000012 0.463239 0.125918 270.92 356.16 1.000
r(C<->T){all} 0.158917 0.018986 0.000027 0.433663 0.122279 145.17 256.39 1.000
r(G<->T){all} 0.153030 0.016560 0.000030 0.412610 0.118047 364.27 380.13 1.003
pi(A){all} 0.225509 0.000264 0.193683 0.256828 0.225400 1286.56 1315.06 1.000
pi(C){all} 0.299195 0.000341 0.263526 0.335646 0.298778 1281.16 1289.03 1.000
pi(G){all} 0.295996 0.000336 0.258719 0.330793 0.296094 1377.90 1396.63 1.000
pi(T){all} 0.179301 0.000232 0.149964 0.207750 0.179081 1343.71 1343.90 1.000
alpha{1,2} 0.418100 0.236144 0.000297 1.404564 0.237022 1287.71 1356.36 1.000
alpha{3} 0.449958 0.243625 0.000176 1.423558 0.285643 1070.14 1269.28 1.000
pinvar{all} 0.997468 0.000010 0.991795 1.000000 0.998452 1367.63 1434.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -813.113299
Model 2: PositiveSelection -813.113299
Model 0: one-ratio -813.113639
Model 7: beta -813.113299
Model 8: beta&w>1 -813.113527
Model 0 vs 1 6.800000001021544E-4
Model 2 vs 1 0.0
Model 8 vs 7 4.5599999998557905E-4
>C1
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C2
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C3
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C4
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C5
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C6
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=206
C1 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C2 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C3 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C4 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C5 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C6 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
**************************************************
C1 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C2 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C3 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C4 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C5 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C6 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
**************************************************
C1 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C2 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C3 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C4 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C5 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C6 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
**************************************************
C1 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C2 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C3 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C4 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C5 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C6 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
**************************************************
C1 DAERSL
C2 DAERSL
C3 DAERSL
C4 DAERSL
C5 DAERSL
C6 DAERSL
******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6180]--->[6180]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.482 Mb, Max= 30.750 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C2 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C3 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C4 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C5 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
C6 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
**************************************************
C1 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C2 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C3 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C4 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C5 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
C6 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
**************************************************
C1 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C2 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C3 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C4 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C5 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
C6 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
**************************************************
C1 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C2 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C3 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C4 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C5 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
C6 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
**************************************************
C1 DAERSL
C2 DAERSL
C3 DAERSL
C4 DAERSL
C5 DAERSL
C6 DAERSL
******
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C2 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C3 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C4 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C5 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
C6 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
**************************************************
C1 CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C2 CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C3 CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C4 CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C5 CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
C6 CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
**************************************************
C1 CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C2 CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C3 CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C4 CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C5 CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
C6 CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
**************************************************
C1 TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C2 TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C3 TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C4 TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C5 TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
C6 TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
**************************************************
C1 CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C2 CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C3 CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C4 CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C5 CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
C6 CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
**************************************************
C1 ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C2 ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C3 ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C4 ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C5 ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
C6 ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
**************************************************
C1 GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C2 GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C3 GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C4 GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C5 GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
C6 GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
**************************************************
C1 TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C2 TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C3 TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C4 TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C5 TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
C6 TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
**************************************************
C1 ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C2 ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C3 ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C4 ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C5 ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
C6 ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
**************************************************
C1 CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C2 CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C3 CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C4 CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C5 CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
C6 CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
**************************************************
C1 CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C2 CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C3 CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C4 CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C5 CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
C6 CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
**************************************************
C1 AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C2 AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C3 AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C4 AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C5 AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
C6 AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
**************************************************
C1 GATGCAGAGCGAAGCTTA
C2 GATGCAGAGCGAAGCTTA
C3 GATGCAGAGCGAAGCTTA
C4 GATGCAGAGCGAAGCTTA
C5 GATGCAGAGCGAAGCTTA
C6 GATGCAGAGCGAAGCTTA
******************
>C1
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C2
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C3
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C4
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C5
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C6
GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC
CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA
CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC
TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA
CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT
ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC
GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC
TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA
ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC
CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC
CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC
AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC
GATGCAGAGCGAAGCTTA
>C1
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C2
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C3
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C4
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C5
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
>C6
VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
DAERSL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 618 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579801233
Setting output file names to "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1286797094
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1869557754
Seed = 1626093861
Swapseed = 1579801233
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1383.113419 -- -24.965149
Chain 2 -- -1383.113630 -- -24.965149
Chain 3 -- -1383.113630 -- -24.965149
Chain 4 -- -1383.113630 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1383.113419 -- -24.965149
Chain 2 -- -1383.113630 -- -24.965149
Chain 3 -- -1383.113630 -- -24.965149
Chain 4 -- -1383.113419 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1383.113] (-1383.114) (-1383.114) (-1383.114) * [-1383.113] (-1383.114) (-1383.114) (-1383.113)
500 -- (-860.899) (-856.736) (-865.061) [-861.992] * [-853.548] (-872.665) (-856.860) (-855.187) -- 0:00:00
1000 -- [-852.002] (-859.722) (-856.461) (-865.527) * (-855.562) [-855.819] (-858.470) (-861.148) -- 0:00:00
1500 -- (-853.377) [-857.195] (-857.686) (-857.004) * [-852.089] (-858.782) (-859.930) (-855.801) -- 0:00:00
2000 -- (-864.287) (-858.741) (-857.660) [-854.646] * (-852.874) (-856.490) [-855.574] (-862.711) -- 0:00:00
2500 -- (-853.329) [-853.072] (-857.485) (-855.804) * [-851.178] (-861.735) (-849.826) (-858.201) -- 0:00:00
3000 -- (-849.720) (-853.635) [-853.783] (-849.240) * (-855.955) [-853.608] (-861.517) (-857.663) -- 0:00:00
3500 -- [-855.354] (-858.924) (-864.938) (-865.541) * (-853.384) [-852.457] (-860.126) (-851.512) -- 0:00:00
4000 -- (-857.737) (-851.827) [-855.658] (-854.221) * [-852.000] (-855.296) (-852.758) (-857.103) -- 0:00:00
4500 -- (-857.102) [-856.109] (-852.767) (-856.357) * (-855.750) (-855.088) (-856.940) [-852.840] -- 0:00:00
5000 -- (-857.715) [-848.639] (-862.607) (-856.376) * (-860.678) [-854.550] (-856.436) (-849.549) -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-850.550) [-861.996] (-860.338) (-855.868) * (-855.261) (-848.631) (-854.225) [-851.323] -- 0:03:00
6000 -- (-861.168) (-848.376) [-852.650] (-852.726) * (-862.770) (-851.429) (-849.989) [-853.334] -- 0:02:45
6500 -- (-851.635) [-849.738] (-859.633) (-857.616) * (-849.911) (-858.469) (-860.207) [-852.374] -- 0:02:32
7000 -- (-859.486) (-857.481) [-850.903] (-850.352) * [-850.692] (-854.208) (-857.528) (-855.298) -- 0:02:21
7500 -- [-854.076] (-853.705) (-856.658) (-860.455) * (-862.967) (-859.707) [-850.866] (-860.883) -- 0:02:12
8000 -- (-852.360) (-850.347) [-862.797] (-854.216) * (-852.733) (-851.806) [-855.139] (-850.497) -- 0:02:04
8500 -- [-851.731] (-852.922) (-859.185) (-860.319) * (-852.018) [-857.826] (-858.997) (-860.192) -- 0:01:56
9000 -- (-862.204) [-851.730] (-868.495) (-857.306) * (-858.403) (-861.345) (-852.587) [-850.208] -- 0:01:50
9500 -- (-859.186) (-854.629) [-853.367] (-871.171) * (-855.245) (-860.856) (-853.757) [-852.616] -- 0:01:44
10000 -- (-844.276) (-859.577) (-845.361) [-848.617] * (-857.048) [-859.495] (-857.126) (-869.491) -- 0:01:39
Average standard deviation of split frequencies: 0.072106
10500 -- (-846.299) (-857.424) (-846.252) [-846.307] * [-859.335] (-855.775) (-857.519) (-857.087) -- 0:01:34
11000 -- [-846.620] (-853.307) (-848.740) (-846.767) * (-849.384) [-852.944] (-859.123) (-853.410) -- 0:01:29
11500 -- (-845.118) (-858.451) [-845.968] (-846.150) * (-862.746) [-858.193] (-858.271) (-857.776) -- 0:01:25
12000 -- (-845.374) [-855.440] (-846.669) (-846.269) * (-855.960) (-859.143) (-854.651) [-852.848] -- 0:01:22
12500 -- [-845.034] (-857.913) (-847.477) (-847.837) * (-856.828) [-854.629] (-854.284) (-857.929) -- 0:01:19
13000 -- [-845.973] (-852.679) (-847.340) (-844.280) * (-861.785) (-844.834) [-858.580] (-850.821) -- 0:01:15
13500 -- (-844.451) (-851.202) (-844.814) [-844.446] * (-853.765) (-845.645) [-852.555] (-853.549) -- 0:01:13
14000 -- (-846.750) (-856.904) [-844.506] (-845.386) * (-854.711) (-844.992) [-857.995] (-858.644) -- 0:01:10
14500 -- (-849.166) [-862.490] (-846.797) (-845.043) * [-851.768] (-846.703) (-854.296) (-857.580) -- 0:01:07
15000 -- [-847.710] (-857.094) (-845.814) (-844.874) * (-856.661) (-845.571) (-862.004) [-853.679] -- 0:01:05
Average standard deviation of split frequencies: 0.053401
15500 -- (-846.153) (-851.177) (-850.460) [-847.982] * (-850.845) [-845.726] (-864.081) (-858.038) -- 0:01:03
16000 -- (-845.942) (-853.548) [-847.684] (-846.513) * (-858.609) [-845.542] (-851.954) (-856.591) -- 0:01:01
16500 -- (-849.402) (-862.666) (-849.126) [-847.469] * (-854.114) [-846.124] (-853.165) (-853.378) -- 0:00:59
17000 -- (-848.373) (-853.051) (-848.064) [-844.228] * [-852.468] (-848.844) (-854.355) (-854.707) -- 0:00:57
17500 -- (-846.134) (-854.816) (-847.907) [-844.004] * (-858.629) [-846.277] (-850.934) (-856.803) -- 0:00:56
18000 -- (-847.921) (-862.711) (-845.304) [-847.849] * [-856.968] (-846.258) (-859.121) (-856.379) -- 0:00:54
18500 -- (-847.960) (-862.766) [-844.548] (-847.352) * (-855.835) (-847.566) [-852.674] (-861.080) -- 0:00:53
19000 -- (-845.926) [-853.935] (-844.165) (-845.562) * (-861.315) (-846.984) [-857.253] (-856.359) -- 0:00:51
19500 -- (-844.984) (-855.337) [-845.913] (-846.132) * [-848.582] (-848.338) (-858.785) (-850.427) -- 0:00:50
20000 -- (-845.055) (-853.991) [-845.675] (-845.742) * (-853.266) [-847.626] (-853.113) (-864.335) -- 0:00:49
Average standard deviation of split frequencies: 0.045620
20500 -- (-845.646) (-857.688) [-849.129] (-844.957) * (-852.669) [-847.901] (-859.882) (-853.414) -- 0:00:47
21000 -- [-847.278] (-865.590) (-847.640) (-845.200) * (-854.825) (-848.090) [-859.455] (-852.338) -- 0:00:46
21500 -- (-847.350) (-860.757) [-844.473] (-844.625) * (-860.983) [-844.617] (-850.778) (-857.060) -- 0:01:31
22000 -- (-847.031) (-852.574) (-846.394) [-846.728] * (-861.230) (-845.542) [-853.436] (-862.747) -- 0:01:28
22500 -- [-845.723] (-857.622) (-845.911) (-844.074) * (-858.101) (-853.440) (-855.947) [-857.896] -- 0:01:26
23000 -- (-845.544) [-855.208] (-848.162) (-844.074) * (-858.089) (-858.711) [-853.580] (-856.507) -- 0:01:24
23500 -- (-846.225) (-872.484) (-845.903) [-844.432] * (-865.825) [-847.270] (-852.342) (-859.472) -- 0:01:23
24000 -- (-846.070) [-857.158] (-846.717) (-844.959) * (-854.971) (-847.569) [-849.787] (-860.992) -- 0:01:21
24500 -- (-846.920) (-853.489) [-845.764] (-844.959) * (-854.771) (-844.686) (-858.397) [-854.380] -- 0:01:19
25000 -- (-847.230) (-847.331) (-845.767) [-844.493] * (-854.227) (-845.503) [-852.255] (-849.694) -- 0:01:18
Average standard deviation of split frequencies: 0.043679
25500 -- (-848.255) (-847.304) (-849.764) [-846.970] * (-852.870) [-845.605] (-854.527) (-850.580) -- 0:01:16
26000 -- (-848.994) (-846.590) (-846.788) [-848.374] * (-856.001) (-847.244) (-860.754) [-851.987] -- 0:01:14
26500 -- (-851.616) (-847.809) [-846.790] (-850.973) * (-853.994) (-849.206) (-855.469) [-862.113] -- 0:01:13
27000 -- (-844.068) (-846.968) [-847.165] (-849.586) * (-851.549) [-845.281] (-865.356) (-858.113) -- 0:01:12
27500 -- [-846.316] (-846.422) (-849.143) (-851.471) * [-855.615] (-845.782) (-853.242) (-857.130) -- 0:01:10
28000 -- (-846.873) (-847.763) [-845.971] (-850.283) * (-862.374) (-846.628) (-853.087) [-851.080] -- 0:01:09
28500 -- [-846.030] (-847.382) (-846.681) (-846.530) * (-858.730) (-845.465) (-865.672) [-855.605] -- 0:01:08
29000 -- (-847.559) (-845.411) [-847.808] (-848.732) * [-859.062] (-848.601) (-851.577) (-849.617) -- 0:01:06
29500 -- (-847.684) [-845.648] (-848.701) (-847.647) * [-862.628] (-845.688) (-855.691) (-856.977) -- 0:01:05
30000 -- (-846.038) (-845.894) (-848.874) [-846.649] * [-845.006] (-846.614) (-857.491) (-855.372) -- 0:01:04
Average standard deviation of split frequencies: 0.044498
30500 -- (-844.952) (-851.151) [-845.317] (-847.721) * (-846.239) [-846.641] (-858.607) (-854.335) -- 0:01:03
31000 -- [-845.217] (-848.817) (-845.164) (-848.093) * (-848.295) [-845.449] (-863.206) (-858.668) -- 0:01:02
31500 -- (-845.316) (-847.464) [-844.795] (-846.925) * [-845.641] (-851.385) (-860.310) (-853.419) -- 0:01:01
32000 -- (-846.128) (-845.964) (-847.174) [-846.402] * (-846.047) (-849.434) [-851.030] (-857.338) -- 0:01:00
32500 -- (-845.002) (-845.965) [-848.096] (-846.975) * (-849.230) (-852.504) (-854.668) [-852.915] -- 0:00:59
33000 -- (-845.498) (-846.808) [-845.305] (-848.140) * [-845.219] (-846.937) (-854.996) (-855.714) -- 0:00:58
33500 -- (-846.784) [-845.787] (-845.502) (-848.824) * (-846.115) [-845.108] (-851.018) (-855.825) -- 0:00:57
34000 -- (-849.337) (-847.687) (-844.891) [-848.497] * (-845.194) [-847.563] (-854.814) (-851.912) -- 0:00:56
34500 -- (-844.185) [-845.834] (-844.789) (-846.039) * (-845.896) (-849.963) [-856.406] (-863.449) -- 0:00:55
35000 -- [-845.377] (-845.241) (-845.103) (-845.542) * (-848.400) [-846.697] (-856.153) (-851.431) -- 0:00:55
Average standard deviation of split frequencies: 0.033770
35500 -- (-847.171) [-845.244] (-845.053) (-845.825) * (-844.589) (-848.206) [-855.091] (-854.043) -- 0:00:54
36000 -- (-846.323) (-845.612) [-846.921] (-846.974) * (-846.188) (-845.321) (-862.732) [-856.156] -- 0:00:53
36500 -- [-847.833] (-844.690) (-846.924) (-847.378) * [-846.481] (-845.890) (-855.664) (-854.118) -- 0:00:52
37000 -- (-845.329) (-844.727) (-845.652) [-844.535] * [-844.196] (-845.764) (-859.175) (-854.062) -- 0:00:52
37500 -- (-845.329) (-845.748) (-845.680) [-845.307] * (-844.574) (-844.750) [-854.805] (-851.805) -- 0:00:51
38000 -- [-845.638] (-844.761) (-845.820) (-851.611) * (-844.234) [-844.429] (-855.562) (-854.613) -- 0:01:15
38500 -- (-844.465) [-847.616] (-844.931) (-844.195) * (-844.840) (-845.137) [-851.607] (-852.526) -- 0:01:14
39000 -- (-845.474) (-848.475) [-845.155] (-846.854) * [-847.846] (-848.009) (-855.969) (-851.584) -- 0:01:13
39500 -- (-844.755) (-846.184) (-849.211) [-846.079] * (-846.930) (-855.169) [-855.180] (-852.880) -- 0:01:12
40000 -- (-844.885) (-845.458) (-846.803) [-847.942] * (-846.136) (-846.548) (-856.194) [-855.618] -- 0:01:12
Average standard deviation of split frequencies: 0.031115
40500 -- (-845.536) (-846.873) (-847.313) [-847.411] * [-845.324] (-844.123) (-862.344) (-859.075) -- 0:01:11
41000 -- (-845.852) (-847.652) [-848.730] (-847.540) * [-845.219] (-844.663) (-851.683) (-858.793) -- 0:01:10
41500 -- [-847.852] (-850.421) (-845.908) (-849.124) * [-844.973] (-845.098) (-853.203) (-853.308) -- 0:01:09
42000 -- (-846.578) (-849.830) (-844.913) [-844.963] * (-844.469) (-845.385) (-850.585) [-854.927] -- 0:01:08
42500 -- (-844.020) (-849.070) (-847.174) [-844.702] * (-845.758) (-844.661) (-859.744) [-851.100] -- 0:01:07
43000 -- (-844.848) (-848.147) [-846.211] (-846.907) * [-845.948] (-845.415) (-860.804) (-856.355) -- 0:01:06
43500 -- [-845.633] (-845.367) (-848.264) (-847.828) * (-845.234) (-845.574) [-853.325] (-865.893) -- 0:01:05
44000 -- (-845.154) (-846.184) [-850.016] (-847.466) * (-845.211) (-845.934) (-862.814) [-852.685] -- 0:01:05
44500 -- (-845.916) [-846.999] (-848.254) (-848.789) * (-851.738) [-845.462] (-862.732) (-859.278) -- 0:01:04
45000 -- [-845.325] (-845.666) (-845.679) (-848.439) * (-850.105) (-850.642) [-848.082] (-855.415) -- 0:01:03
Average standard deviation of split frequencies: 0.036893
45500 -- [-845.113] (-846.383) (-849.043) (-847.023) * (-848.211) (-849.874) (-845.402) [-852.918] -- 0:01:02
46000 -- (-845.113) [-845.199] (-847.378) (-847.172) * (-847.788) (-847.317) [-845.521] (-857.141) -- 0:01:02
46500 -- [-845.775] (-846.053) (-849.837) (-847.496) * (-851.713) [-847.208] (-847.397) (-854.641) -- 0:01:01
47000 -- [-847.442] (-847.284) (-844.545) (-845.511) * (-845.800) (-845.655) [-846.565] (-860.044) -- 0:01:00
47500 -- (-847.836) (-844.800) [-844.832] (-845.841) * (-846.234) (-850.304) [-845.073] (-858.479) -- 0:01:00
48000 -- (-849.207) [-845.250] (-846.378) (-847.013) * (-845.198) (-846.120) (-846.134) [-853.083] -- 0:00:59
48500 -- (-851.678) [-845.371] (-845.847) (-848.057) * (-846.354) (-849.113) [-845.790] (-859.527) -- 0:00:58
49000 -- (-848.896) [-846.292] (-844.313) (-844.652) * [-850.336] (-847.242) (-846.505) (-862.061) -- 0:00:58
49500 -- (-848.890) (-847.960) [-844.559] (-846.497) * [-848.272] (-847.368) (-846.523) (-857.524) -- 0:00:57
50000 -- (-847.834) (-851.807) (-844.405) [-845.482] * (-847.624) (-849.886) (-848.582) [-859.445] -- 0:00:57
Average standard deviation of split frequencies: 0.034425
50500 -- (-846.249) (-847.418) [-845.185] (-845.869) * (-847.863) (-847.974) [-846.890] (-852.640) -- 0:00:56
51000 -- (-848.103) [-846.556] (-846.760) (-848.140) * (-845.148) [-845.199] (-849.403) (-852.083) -- 0:00:55
51500 -- (-845.849) (-845.696) [-847.693] (-848.527) * (-845.196) [-848.870] (-845.291) (-855.051) -- 0:00:55
52000 -- [-844.667] (-844.502) (-848.786) (-849.137) * (-845.048) [-848.603] (-847.638) (-855.384) -- 0:00:54
52500 -- [-844.576] (-844.772) (-846.509) (-851.267) * (-844.564) (-849.077) (-847.724) [-852.773] -- 0:00:54
53000 -- (-844.747) (-848.792) [-844.786] (-848.423) * (-844.757) (-849.154) (-847.303) [-854.257] -- 0:00:53
53500 -- (-848.618) (-848.509) (-854.732) [-847.630] * [-845.834] (-849.193) (-847.515) (-853.423) -- 0:00:53
54000 -- (-846.697) (-846.353) [-845.484] (-846.730) * (-845.194) (-849.639) [-845.422] (-856.888) -- 0:01:10
54500 -- (-847.392) (-847.286) (-844.962) [-850.603] * (-844.888) (-849.676) [-844.268] (-854.973) -- 0:01:09
55000 -- (-846.896) (-848.127) (-844.875) [-847.744] * (-844.952) (-847.992) [-845.926] (-854.220) -- 0:01:08
Average standard deviation of split frequencies: 0.023991
55500 -- (-846.890) (-849.549) (-845.642) [-844.883] * (-847.352) (-849.063) [-845.363] (-864.110) -- 0:01:08
56000 -- (-846.391) (-849.506) [-846.238] (-845.746) * [-847.070] (-844.975) (-846.349) (-865.412) -- 0:01:07
56500 -- (-845.630) [-847.368] (-845.231) (-848.224) * (-844.772) (-844.373) [-847.931] (-855.160) -- 0:01:06
57000 -- (-845.422) (-847.271) (-847.762) [-846.230] * (-846.842) [-847.011] (-846.008) (-854.900) -- 0:01:06
57500 -- [-845.073] (-845.478) (-852.403) (-846.800) * [-845.431] (-844.952) (-849.046) (-855.632) -- 0:01:05
58000 -- (-857.019) [-846.882] (-850.592) (-844.783) * (-847.008) [-848.130] (-845.049) (-853.724) -- 0:01:04
58500 -- (-845.279) (-845.011) [-846.517] (-845.273) * [-848.450] (-845.309) (-844.624) (-853.278) -- 0:01:04
59000 -- (-845.323) [-845.868] (-846.294) (-845.251) * [-848.461] (-847.017) (-844.979) (-855.490) -- 0:01:03
59500 -- (-850.405) (-844.811) (-847.227) [-845.259] * (-846.161) [-844.602] (-847.949) (-857.137) -- 0:01:03
60000 -- [-845.610] (-844.902) (-850.193) (-846.686) * (-846.077) (-847.618) [-846.498] (-852.002) -- 0:01:02
Average standard deviation of split frequencies: 0.022534
60500 -- [-845.263] (-845.446) (-846.877) (-846.995) * (-845.484) [-845.420] (-844.877) (-856.497) -- 0:01:02
61000 -- (-845.683) (-845.300) [-847.636] (-847.223) * [-845.684] (-848.299) (-844.928) (-855.031) -- 0:01:01
61500 -- [-844.436] (-848.497) (-847.724) (-846.946) * (-844.673) (-844.253) [-846.346] (-850.813) -- 0:01:01
62000 -- [-845.787] (-847.056) (-848.639) (-850.538) * [-844.928] (-849.929) (-846.539) (-859.430) -- 0:01:00
62500 -- (-845.563) [-844.897] (-847.135) (-848.816) * (-844.488) [-852.309] (-846.587) (-852.205) -- 0:01:00
63000 -- (-847.243) [-844.089] (-847.501) (-850.322) * [-844.974] (-849.435) (-846.460) (-852.989) -- 0:00:59
63500 -- (-847.413) (-844.588) (-847.196) [-846.762] * [-845.028] (-850.960) (-846.411) (-859.904) -- 0:00:58
64000 -- (-854.278) (-845.441) (-847.079) [-848.757] * (-845.016) (-846.867) (-845.987) [-854.962] -- 0:00:58
64500 -- (-846.422) [-843.902] (-846.018) (-846.431) * [-845.542] (-847.602) (-845.127) (-856.552) -- 0:00:58
65000 -- [-848.487] (-845.296) (-846.677) (-847.043) * (-846.221) (-845.816) [-847.429] (-851.303) -- 0:00:57
Average standard deviation of split frequencies: 0.023128
65500 -- (-845.924) (-844.635) (-848.946) [-850.190] * [-847.323] (-848.460) (-845.373) (-858.942) -- 0:00:57
66000 -- (-848.113) (-844.639) [-848.040] (-845.565) * (-847.465) [-849.375] (-849.061) (-856.755) -- 0:00:56
66500 -- (-846.979) [-845.733] (-847.944) (-848.684) * (-846.878) (-845.038) [-845.254] (-856.627) -- 0:00:56
67000 -- (-846.139) (-845.522) (-846.565) [-848.386] * (-847.005) (-846.599) [-847.620] (-852.564) -- 0:00:55
67500 -- (-851.682) (-844.387) (-845.701) [-846.956] * (-845.081) (-847.280) (-846.656) [-850.265] -- 0:00:55
68000 -- (-846.030) [-846.692] (-846.553) (-846.190) * (-845.640) [-845.371] (-849.024) (-866.400) -- 0:00:54
68500 -- (-847.341) (-848.156) [-845.781] (-849.377) * (-844.610) (-845.686) [-847.558] (-852.512) -- 0:00:54
69000 -- (-847.252) (-849.531) [-845.086] (-846.691) * (-845.657) [-844.805] (-846.636) (-855.532) -- 0:00:53
69500 -- (-845.717) (-847.531) (-845.416) [-845.477] * (-844.773) (-849.058) [-844.947] (-860.534) -- 0:00:53
70000 -- (-844.655) (-845.009) [-846.872] (-846.087) * (-847.376) (-847.400) [-845.636] (-855.131) -- 0:01:06
Average standard deviation of split frequencies: 0.022347
70500 -- [-845.371] (-847.107) (-846.270) (-845.447) * (-845.284) (-847.041) [-846.180] (-867.817) -- 0:01:05
71000 -- (-846.102) (-845.436) (-845.642) [-844.793] * [-845.308] (-846.925) (-847.083) (-856.803) -- 0:01:05
71500 -- (-844.709) (-847.602) (-848.740) [-844.791] * [-845.548] (-845.570) (-845.966) (-858.389) -- 0:01:04
72000 -- (-845.269) (-846.674) (-845.641) [-848.172] * (-845.375) (-845.751) [-846.960] (-848.732) -- 0:01:04
72500 -- (-844.955) (-847.433) [-844.434] (-847.860) * (-847.471) [-846.784] (-846.875) (-847.729) -- 0:01:03
73000 -- [-846.176] (-848.570) (-846.672) (-848.160) * (-846.027) [-845.926] (-845.185) (-847.750) -- 0:01:03
73500 -- (-847.763) [-845.887] (-849.126) (-848.931) * (-844.241) (-848.366) (-848.476) [-845.553] -- 0:01:03
74000 -- [-847.148] (-846.124) (-850.289) (-846.502) * [-844.203] (-845.772) (-844.775) (-847.510) -- 0:01:02
74500 -- (-847.514) (-846.606) [-845.552] (-847.290) * (-846.296) (-844.881) [-844.547] (-846.362) -- 0:01:02
75000 -- (-847.256) (-845.330) (-845.945) [-844.512] * [-844.296] (-845.958) (-845.629) (-850.918) -- 0:01:01
Average standard deviation of split frequencies: 0.024220
75500 -- [-847.376] (-850.787) (-845.373) (-846.142) * (-844.421) (-847.062) (-844.767) [-844.312] -- 0:01:01
76000 -- (-848.213) (-844.968) [-844.208] (-844.301) * (-847.460) [-848.188] (-845.461) (-844.877) -- 0:01:00
76500 -- (-848.864) (-845.791) (-846.803) [-844.344] * [-844.380] (-846.764) (-845.241) (-848.818) -- 0:01:00
77000 -- (-844.795) (-848.599) (-846.589) [-844.512] * [-845.292] (-844.680) (-846.625) (-846.053) -- 0:00:59
77500 -- (-846.306) [-845.444] (-846.154) (-844.135) * (-846.098) (-846.719) [-846.282] (-848.233) -- 0:00:59
78000 -- (-845.824) [-847.044] (-847.334) (-844.909) * (-846.076) [-845.166] (-845.344) (-847.611) -- 0:00:59
78500 -- [-844.764] (-845.771) (-846.560) (-854.129) * (-845.298) (-845.006) (-850.097) [-846.741] -- 0:00:58
79000 -- (-845.005) (-845.287) (-845.663) [-849.220] * (-848.150) (-844.939) [-845.239] (-846.001) -- 0:00:58
79500 -- (-845.795) (-845.466) [-847.385] (-845.209) * [-847.240] (-848.080) (-845.922) (-846.719) -- 0:00:57
80000 -- [-846.675] (-847.333) (-849.091) (-846.248) * (-848.665) [-848.387] (-848.847) (-844.311) -- 0:00:57
Average standard deviation of split frequencies: 0.021530
80500 -- (-846.952) (-844.596) [-848.984] (-847.963) * [-848.323] (-845.672) (-844.782) (-845.151) -- 0:00:57
81000 -- (-845.801) [-845.603] (-848.605) (-846.503) * (-851.691) (-844.693) (-845.056) [-844.103] -- 0:00:56
81500 -- (-845.897) (-846.524) (-846.768) [-848.617] * (-852.827) [-845.807] (-845.684) (-844.341) -- 0:00:56
82000 -- (-847.065) (-845.080) (-849.534) [-847.657] * [-846.997] (-846.618) (-844.728) (-846.788) -- 0:00:55
82500 -- (-847.515) [-844.298] (-846.683) (-847.088) * [-845.863] (-844.843) (-844.827) (-845.673) -- 0:00:55
83000 -- (-846.807) (-844.490) (-845.776) [-847.601] * (-848.734) [-847.476] (-845.388) (-847.048) -- 0:00:55
83500 -- [-846.679] (-844.443) (-844.918) (-849.307) * [-853.155] (-845.292) (-847.173) (-849.029) -- 0:00:54
84000 -- (-847.884) (-846.758) (-845.823) [-849.058] * [-846.335] (-846.090) (-846.030) (-846.645) -- 0:00:54
84500 -- [-847.821] (-844.557) (-844.748) (-855.767) * (-844.433) (-846.184) (-846.541) [-847.000] -- 0:00:54
85000 -- [-848.537] (-845.775) (-845.921) (-850.241) * (-844.248) [-847.060] (-849.377) (-846.468) -- 0:00:53
Average standard deviation of split frequencies: 0.021104
85500 -- (-845.538) [-846.359] (-845.373) (-846.522) * (-845.232) (-849.602) [-850.703] (-845.892) -- 0:00:53
86000 -- [-846.636] (-847.186) (-847.239) (-846.028) * (-845.640) (-844.511) (-845.407) [-847.415] -- 0:00:53
86500 -- (-845.602) [-847.732] (-846.219) (-850.066) * [-846.212] (-845.035) (-848.452) (-844.505) -- 0:01:03
87000 -- [-848.932] (-844.893) (-845.652) (-849.453) * (-848.951) [-845.333] (-848.896) (-844.254) -- 0:01:02
87500 -- (-845.845) [-846.123] (-848.791) (-852.348) * (-846.346) [-844.373] (-848.184) (-849.989) -- 0:01:02
88000 -- (-847.405) [-847.822] (-847.326) (-845.882) * (-850.033) [-847.204] (-847.094) (-849.896) -- 0:01:02
88500 -- [-847.292] (-849.126) (-848.316) (-847.686) * (-846.934) (-848.218) [-845.885] (-851.142) -- 0:01:01
89000 -- [-845.035] (-844.998) (-848.644) (-844.753) * (-845.789) (-846.574) [-844.673] (-846.435) -- 0:01:01
89500 -- (-845.300) [-845.434] (-846.315) (-844.551) * [-845.065] (-850.522) (-846.173) (-845.726) -- 0:01:01
90000 -- [-846.554] (-846.561) (-848.349) (-848.035) * (-845.115) [-845.670] (-850.075) (-844.799) -- 0:01:00
Average standard deviation of split frequencies: 0.020250
90500 -- (-844.160) [-846.624] (-849.405) (-846.853) * (-845.004) [-846.593] (-849.731) (-846.288) -- 0:01:00
91000 -- (-846.714) [-845.171] (-846.504) (-849.428) * (-843.979) (-846.428) [-845.159] (-847.583) -- 0:00:59
91500 -- (-846.696) (-845.744) [-846.221] (-846.391) * (-844.407) [-848.733] (-848.635) (-851.250) -- 0:00:59
92000 -- (-846.573) [-845.042] (-848.451) (-847.846) * (-845.566) (-852.197) (-846.239) [-848.535] -- 0:00:59
92500 -- (-844.775) [-844.346] (-848.230) (-847.860) * (-847.014) (-847.526) [-846.684] (-849.531) -- 0:00:58
93000 -- [-846.819] (-844.860) (-850.671) (-845.203) * [-846.338] (-848.144) (-848.605) (-854.394) -- 0:00:58
93500 -- (-845.184) [-847.639] (-846.828) (-849.427) * [-846.804] (-845.747) (-847.025) (-846.240) -- 0:00:58
94000 -- (-847.623) (-848.164) (-846.360) [-844.732] * (-844.682) [-848.673] (-845.807) (-846.633) -- 0:00:57
94500 -- (-848.626) (-850.831) (-850.271) [-845.044] * (-845.242) (-851.690) [-846.015] (-846.553) -- 0:00:57
95000 -- [-848.193] (-846.328) (-849.174) (-844.881) * (-845.317) (-848.669) (-847.701) [-845.024] -- 0:00:57
Average standard deviation of split frequencies: 0.021852
95500 -- (-848.355) (-845.187) (-852.499) [-846.448] * (-846.178) (-845.523) (-844.877) [-844.784] -- 0:00:56
96000 -- (-846.770) (-847.807) [-845.354] (-847.485) * [-844.568] (-845.520) (-845.227) (-847.084) -- 0:00:56
96500 -- (-844.383) [-845.086] (-853.798) (-845.966) * (-845.832) (-847.235) [-845.739] (-845.177) -- 0:00:56
97000 -- (-848.385) (-845.838) (-854.777) [-845.714] * (-846.376) (-847.553) [-844.008] (-843.960) -- 0:00:55
97500 -- (-844.463) (-849.611) (-849.766) [-847.719] * [-848.143] (-847.088) (-845.419) (-847.552) -- 0:00:55
98000 -- (-844.769) [-844.606] (-849.862) (-846.056) * (-846.208) [-847.807] (-854.108) (-847.216) -- 0:00:55
98500 -- (-845.674) (-846.754) (-848.795) [-844.149] * [-849.176] (-849.530) (-853.292) (-849.533) -- 0:00:54
99000 -- (-845.991) (-846.872) (-848.321) [-844.527] * (-847.642) [-847.899] (-846.491) (-849.142) -- 0:00:54
99500 -- (-847.858) (-846.173) [-845.530] (-845.353) * (-849.119) (-850.098) (-845.823) [-851.674] -- 0:00:54
100000 -- (-849.270) [-846.482] (-845.183) (-844.910) * [-848.010] (-845.357) (-846.819) (-846.344) -- 0:00:54
Average standard deviation of split frequencies: 0.023168
100500 -- (-845.921) (-846.815) [-844.197] (-845.530) * (-847.275) (-844.932) [-844.497] (-844.880) -- 0:00:53
101000 -- (-846.100) (-846.436) (-846.104) [-844.475] * (-846.822) (-847.121) [-846.117] (-844.622) -- 0:00:53
101500 -- (-846.945) [-847.234] (-846.048) (-848.530) * [-846.216] (-847.973) (-845.370) (-848.181) -- 0:00:53
102000 -- (-847.510) (-847.074) [-848.461] (-845.035) * [-846.046] (-847.434) (-846.036) (-845.321) -- 0:00:52
102500 -- (-847.992) (-846.287) [-845.906] (-846.010) * (-846.581) (-850.272) [-845.606] (-850.381) -- 0:00:52
103000 -- [-847.608] (-846.411) (-845.294) (-847.055) * [-845.777] (-847.519) (-846.162) (-849.938) -- 0:01:00
103500 -- (-850.120) [-845.856] (-848.991) (-847.994) * (-844.547) [-844.756] (-846.155) (-844.858) -- 0:01:00
104000 -- (-852.507) (-847.170) [-844.345] (-847.009) * (-847.110) (-845.668) (-845.871) [-846.785] -- 0:01:00
104500 -- (-851.259) (-844.308) [-847.231] (-849.872) * (-846.679) [-847.244] (-845.679) (-846.631) -- 0:00:59
105000 -- (-847.706) [-844.013] (-847.095) (-849.323) * (-844.269) (-848.058) [-847.776] (-844.060) -- 0:00:59
Average standard deviation of split frequencies: 0.021569
105500 -- (-845.749) (-844.280) [-846.944] (-848.440) * [-844.860] (-848.053) (-845.449) (-847.204) -- 0:00:59
106000 -- (-844.762) (-844.856) [-845.306] (-847.617) * [-844.344] (-849.647) (-851.613) (-854.363) -- 0:00:59
106500 -- (-845.805) [-849.305] (-852.776) (-845.227) * (-845.718) (-846.839) (-849.796) [-847.631] -- 0:00:58
107000 -- (-851.229) (-847.051) [-846.115] (-846.316) * (-846.730) (-845.281) [-845.179] (-844.185) -- 0:00:58
107500 -- (-852.369) (-850.719) (-846.612) [-846.996] * [-846.989] (-845.085) (-847.088) (-850.716) -- 0:00:58
108000 -- [-848.838] (-848.238) (-846.961) (-847.597) * (-847.565) (-847.821) [-845.709] (-844.957) -- 0:00:57
108500 -- (-846.513) [-849.106] (-847.905) (-851.846) * [-847.398] (-847.837) (-847.113) (-845.114) -- 0:00:57
109000 -- (-850.399) (-850.448) [-847.172] (-844.324) * (-845.452) (-846.054) (-851.971) [-847.072] -- 0:00:57
109500 -- (-846.409) (-849.826) (-846.121) [-844.650] * (-850.612) [-845.277] (-850.351) (-850.368) -- 0:00:56
110000 -- [-844.251] (-847.235) (-846.167) (-845.887) * [-846.922] (-845.071) (-846.994) (-849.288) -- 0:00:56
Average standard deviation of split frequencies: 0.022868
110500 -- (-847.482) (-846.297) (-845.853) [-847.270] * (-846.859) [-845.422] (-846.102) (-846.363) -- 0:00:56
111000 -- (-844.756) [-846.239] (-848.098) (-847.866) * (-845.143) (-847.921) [-849.235] (-846.222) -- 0:00:56
111500 -- (-845.746) [-844.298] (-846.012) (-847.875) * [-845.609] (-849.851) (-846.755) (-846.348) -- 0:00:55
112000 -- (-845.530) (-844.320) (-845.652) [-848.053] * [-844.886] (-846.842) (-846.535) (-847.701) -- 0:00:55
112500 -- [-845.456] (-845.292) (-845.382) (-845.017) * (-844.503) (-846.518) [-846.321] (-849.866) -- 0:00:55
113000 -- (-846.749) (-844.910) (-848.323) [-844.581] * (-847.366) [-845.832] (-845.156) (-846.575) -- 0:00:54
113500 -- (-845.163) (-847.241) (-845.100) [-844.845] * (-847.114) (-846.750) [-846.237] (-844.356) -- 0:00:54
114000 -- (-845.578) (-844.606) (-845.613) [-847.300] * (-846.058) [-844.616] (-845.959) (-844.506) -- 0:00:54
114500 -- (-846.882) [-846.497] (-845.257) (-851.908) * [-844.241] (-852.364) (-845.590) (-844.244) -- 0:00:54
115000 -- (-845.490) (-846.378) (-847.171) [-846.940] * [-844.820] (-848.493) (-844.319) (-847.761) -- 0:00:53
Average standard deviation of split frequencies: 0.023527
115500 -- (-847.820) [-846.063] (-845.410) (-845.349) * (-844.510) (-849.974) [-845.563] (-847.763) -- 0:00:53
116000 -- (-845.652) (-845.213) (-846.876) [-844.908] * (-844.510) (-844.901) [-847.432] (-848.672) -- 0:00:53
116500 -- (-847.144) (-845.577) [-846.574] (-846.613) * (-844.929) [-848.882] (-847.319) (-850.733) -- 0:00:53
117000 -- [-844.968] (-846.440) (-846.547) (-846.738) * (-846.560) [-844.907] (-851.607) (-849.518) -- 0:00:52
117500 -- [-848.494] (-850.155) (-845.387) (-844.669) * (-847.921) (-844.826) [-845.552] (-845.911) -- 0:00:52
118000 -- (-848.118) (-846.947) [-845.331] (-846.341) * [-847.880] (-844.844) (-844.807) (-845.840) -- 0:00:52
118500 -- (-845.106) (-845.611) [-846.430] (-855.878) * (-845.099) (-846.992) [-845.463] (-847.393) -- 0:00:52
119000 -- (-844.836) [-847.699] (-847.982) (-850.166) * (-844.706) (-849.583) (-846.922) [-850.117] -- 0:00:51
119500 -- (-845.033) (-846.537) (-849.797) [-845.576] * (-845.442) (-848.457) (-845.629) [-849.084] -- 0:00:58
120000 -- [-846.478] (-846.593) (-845.446) (-846.581) * (-846.482) [-846.158] (-846.203) (-843.983) -- 0:00:58
Average standard deviation of split frequencies: 0.022001
120500 -- (-850.223) (-847.178) (-845.632) [-845.989] * (-846.701) (-847.777) [-844.330] (-844.021) -- 0:00:58
121000 -- (-850.751) (-848.179) (-849.033) [-844.133] * [-846.987] (-849.207) (-844.690) (-845.880) -- 0:00:58
121500 -- [-850.177] (-846.179) (-846.795) (-845.001) * (-844.688) [-846.143] (-846.818) (-846.088) -- 0:00:57
122000 -- [-844.916] (-845.187) (-846.607) (-846.293) * [-845.924] (-845.149) (-844.826) (-850.986) -- 0:00:57
122500 -- (-844.387) [-845.298] (-846.204) (-846.369) * (-848.481) (-844.937) (-845.615) [-847.035] -- 0:00:57
123000 -- (-847.681) [-844.891] (-845.834) (-847.910) * (-845.981) [-845.580] (-844.602) (-846.196) -- 0:00:57
123500 -- (-848.107) (-845.120) [-846.724] (-846.638) * [-845.829] (-846.143) (-845.578) (-847.179) -- 0:00:56
124000 -- (-848.996) [-845.971] (-845.485) (-845.985) * [-847.033] (-849.231) (-846.725) (-845.047) -- 0:00:56
124500 -- (-847.063) (-847.596) [-845.487] (-845.238) * (-847.634) (-848.413) (-844.740) [-847.512] -- 0:00:56
125000 -- (-848.062) (-852.428) [-844.849] (-845.746) * (-844.725) (-846.656) [-844.831] (-845.500) -- 0:00:56
Average standard deviation of split frequencies: 0.021660
125500 -- (-846.518) [-845.614] (-844.520) (-845.834) * [-846.803] (-847.866) (-846.546) (-845.695) -- 0:00:55
126000 -- [-846.862] (-845.031) (-845.769) (-852.318) * [-847.954] (-847.101) (-845.481) (-845.756) -- 0:00:55
126500 -- (-845.742) (-848.492) [-845.769] (-846.326) * (-846.051) (-849.685) [-845.198] (-847.892) -- 0:00:55
127000 -- [-846.669] (-845.277) (-844.490) (-846.979) * [-844.783] (-844.892) (-846.506) (-845.803) -- 0:00:54
127500 -- (-845.621) [-845.009] (-844.837) (-845.452) * [-844.884] (-847.466) (-859.022) (-848.925) -- 0:00:54
128000 -- [-845.736] (-845.964) (-850.163) (-844.752) * [-845.778] (-846.525) (-847.301) (-846.330) -- 0:00:54
128500 -- [-847.676] (-847.972) (-849.134) (-845.907) * (-845.345) (-848.410) [-845.327] (-849.112) -- 0:00:54
129000 -- (-845.080) (-846.598) [-852.296] (-846.577) * (-845.475) (-848.655) (-845.312) [-852.013] -- 0:00:54
129500 -- [-845.804] (-845.718) (-849.548) (-846.330) * [-844.986] (-847.309) (-846.950) (-849.438) -- 0:00:53
130000 -- [-845.972] (-846.286) (-844.623) (-845.030) * (-845.146) (-845.956) (-845.822) [-845.616] -- 0:00:53
Average standard deviation of split frequencies: 0.023250
130500 -- (-844.781) (-848.186) (-846.565) [-844.934] * [-845.253] (-848.336) (-845.784) (-847.745) -- 0:00:53
131000 -- (-845.337) (-851.357) [-848.224] (-844.911) * (-846.606) [-848.100] (-844.429) (-845.083) -- 0:00:53
131500 -- (-846.269) (-847.487) (-843.960) [-845.619] * [-846.222] (-849.049) (-846.703) (-844.365) -- 0:00:52
132000 -- [-847.686] (-849.974) (-845.822) (-844.995) * (-844.338) (-845.302) [-845.156] (-846.054) -- 0:00:52
132500 -- (-846.862) (-850.950) (-848.932) [-846.450] * (-845.174) (-846.915) (-845.248) [-847.272] -- 0:00:52
133000 -- (-848.797) (-849.501) (-846.190) [-846.230] * (-845.551) (-846.219) [-844.453] (-844.877) -- 0:00:52
133500 -- (-849.322) (-847.722) (-845.614) [-844.513] * (-844.756) [-844.947] (-848.624) (-847.869) -- 0:00:51
134000 -- [-846.241] (-847.002) (-846.772) (-845.314) * (-845.484) (-846.577) [-848.693] (-845.821) -- 0:00:51
134500 -- [-847.821] (-845.381) (-848.228) (-844.979) * (-845.002) (-845.329) (-847.797) [-845.825] -- 0:00:51
135000 -- (-850.822) [-847.072] (-845.483) (-844.819) * (-844.970) [-846.892] (-844.540) (-844.801) -- 0:00:51
Average standard deviation of split frequencies: 0.023351
135500 -- [-845.114] (-845.536) (-845.882) (-848.862) * (-845.569) (-845.100) [-847.183] (-846.882) -- 0:00:51
136000 -- (-847.155) [-845.015] (-847.650) (-846.526) * [-847.034] (-846.133) (-850.253) (-846.879) -- 0:00:57
136500 -- (-847.363) (-847.995) (-844.552) [-847.796] * (-846.293) [-845.053] (-850.018) (-848.055) -- 0:00:56
137000 -- (-847.254) (-844.635) (-846.259) [-850.737] * (-851.481) (-845.306) (-848.748) [-844.496] -- 0:00:56
137500 -- (-849.309) [-844.722] (-847.665) (-847.434) * [-846.005] (-845.664) (-845.761) (-845.685) -- 0:00:56
138000 -- (-845.988) (-847.494) (-847.548) [-847.481] * [-846.156] (-845.048) (-848.193) (-847.007) -- 0:00:56
138500 -- (-845.988) (-849.428) (-845.698) [-846.881] * (-846.426) [-850.973] (-847.956) (-844.927) -- 0:00:55
139000 -- (-845.860) [-847.090] (-846.897) (-847.125) * [-845.889] (-848.048) (-848.490) (-847.174) -- 0:00:55
139500 -- [-847.927] (-846.018) (-845.950) (-846.298) * (-845.465) (-850.292) [-847.159] (-845.044) -- 0:00:55
140000 -- [-850.764] (-848.473) (-845.560) (-850.331) * (-844.843) (-849.519) (-846.828) [-846.009] -- 0:00:55
Average standard deviation of split frequencies: 0.023811
140500 -- (-845.713) (-852.698) (-846.648) [-846.730] * (-846.762) (-852.015) [-846.011] (-844.670) -- 0:00:55
141000 -- (-847.856) [-844.683] (-846.212) (-847.491) * (-845.956) [-847.303] (-845.502) (-844.424) -- 0:00:54
141500 -- (-845.206) (-844.677) (-847.190) [-845.004] * (-847.974) (-845.320) (-845.636) [-845.872] -- 0:00:54
142000 -- (-846.531) [-846.684] (-851.388) (-848.857) * (-848.290) (-845.341) [-844.856] (-847.226) -- 0:00:54
142500 -- (-845.092) [-844.363] (-845.745) (-846.544) * (-847.511) (-848.240) (-844.845) [-846.735] -- 0:00:54
143000 -- (-855.268) (-848.182) (-846.322) [-846.458] * (-846.000) (-846.797) [-845.032] (-844.796) -- 0:00:53
143500 -- (-849.040) (-844.924) [-846.543] (-846.389) * (-845.303) (-844.987) [-845.160] (-846.749) -- 0:00:53
144000 -- [-851.443] (-844.426) (-849.921) (-846.228) * [-844.711] (-846.664) (-845.115) (-845.607) -- 0:00:53
144500 -- (-850.416) (-845.124) [-845.163] (-848.751) * (-844.326) (-845.967) (-847.340) [-846.402] -- 0:00:53
145000 -- (-847.512) [-846.971] (-846.667) (-849.378) * (-845.492) (-846.943) (-845.748) [-846.125] -- 0:00:53
Average standard deviation of split frequencies: 0.022941
145500 -- (-845.426) [-849.857] (-847.257) (-847.068) * (-844.955) (-846.091) (-847.349) [-847.535] -- 0:00:52
146000 -- (-845.552) (-850.283) [-844.753] (-846.277) * [-844.940] (-846.406) (-847.088) (-850.618) -- 0:00:52
146500 -- (-845.469) [-843.920] (-846.921) (-846.303) * [-846.806] (-846.401) (-846.493) (-853.852) -- 0:00:52
147000 -- (-846.876) [-844.809] (-844.735) (-849.826) * (-845.159) (-847.840) [-845.870] (-844.329) -- 0:00:52
147500 -- [-844.206] (-846.960) (-844.433) (-847.242) * (-846.334) (-848.727) (-847.478) [-844.789] -- 0:00:52
148000 -- [-846.743] (-847.119) (-845.811) (-848.030) * (-846.506) (-849.726) (-844.597) [-844.903] -- 0:00:51
148500 -- [-845.060] (-844.546) (-847.055) (-845.606) * [-849.354] (-847.847) (-846.737) (-848.166) -- 0:00:51
149000 -- (-845.514) (-844.520) [-847.874] (-848.145) * [-847.094] (-847.062) (-845.561) (-849.061) -- 0:00:51
149500 -- [-846.317] (-846.936) (-846.205) (-852.378) * [-844.681] (-846.074) (-849.388) (-846.813) -- 0:00:51
150000 -- (-845.812) (-845.647) (-845.934) [-848.629] * (-844.867) (-845.468) [-845.744] (-845.652) -- 0:00:51
Average standard deviation of split frequencies: 0.022396
150500 -- [-847.395] (-845.172) (-844.856) (-847.734) * (-849.233) (-844.951) [-844.808] (-845.473) -- 0:00:50
151000 -- (-847.096) (-845.072) [-844.534] (-845.994) * (-849.532) (-844.111) (-847.021) [-847.305] -- 0:00:50
151500 -- (-847.469) (-845.535) (-844.763) [-845.432] * (-845.245) [-847.344] (-849.661) (-846.460) -- 0:00:50
152000 -- [-844.796] (-846.134) (-844.686) (-844.948) * (-846.509) [-847.067] (-846.831) (-849.643) -- 0:00:55
152500 -- (-844.652) (-849.195) [-848.159] (-845.107) * (-847.693) [-844.533] (-845.713) (-846.604) -- 0:00:55
153000 -- [-844.632] (-846.941) (-848.006) (-844.103) * (-847.350) (-849.323) [-846.747] (-847.398) -- 0:00:55
153500 -- [-844.664] (-846.430) (-849.144) (-847.274) * (-848.709) (-846.326) [-846.760] (-845.447) -- 0:00:55
154000 -- [-844.505] (-844.455) (-847.436) (-846.315) * (-845.273) (-847.860) [-845.905] (-847.387) -- 0:00:54
154500 -- (-845.439) [-844.464] (-847.057) (-848.131) * (-847.345) [-847.051] (-845.591) (-847.414) -- 0:00:54
155000 -- [-844.329] (-844.288) (-844.197) (-848.012) * (-849.293) (-847.554) [-847.278] (-846.271) -- 0:00:54
Average standard deviation of split frequencies: 0.024678
155500 -- (-849.021) [-846.995] (-844.488) (-845.319) * (-848.962) (-847.131) (-844.427) [-846.446] -- 0:00:54
156000 -- (-847.717) [-845.256] (-848.814) (-845.474) * (-846.720) (-847.486) [-849.332] (-846.882) -- 0:00:54
156500 -- (-844.831) (-847.990) (-850.454) [-848.276] * (-844.843) (-849.616) [-847.885] (-850.089) -- 0:00:53
157000 -- (-844.843) (-848.681) (-850.418) [-846.353] * [-849.610] (-846.205) (-847.105) (-846.081) -- 0:00:53
157500 -- (-846.507) [-846.472] (-845.727) (-846.967) * (-846.185) (-845.170) [-844.545] (-845.852) -- 0:00:53
158000 -- (-847.712) (-845.544) [-847.159] (-847.708) * (-847.072) (-845.370) [-846.217] (-844.440) -- 0:00:53
158500 -- (-846.517) (-844.525) (-845.030) [-848.707] * (-845.192) (-847.722) (-848.539) [-847.038] -- 0:00:53
159000 -- (-844.721) [-846.671] (-846.630) (-846.730) * (-847.654) (-847.933) (-845.031) [-845.866] -- 0:00:52
159500 -- [-844.943] (-846.045) (-845.269) (-845.439) * (-846.423) (-846.417) [-845.414] (-848.179) -- 0:00:52
160000 -- [-844.618] (-848.686) (-848.041) (-846.105) * (-844.973) (-846.913) (-845.741) [-845.588] -- 0:00:52
Average standard deviation of split frequencies: 0.023635
160500 -- (-847.610) [-847.196] (-845.953) (-845.182) * [-845.702] (-846.187) (-844.766) (-845.892) -- 0:00:52
161000 -- (-848.671) (-845.759) [-846.339] (-846.968) * (-845.767) [-846.395] (-846.215) (-844.647) -- 0:00:52
161500 -- (-845.256) [-845.171] (-847.037) (-845.906) * (-845.062) (-846.403) (-846.836) [-844.768] -- 0:00:51
162000 -- (-847.241) [-845.469] (-845.554) (-846.698) * (-848.577) (-845.920) [-845.444] (-847.604) -- 0:00:51
162500 -- (-845.783) [-845.999] (-847.301) (-844.672) * (-845.594) (-847.211) (-845.298) [-845.693] -- 0:00:51
163000 -- (-844.775) [-845.079] (-848.917) (-845.972) * [-844.697] (-846.622) (-845.053) (-845.176) -- 0:00:51
163500 -- (-847.764) (-847.338) (-847.181) [-845.038] * (-844.264) (-846.158) (-847.362) [-846.499] -- 0:00:51
164000 -- [-845.756] (-848.155) (-844.510) (-845.701) * (-846.088) (-851.009) (-847.964) [-846.478] -- 0:00:50
164500 -- (-846.152) (-845.983) (-843.952) [-846.399] * (-847.017) (-846.057) [-847.488] (-846.426) -- 0:00:50
165000 -- (-848.406) (-845.287) (-845.055) [-845.362] * (-846.196) [-846.723] (-850.424) (-848.300) -- 0:00:50
Average standard deviation of split frequencies: 0.024769
165500 -- (-848.098) [-849.159] (-845.585) (-847.325) * (-851.773) (-848.303) (-848.087) [-844.931] -- 0:00:50
166000 -- (-845.893) [-846.899] (-846.465) (-844.649) * [-845.095] (-844.971) (-847.687) (-846.171) -- 0:00:50
166500 -- (-844.619) (-851.350) [-847.641] (-849.299) * (-846.293) (-844.256) (-845.520) [-844.180] -- 0:00:50
167000 -- [-847.613] (-847.805) (-845.418) (-846.493) * [-847.418] (-845.591) (-845.817) (-844.607) -- 0:00:49
167500 -- (-845.353) (-845.804) (-844.993) [-846.728] * (-846.272) (-844.706) [-844.112] (-845.229) -- 0:00:49
168000 -- (-844.350) [-845.434] (-844.829) (-850.937) * (-847.272) (-848.953) (-844.543) [-845.575] -- 0:00:49
168500 -- [-844.350] (-847.583) (-846.958) (-845.532) * (-847.316) [-847.689] (-846.667) (-845.160) -- 0:00:49
169000 -- [-844.297] (-846.051) (-845.013) (-846.225) * (-845.673) (-849.131) (-848.950) [-845.934] -- 0:00:54
169500 -- (-847.911) (-849.767) [-844.664] (-845.986) * (-845.317) (-844.634) (-846.154) [-847.184] -- 0:00:53
170000 -- (-844.357) (-848.325) [-847.569] (-847.051) * (-847.165) [-848.285] (-846.424) (-848.318) -- 0:00:53
Average standard deviation of split frequencies: 0.022373
170500 -- [-846.113] (-847.980) (-845.039) (-847.365) * [-846.976] (-852.826) (-845.261) (-851.039) -- 0:00:53
171000 -- (-844.491) (-845.857) (-851.913) [-846.733] * [-850.923] (-847.652) (-844.833) (-851.895) -- 0:00:53
171500 -- (-847.359) [-845.828] (-844.867) (-847.894) * (-845.985) [-845.009] (-846.260) (-849.591) -- 0:00:53
172000 -- (-845.001) (-844.986) [-845.659] (-854.950) * (-846.223) (-846.486) (-851.464) [-846.801] -- 0:00:52
172500 -- [-846.638] (-847.690) (-846.910) (-853.516) * (-844.684) [-846.791] (-851.089) (-845.711) -- 0:00:52
173000 -- [-848.115] (-848.390) (-844.546) (-848.504) * [-847.807] (-845.518) (-847.108) (-845.833) -- 0:00:52
173500 -- [-848.715] (-846.589) (-847.971) (-848.649) * [-847.281] (-846.244) (-848.011) (-846.119) -- 0:00:52
174000 -- (-845.010) [-848.371] (-848.882) (-845.392) * (-847.428) (-844.882) [-847.782] (-844.450) -- 0:00:52
174500 -- [-845.400] (-845.917) (-846.164) (-845.293) * (-851.556) (-845.462) (-848.294) [-845.081] -- 0:00:52
175000 -- [-846.934] (-845.129) (-846.891) (-850.672) * (-846.426) (-845.421) [-845.607] (-846.230) -- 0:00:51
Average standard deviation of split frequencies: 0.023341
175500 -- (-844.567) [-844.931] (-848.605) (-850.515) * (-849.968) (-847.225) (-846.820) [-845.518] -- 0:00:51
176000 -- (-846.789) (-844.617) (-856.277) [-852.573] * [-848.086] (-846.310) (-844.470) (-845.729) -- 0:00:51
176500 -- [-846.517] (-845.434) (-850.551) (-849.852) * (-847.712) (-844.911) [-845.650] (-844.804) -- 0:00:51
177000 -- (-847.164) (-845.159) [-849.308] (-845.569) * [-851.215] (-847.697) (-845.329) (-848.737) -- 0:00:51
177500 -- (-848.891) (-849.686) [-846.556] (-845.653) * (-845.367) [-847.304] (-845.846) (-849.305) -- 0:00:50
178000 -- (-847.784) (-849.476) (-847.611) [-845.015] * (-845.257) (-845.650) (-847.438) [-846.963] -- 0:00:50
178500 -- (-846.857) (-846.257) (-846.446) [-846.194] * (-845.899) (-844.439) (-847.357) [-850.074] -- 0:00:50
179000 -- (-845.956) [-846.018] (-846.016) (-845.453) * (-845.022) (-844.997) (-847.410) [-848.672] -- 0:00:50
179500 -- (-848.475) (-846.324) [-845.777] (-849.403) * [-845.587] (-846.153) (-845.127) (-845.211) -- 0:00:50
180000 -- [-844.957] (-849.999) (-844.643) (-844.744) * (-845.533) [-845.894] (-849.740) (-846.927) -- 0:00:50
Average standard deviation of split frequencies: 0.023359
180500 -- [-844.947] (-845.173) (-844.822) (-849.323) * (-846.107) (-844.185) [-844.140] (-847.082) -- 0:00:54
181000 -- (-844.842) (-848.332) (-844.558) [-844.436] * (-847.121) (-844.716) [-845.450] (-850.333) -- 0:00:54
181500 -- (-846.848) (-848.829) (-849.122) [-846.344] * (-844.749) (-844.227) [-845.341] (-846.679) -- 0:00:54
182000 -- [-845.236] (-848.489) (-850.268) (-844.411) * (-845.011) [-848.075] (-844.936) (-846.795) -- 0:00:53
182500 -- (-844.888) [-847.371] (-846.633) (-844.505) * (-845.658) [-845.468] (-846.499) (-846.257) -- 0:00:53
183000 -- [-846.806] (-847.934) (-848.037) (-846.466) * (-848.507) [-846.279] (-845.899) (-844.385) -- 0:00:53
183500 -- (-847.370) [-845.853] (-849.389) (-845.827) * [-850.114] (-845.979) (-846.871) (-844.491) -- 0:00:53
184000 -- (-845.628) (-848.063) (-844.713) [-844.757] * (-849.139) (-845.174) (-846.849) [-848.777] -- 0:00:53
184500 -- (-845.196) (-846.720) (-845.887) [-849.608] * (-848.777) [-844.410] (-847.314) (-849.269) -- 0:00:57
185000 -- [-844.497] (-849.352) (-844.397) (-848.700) * (-845.160) [-847.806] (-846.009) (-845.270) -- 0:00:57
Average standard deviation of split frequencies: 0.022206
185500 -- (-846.155) (-846.012) [-844.660] (-845.790) * (-845.345) (-850.283) [-845.562] (-847.455) -- 0:00:57
186000 -- (-845.867) [-844.463] (-845.613) (-847.728) * (-846.654) [-847.394] (-844.100) (-854.871) -- 0:00:56
186500 -- (-845.382) [-845.572] (-846.868) (-847.036) * (-847.455) (-847.790) [-843.957] (-848.131) -- 0:00:56
187000 -- (-847.962) [-845.083] (-844.071) (-845.306) * (-847.855) (-848.913) (-844.645) [-847.134] -- 0:00:56
187500 -- (-848.303) (-849.575) (-847.366) [-844.249] * (-851.346) (-847.211) [-844.326] (-846.603) -- 0:00:56
188000 -- (-844.994) [-845.527] (-853.839) (-844.766) * [-847.055] (-844.621) (-846.944) (-846.657) -- 0:00:56
188500 -- (-848.035) [-846.993] (-848.057) (-844.251) * [-846.875] (-844.601) (-847.211) (-846.671) -- 0:00:55
189000 -- [-847.133] (-846.063) (-848.866) (-846.351) * (-850.009) (-847.495) (-845.349) [-847.516] -- 0:00:55
189500 -- (-845.235) (-848.847) [-844.715] (-844.613) * (-847.410) (-844.710) [-846.555] (-847.699) -- 0:00:55
190000 -- [-845.124] (-845.800) (-845.810) (-845.445) * (-850.005) (-846.650) (-852.054) [-847.036] -- 0:00:55
Average standard deviation of split frequencies: 0.024724
190500 -- (-847.147) (-845.303) (-847.205) [-844.628] * (-845.380) [-845.021] (-849.892) (-846.132) -- 0:00:55
191000 -- (-849.184) (-845.701) (-845.424) [-847.466] * (-845.201) [-844.564] (-848.366) (-847.783) -- 0:00:55
191500 -- [-846.520] (-847.087) (-848.380) (-847.617) * (-845.363) [-845.938] (-847.370) (-845.381) -- 0:00:54
192000 -- (-845.365) [-846.199] (-848.011) (-845.602) * (-844.747) [-844.529] (-845.353) (-846.488) -- 0:00:54
192500 -- (-846.805) (-846.288) (-845.817) [-844.431] * [-844.779] (-844.455) (-846.439) (-850.905) -- 0:00:54
193000 -- [-845.444] (-844.527) (-844.785) (-854.711) * (-847.703) [-844.568] (-844.929) (-845.916) -- 0:00:54
193500 -- (-847.512) [-845.044] (-848.152) (-848.165) * (-846.021) (-846.924) (-845.740) [-845.496] -- 0:00:54
194000 -- (-845.856) [-844.739] (-847.136) (-846.704) * (-844.768) (-850.360) (-845.018) [-847.191] -- 0:00:54
194500 -- (-847.844) [-844.911] (-846.909) (-845.788) * (-844.563) (-845.277) (-844.269) [-845.245] -- 0:00:53
195000 -- (-844.566) (-846.951) [-845.001] (-845.794) * (-844.768) (-848.533) [-845.008] (-846.974) -- 0:00:53
Average standard deviation of split frequencies: 0.024509
195500 -- (-845.337) [-847.951] (-846.835) (-845.251) * (-844.967) (-848.920) [-845.982] (-845.889) -- 0:00:57
196000 -- (-844.797) (-846.186) (-845.330) [-847.180] * [-845.903] (-847.961) (-848.229) (-846.104) -- 0:00:57
196500 -- [-847.799] (-845.275) (-845.276) (-848.368) * (-848.065) (-846.337) (-847.702) [-845.567] -- 0:00:57
197000 -- (-845.732) (-844.725) [-847.269] (-846.167) * [-845.791] (-845.549) (-846.080) (-845.339) -- 0:00:57
197500 -- (-847.578) (-845.395) (-844.939) [-846.045] * (-844.752) [-847.589] (-846.971) (-847.074) -- 0:00:56
198000 -- (-847.401) (-846.268) [-843.991] (-847.868) * (-844.248) (-848.432) (-846.243) [-844.362] -- 0:00:56
198500 -- [-847.409] (-847.000) (-844.676) (-845.834) * [-846.125] (-849.339) (-846.540) (-846.866) -- 0:00:56
199000 -- [-847.597] (-845.936) (-845.698) (-848.009) * (-845.324) (-847.491) (-844.935) [-846.753] -- 0:00:56
199500 -- (-848.435) (-847.528) (-847.704) [-847.641] * (-849.769) (-845.487) (-845.933) [-845.309] -- 0:00:56
200000 -- (-849.947) [-851.139] (-847.268) (-844.821) * (-848.776) [-848.414] (-846.088) (-844.389) -- 0:00:55
Average standard deviation of split frequencies: 0.024901
200500 -- (-850.315) (-844.564) [-847.698] (-846.750) * (-847.954) (-847.988) (-845.089) [-848.371] -- 0:00:55
201000 -- (-848.066) (-846.174) [-845.841] (-845.136) * (-846.520) (-845.030) (-847.901) [-844.293] -- 0:00:55
201500 -- (-850.248) [-846.052] (-845.929) (-848.209) * [-845.694] (-848.126) (-844.750) (-844.335) -- 0:00:55
202000 -- [-846.230] (-845.125) (-848.174) (-850.166) * (-845.821) [-845.853] (-846.590) (-845.912) -- 0:00:55
202500 -- (-848.438) (-855.060) (-848.173) [-846.580] * (-845.692) [-846.613] (-849.562) (-846.077) -- 0:00:55
203000 -- [-850.211] (-848.737) (-845.039) (-845.867) * (-844.389) [-844.934] (-848.342) (-845.561) -- 0:00:54
203500 -- [-845.964] (-844.448) (-846.835) (-846.507) * [-844.641] (-844.536) (-845.417) (-845.800) -- 0:00:54
204000 -- (-851.178) (-845.207) [-845.364] (-846.133) * (-845.474) [-845.866] (-848.761) (-847.180) -- 0:00:54
204500 -- (-848.231) [-844.504] (-846.525) (-847.161) * (-849.263) (-848.745) [-846.100] (-844.621) -- 0:00:54
205000 -- (-845.857) [-845.730] (-844.584) (-847.586) * (-851.980) (-844.983) (-845.041) [-846.609] -- 0:00:54
Average standard deviation of split frequencies: 0.022540
205500 -- (-846.756) (-846.316) [-845.451] (-848.632) * (-845.707) (-844.994) (-844.833) [-845.734] -- 0:00:54
206000 -- (-845.125) (-846.463) [-844.899] (-850.849) * (-845.375) (-847.247) (-845.778) [-846.560] -- 0:00:53
206500 -- (-846.075) [-847.661] (-845.804) (-848.805) * (-845.393) (-847.092) (-846.310) [-846.176] -- 0:00:53
207000 -- (-845.813) (-847.140) [-848.064] (-851.898) * [-845.474] (-845.967) (-847.577) (-845.035) -- 0:00:53
207500 -- [-846.787] (-846.289) (-849.595) (-851.307) * (-845.351) (-848.604) (-851.580) [-849.060] -- 0:00:53
208000 -- (-844.822) (-844.856) (-849.947) [-846.334] * (-846.346) (-849.021) [-846.396] (-847.849) -- 0:00:53
208500 -- (-844.681) (-846.583) (-845.961) [-845.445] * [-846.019] (-847.748) (-849.257) (-848.899) -- 0:00:53
209000 -- [-845.882] (-844.776) (-845.252) (-845.441) * (-845.503) [-846.648] (-845.712) (-844.453) -- 0:00:52
209500 -- (-845.935) [-847.678] (-848.743) (-845.322) * [-846.721] (-847.914) (-845.895) (-846.686) -- 0:00:52
210000 -- (-848.129) (-845.766) (-845.911) [-846.313] * [-845.242] (-849.105) (-845.235) (-845.292) -- 0:00:52
Average standard deviation of split frequencies: 0.023496
210500 -- (-847.165) [-845.144] (-848.850) (-844.796) * (-845.737) (-849.704) [-846.260] (-844.074) -- 0:00:52
211000 -- (-845.699) (-844.814) [-845.361] (-844.089) * [-844.912] (-848.496) (-848.018) (-846.837) -- 0:00:52
211500 -- (-849.485) [-844.718] (-845.167) (-848.144) * [-844.914] (-846.718) (-845.075) (-846.369) -- 0:00:52
212000 -- (-845.209) [-845.064] (-846.002) (-846.714) * (-844.842) (-848.675) [-845.224] (-845.869) -- 0:00:55
212500 -- (-844.549) [-847.210] (-846.634) (-848.173) * (-844.727) (-851.774) [-845.364] (-845.384) -- 0:00:55
213000 -- (-843.971) [-850.041] (-846.116) (-850.818) * (-846.193) [-844.512] (-845.299) (-847.955) -- 0:00:55
213500 -- (-848.858) (-851.134) [-848.918] (-849.730) * (-846.810) (-846.230) (-845.103) [-848.333] -- 0:00:55
214000 -- [-847.832] (-846.793) (-845.704) (-845.481) * [-845.857] (-844.803) (-851.616) (-847.304) -- 0:00:55
214500 -- [-845.028] (-845.401) (-847.530) (-844.662) * [-845.570] (-846.171) (-845.561) (-846.410) -- 0:00:54
215000 -- [-844.677] (-846.589) (-852.155) (-845.747) * (-846.715) (-848.206) [-848.586] (-844.752) -- 0:00:54
Average standard deviation of split frequencies: 0.023352
215500 -- (-847.412) [-845.671] (-845.748) (-847.940) * (-850.515) (-845.000) [-846.572] (-848.263) -- 0:00:54
216000 -- [-845.973] (-850.699) (-845.897) (-845.619) * (-845.815) (-845.278) [-846.251] (-846.713) -- 0:00:54
216500 -- (-846.954) (-847.170) (-845.992) [-848.761] * [-844.635] (-846.513) (-848.050) (-846.651) -- 0:00:54
217000 -- [-845.825] (-849.369) (-849.155) (-848.754) * (-847.424) (-848.570) [-845.014] (-845.185) -- 0:00:54
217500 -- [-844.490] (-847.919) (-848.259) (-850.828) * [-850.492] (-848.077) (-845.267) (-849.644) -- 0:00:53
218000 -- (-846.130) (-845.946) (-847.637) [-845.368] * (-852.151) (-845.075) (-846.907) [-845.066] -- 0:00:53
218500 -- [-845.586] (-850.250) (-845.426) (-846.081) * [-846.210] (-847.955) (-845.690) (-845.394) -- 0:00:53
219000 -- (-844.884) (-845.932) [-844.054] (-847.488) * [-846.305] (-846.115) (-845.772) (-846.624) -- 0:00:53
219500 -- (-845.590) (-845.331) [-846.356] (-846.453) * (-849.725) (-847.497) [-846.432] (-847.815) -- 0:00:53
220000 -- [-845.554] (-849.771) (-848.261) (-847.840) * [-844.890] (-845.138) (-849.250) (-849.253) -- 0:00:53
Average standard deviation of split frequencies: 0.022431
220500 -- (-846.693) (-845.662) (-845.760) [-845.224] * (-847.412) (-845.955) (-848.618) [-846.016] -- 0:00:53
221000 -- [-845.420] (-845.969) (-844.732) (-845.437) * [-845.823] (-846.422) (-849.371) (-846.992) -- 0:00:52
221500 -- [-848.144] (-845.477) (-845.102) (-844.679) * [-844.762] (-845.535) (-848.848) (-846.594) -- 0:00:52
222000 -- (-845.198) (-844.646) (-845.745) [-843.986] * (-846.173) (-845.535) [-845.711] (-845.883) -- 0:00:52
222500 -- (-847.410) [-845.523] (-849.912) (-845.142) * (-846.494) [-845.585] (-847.948) (-844.929) -- 0:00:52
223000 -- (-847.568) (-844.773) (-848.703) [-845.195] * (-846.039) [-844.772] (-846.645) (-845.457) -- 0:00:52
223500 -- (-849.214) (-846.607) (-846.690) [-845.839] * (-849.735) (-845.229) [-844.641] (-845.359) -- 0:00:52
224000 -- [-845.187] (-846.850) (-847.363) (-848.186) * (-845.795) (-847.179) (-847.754) [-844.335] -- 0:00:51
224500 -- (-846.027) (-850.443) [-844.013] (-847.083) * (-846.128) (-847.353) (-845.939) [-845.358] -- 0:00:51
225000 -- (-846.214) (-847.793) (-844.469) [-844.391] * (-845.308) [-845.610] (-850.650) (-845.153) -- 0:00:51
Average standard deviation of split frequencies: 0.020963
225500 -- [-846.649] (-846.814) (-844.982) (-846.250) * (-844.605) (-845.768) (-847.131) [-844.153] -- 0:00:51
226000 -- (-847.504) (-847.445) (-847.850) [-845.231] * (-848.555) [-844.218] (-846.039) (-845.008) -- 0:00:51
226500 -- (-846.124) (-848.602) (-849.679) [-845.653] * (-845.327) (-845.295) [-844.449] (-846.805) -- 0:00:51
227000 -- (-846.607) (-844.761) (-849.683) [-850.161] * (-846.256) (-845.119) (-846.908) [-845.606] -- 0:00:51
227500 -- (-846.373) (-846.740) [-847.789] (-848.112) * (-844.618) (-849.188) [-846.892] (-846.140) -- 0:00:54
228000 -- [-848.116] (-846.255) (-849.506) (-846.533) * (-844.671) (-849.496) (-847.910) [-845.415] -- 0:00:54
228500 -- (-844.977) [-846.832] (-844.950) (-845.178) * (-845.986) (-845.829) (-847.147) [-845.287] -- 0:00:54
229000 -- (-846.952) (-848.155) (-846.715) [-845.540] * (-845.974) (-845.675) [-844.471] (-846.271) -- 0:00:53
229500 -- (-847.329) (-845.026) (-846.081) [-848.545] * (-845.161) [-848.467] (-844.410) (-847.617) -- 0:00:53
230000 -- (-845.874) (-846.362) (-849.714) [-845.196] * (-845.210) [-845.354] (-844.659) (-848.011) -- 0:00:53
Average standard deviation of split frequencies: 0.019313
230500 -- [-848.146] (-846.443) (-846.650) (-849.468) * (-849.368) (-844.431) (-845.606) [-844.596] -- 0:00:53
231000 -- (-845.710) [-845.045] (-850.869) (-847.027) * [-845.551] (-845.296) (-847.424) (-845.545) -- 0:00:53
231500 -- (-846.248) (-845.845) (-845.277) [-846.514] * [-846.088] (-844.994) (-844.682) (-847.542) -- 0:00:53
232000 -- (-845.461) [-846.371] (-845.028) (-845.562) * (-848.509) (-846.701) (-844.488) [-845.666] -- 0:00:52
232500 -- (-847.937) (-846.526) (-847.749) [-846.841] * (-846.370) (-847.410) [-844.527] (-846.054) -- 0:00:52
233000 -- [-847.757] (-850.525) (-844.770) (-848.664) * (-847.477) [-847.633] (-844.835) (-846.216) -- 0:00:52
233500 -- (-849.101) (-847.281) [-845.087] (-846.272) * (-847.070) (-848.313) (-845.034) [-848.205] -- 0:00:52
234000 -- [-846.808] (-845.908) (-847.489) (-847.456) * (-847.883) [-848.254] (-848.330) (-848.118) -- 0:00:52
234500 -- (-845.127) [-844.809] (-846.854) (-846.094) * [-845.907] (-848.963) (-849.277) (-845.639) -- 0:00:52
235000 -- [-846.030] (-845.102) (-844.774) (-845.964) * [-845.576] (-849.841) (-848.606) (-844.641) -- 0:00:52
Average standard deviation of split frequencies: 0.018713
235500 -- (-847.985) [-846.664] (-847.970) (-847.335) * [-846.186] (-847.291) (-845.788) (-844.457) -- 0:00:51
236000 -- (-850.860) (-844.677) (-848.455) [-845.613] * (-845.391) (-845.200) (-846.686) [-849.776] -- 0:00:51
236500 -- (-847.961) (-844.852) [-846.096] (-844.472) * [-846.027] (-846.317) (-844.939) (-845.609) -- 0:00:51
237000 -- (-845.866) [-846.361] (-845.407) (-845.006) * (-844.341) (-845.927) (-847.416) [-849.047] -- 0:00:51
237500 -- (-846.405) [-845.583] (-845.678) (-844.148) * (-845.380) (-844.411) [-846.724] (-848.369) -- 0:00:51
238000 -- (-845.997) (-844.232) (-849.954) [-844.148] * (-845.961) (-848.381) [-847.432] (-845.700) -- 0:00:51
238500 -- (-847.646) (-846.835) (-852.522) [-844.148] * (-847.357) [-846.206] (-848.080) (-850.383) -- 0:00:51
239000 -- [-847.131] (-845.630) (-851.084) (-846.927) * [-846.449] (-846.847) (-846.532) (-849.243) -- 0:00:50
239500 -- (-846.989) (-850.904) [-846.452] (-846.690) * (-844.559) (-844.744) [-846.532] (-848.299) -- 0:00:50
240000 -- (-849.161) (-847.354) [-845.207] (-846.706) * (-845.109) (-845.077) (-844.849) [-848.053] -- 0:00:50
Average standard deviation of split frequencies: 0.019072
240500 -- (-846.290) (-848.976) (-845.097) [-845.152] * (-845.342) (-847.175) [-844.247] (-844.840) -- 0:00:50
241000 -- [-845.529] (-845.344) (-846.520) (-848.710) * (-848.023) (-844.624) [-845.021] (-846.897) -- 0:00:50
241500 -- [-845.749] (-845.955) (-845.143) (-849.899) * (-846.543) [-845.492] (-844.958) (-847.460) -- 0:00:50
242000 -- (-846.216) (-850.547) (-845.885) [-846.004] * (-845.551) [-846.010] (-846.023) (-847.206) -- 0:00:50
242500 -- (-847.142) (-857.100) (-846.321) [-846.337] * (-845.864) (-845.219) (-846.841) [-845.223] -- 0:00:49
243000 -- (-846.811) (-846.453) (-846.735) [-845.930] * (-844.726) [-844.169] (-846.843) (-845.063) -- 0:00:49
243500 -- [-844.782] (-844.097) (-845.278) (-845.835) * (-846.534) [-848.177] (-846.552) (-847.374) -- 0:00:49
244000 -- [-845.455] (-849.777) (-846.956) (-847.718) * (-848.285) (-845.134) [-844.463] (-848.414) -- 0:00:52
244500 -- (-846.458) (-846.691) [-846.087] (-847.294) * (-850.476) (-844.527) [-845.505] (-847.158) -- 0:00:52
245000 -- (-847.435) [-845.760] (-847.784) (-844.617) * (-846.065) [-844.671] (-845.564) (-848.539) -- 0:00:52
Average standard deviation of split frequencies: 0.019264
245500 -- [-844.906] (-846.714) (-847.646) (-845.500) * (-844.789) (-846.521) (-846.831) [-846.771] -- 0:00:52
246000 -- [-847.337] (-848.104) (-845.960) (-846.724) * (-844.885) (-851.473) (-844.008) [-848.911] -- 0:00:52
246500 -- (-845.233) (-846.570) [-845.325] (-845.877) * (-848.686) (-848.300) (-844.008) [-844.731] -- 0:00:51
247000 -- (-846.654) (-846.105) (-845.998) [-847.751] * (-848.853) [-846.606] (-844.968) (-846.285) -- 0:00:51
247500 -- (-847.263) (-846.925) (-847.533) [-848.025] * (-848.224) (-845.131) [-844.064] (-844.992) -- 0:00:51
248000 -- [-845.627] (-846.632) (-849.099) (-846.766) * (-846.314) (-844.580) [-844.919] (-844.614) -- 0:00:51
248500 -- [-844.691] (-845.958) (-856.527) (-848.759) * (-846.040) (-846.388) [-844.091] (-845.256) -- 0:00:51
249000 -- (-848.749) (-846.509) (-848.529) [-844.285] * (-848.261) (-845.376) (-847.750) [-849.046] -- 0:00:51
249500 -- (-848.184) (-848.396) (-848.055) [-848.735] * (-846.695) (-844.793) [-846.352] (-846.701) -- 0:00:51
250000 -- (-851.273) [-844.799] (-846.356) (-847.045) * (-845.359) (-845.763) [-845.941] (-844.112) -- 0:00:51
Average standard deviation of split frequencies: 0.018509
250500 -- (-845.326) [-844.763] (-845.412) (-849.074) * (-848.965) (-845.822) [-846.875] (-846.873) -- 0:00:50
251000 -- (-845.008) [-845.122] (-848.290) (-849.011) * [-846.240] (-847.132) (-847.538) (-846.696) -- 0:00:50
251500 -- (-848.523) (-849.540) [-844.246] (-850.200) * (-850.639) (-845.785) [-846.344] (-845.425) -- 0:00:50
252000 -- (-846.879) [-847.131] (-845.765) (-850.357) * [-846.444] (-844.906) (-845.276) (-849.901) -- 0:00:50
252500 -- (-847.477) (-847.409) (-845.614) [-846.387] * (-844.363) (-844.946) [-846.417] (-847.116) -- 0:00:50
253000 -- (-845.814) [-845.413] (-845.068) (-846.837) * [-844.290] (-844.810) (-845.656) (-844.428) -- 0:00:50
253500 -- (-846.797) [-845.283] (-845.567) (-849.911) * [-846.891] (-846.508) (-846.174) (-844.508) -- 0:00:50
254000 -- (-847.920) (-845.209) [-848.290] (-845.457) * [-847.817] (-844.568) (-845.028) (-844.797) -- 0:00:49
254500 -- (-855.590) (-846.031) [-845.787] (-848.024) * (-844.419) (-845.422) [-847.697] (-848.998) -- 0:00:49
255000 -- (-845.398) (-846.257) (-846.846) [-848.707] * [-845.447] (-848.306) (-845.543) (-845.578) -- 0:00:49
Average standard deviation of split frequencies: 0.018220
255500 -- (-845.559) (-845.267) [-847.049] (-846.286) * (-846.509) [-847.385] (-848.975) (-848.560) -- 0:00:49
256000 -- (-846.644) (-844.523) (-845.922) [-845.788] * (-845.980) (-855.337) (-850.268) [-847.158] -- 0:00:49
256500 -- (-848.679) (-850.092) [-847.332] (-845.069) * (-844.401) [-846.233] (-848.107) (-845.281) -- 0:00:49
257000 -- (-845.400) (-844.847) [-846.655] (-847.397) * [-847.062] (-845.111) (-846.015) (-848.172) -- 0:00:49
257500 -- [-846.050] (-846.123) (-849.000) (-845.885) * (-845.959) [-846.530] (-845.457) (-847.185) -- 0:00:49
258000 -- (-847.219) (-845.716) (-847.521) [-845.410] * (-844.488) [-846.048] (-848.670) (-845.283) -- 0:00:48
258500 -- (-846.486) (-846.793) (-846.300) [-845.008] * [-845.148] (-844.508) (-845.535) (-846.622) -- 0:00:48
259000 -- (-850.236) (-844.426) [-847.392] (-851.494) * (-846.785) [-845.967] (-846.300) (-851.097) -- 0:00:48
259500 -- (-845.053) [-849.041] (-846.356) (-856.399) * (-846.097) (-846.390) (-851.031) [-845.157] -- 0:00:48
260000 -- (-844.500) [-844.988] (-845.768) (-845.135) * (-851.449) (-846.381) (-849.017) [-843.870] -- 0:00:48
Average standard deviation of split frequencies: 0.017418
260500 -- (-845.523) [-844.044] (-846.367) (-847.553) * [-848.626] (-846.735) (-844.518) (-845.008) -- 0:00:51
261000 -- (-853.573) (-847.349) [-847.326] (-845.704) * (-846.947) (-844.682) [-844.141] (-847.422) -- 0:00:50
261500 -- (-848.648) (-844.494) (-850.268) [-845.642] * (-846.235) [-846.182] (-844.876) (-845.401) -- 0:00:50
262000 -- (-849.689) (-844.295) (-853.004) [-844.676] * (-847.741) (-850.722) [-844.759] (-847.124) -- 0:00:50
262500 -- [-850.366] (-844.454) (-848.148) (-847.068) * [-850.176] (-844.890) (-844.728) (-848.345) -- 0:00:50
263000 -- (-846.479) (-846.306) [-844.871] (-851.083) * [-846.745] (-844.291) (-844.723) (-845.486) -- 0:00:50
263500 -- (-845.751) (-845.111) [-846.029] (-848.038) * (-851.085) (-844.487) [-844.950] (-846.072) -- 0:00:50
264000 -- (-845.290) [-845.413] (-848.689) (-848.164) * (-848.511) [-845.189] (-843.950) (-846.010) -- 0:00:50
264500 -- (-844.807) [-846.979] (-847.659) (-848.018) * (-849.482) [-845.129] (-844.051) (-845.969) -- 0:00:50
265000 -- (-844.757) [-844.519] (-846.509) (-846.196) * (-845.802) [-849.519] (-845.537) (-846.889) -- 0:00:49
Average standard deviation of split frequencies: 0.015857
265500 -- [-845.964] (-848.449) (-845.499) (-847.676) * (-847.770) (-848.552) [-845.633] (-850.823) -- 0:00:49
266000 -- [-845.034] (-848.094) (-844.748) (-848.028) * (-845.913) (-846.417) [-844.813] (-848.343) -- 0:00:49
266500 -- [-846.204] (-848.538) (-845.666) (-846.427) * (-844.986) (-849.455) [-844.785] (-856.405) -- 0:00:49
267000 -- (-847.635) (-848.742) (-844.656) [-847.054] * (-847.048) (-847.161) [-845.318] (-847.078) -- 0:00:49
267500 -- (-844.733) (-845.029) (-845.998) [-844.571] * (-846.355) (-847.720) [-845.874] (-847.706) -- 0:00:49
268000 -- (-848.081) (-847.550) (-847.708) [-845.520] * [-846.769] (-845.653) (-847.061) (-850.838) -- 0:00:49
268500 -- (-850.290) [-845.737] (-844.742) (-845.532) * (-848.567) (-845.651) [-845.178] (-848.779) -- 0:00:49
269000 -- (-846.575) (-845.429) [-844.985] (-845.254) * (-847.813) [-849.012] (-846.342) (-850.521) -- 0:00:48
269500 -- [-846.121] (-847.767) (-847.068) (-846.233) * (-846.286) [-847.067] (-845.515) (-846.436) -- 0:00:48
270000 -- (-849.552) [-847.106] (-851.658) (-845.259) * (-845.687) (-846.431) [-849.374] (-851.387) -- 0:00:48
Average standard deviation of split frequencies: 0.016933
270500 -- (-845.143) [-846.959] (-845.859) (-845.744) * [-850.528] (-846.250) (-846.934) (-845.889) -- 0:00:48
271000 -- [-845.077] (-848.018) (-844.284) (-846.034) * (-846.915) (-846.412) (-848.338) [-845.506] -- 0:00:48
271500 -- (-845.434) (-846.225) [-846.201] (-845.338) * (-847.258) (-846.601) [-845.834] (-847.853) -- 0:00:48
272000 -- (-845.108) (-845.986) [-844.392] (-850.628) * (-846.221) (-850.951) [-847.471] (-845.522) -- 0:00:48
272500 -- (-845.670) (-846.090) [-845.946] (-844.261) * (-851.529) [-852.718] (-846.794) (-844.879) -- 0:00:48
273000 -- (-845.628) [-845.685] (-845.861) (-846.114) * (-848.201) [-846.121] (-846.257) (-845.536) -- 0:00:47
273500 -- (-847.500) (-845.543) (-844.719) [-846.065] * (-844.362) [-848.256] (-845.505) (-845.621) -- 0:00:47
274000 -- (-845.696) (-846.356) [-845.935] (-847.190) * (-846.685) (-845.975) [-845.963] (-844.912) -- 0:00:47
274500 -- (-846.368) (-848.185) [-845.519] (-845.937) * (-845.224) (-844.687) (-845.850) [-844.919] -- 0:00:47
275000 -- [-845.693] (-847.625) (-845.978) (-845.278) * (-845.742) (-845.452) [-845.505] (-847.332) -- 0:00:47
Average standard deviation of split frequencies: 0.015846
275500 -- [-845.300] (-846.167) (-848.355) (-846.765) * [-845.386] (-848.815) (-845.026) (-846.252) -- 0:00:47
276000 -- (-846.758) (-849.271) (-846.610) [-846.471] * (-846.651) (-844.813) [-845.026] (-846.445) -- 0:00:47
276500 -- (-845.662) [-846.987] (-848.526) (-846.597) * (-848.566) [-844.394] (-846.494) (-846.656) -- 0:00:47
277000 -- [-849.195] (-848.525) (-848.152) (-851.303) * (-850.898) [-845.985] (-847.872) (-849.083) -- 0:00:46
277500 -- (-845.834) (-849.843) (-845.376) [-848.900] * (-848.417) [-846.590] (-845.269) (-846.853) -- 0:00:49
278000 -- (-847.454) (-849.899) [-846.955] (-847.182) * (-848.049) (-847.378) (-848.487) [-845.874] -- 0:00:49
278500 -- (-848.762) (-846.116) [-845.478] (-849.729) * (-850.821) (-850.666) (-845.531) [-844.869] -- 0:00:49
279000 -- (-845.509) (-845.340) [-847.248] (-846.984) * (-846.087) (-852.489) (-845.752) [-845.937] -- 0:00:49
279500 -- (-847.128) (-850.640) (-847.653) [-846.439] * (-846.535) (-847.978) (-845.920) [-846.901] -- 0:00:48
280000 -- (-847.428) (-845.547) (-846.603) [-847.769] * (-853.143) (-846.813) [-844.426] (-847.880) -- 0:00:48
Average standard deviation of split frequencies: 0.016049
280500 -- [-846.247] (-845.001) (-847.218) (-846.469) * (-849.463) (-846.330) [-845.360] (-845.941) -- 0:00:48
281000 -- [-845.948] (-848.815) (-847.861) (-849.213) * (-845.579) (-844.546) [-844.639] (-844.073) -- 0:00:48
281500 -- (-846.993) (-845.270) [-848.330] (-849.823) * [-846.263] (-849.650) (-846.593) (-846.701) -- 0:00:48
282000 -- (-849.403) (-845.232) [-850.744] (-845.479) * (-844.901) (-847.016) [-850.076] (-845.877) -- 0:00:48
282500 -- (-845.368) (-848.398) (-845.913) [-845.852] * (-844.892) [-844.907] (-848.004) (-845.729) -- 0:00:48
283000 -- [-847.097] (-846.508) (-848.733) (-848.823) * [-844.457] (-848.462) (-850.700) (-848.386) -- 0:00:48
283500 -- [-847.340] (-846.660) (-847.509) (-844.947) * (-847.594) (-848.268) [-847.985] (-855.673) -- 0:00:48
284000 -- (-847.611) (-848.089) [-850.105] (-846.856) * (-846.061) [-845.595] (-848.063) (-850.369) -- 0:00:47
284500 -- [-848.928] (-846.338) (-851.582) (-848.170) * (-851.551) [-845.645] (-847.667) (-847.262) -- 0:00:47
285000 -- [-848.270] (-846.830) (-845.029) (-845.280) * (-846.391) (-845.384) [-847.398] (-846.727) -- 0:00:47
Average standard deviation of split frequencies: 0.017032
285500 -- (-846.686) (-846.454) (-853.859) [-850.062] * [-850.082] (-844.774) (-849.933) (-847.663) -- 0:00:47
286000 -- [-846.265] (-849.035) (-844.728) (-846.026) * (-845.283) [-844.937] (-847.083) (-846.279) -- 0:00:47
286500 -- (-845.861) (-845.132) (-845.397) [-845.903] * (-847.739) [-846.318] (-847.106) (-845.534) -- 0:00:47
287000 -- [-846.338] (-846.510) (-845.135) (-846.478) * (-846.222) (-847.214) (-846.229) [-846.209] -- 0:00:47
287500 -- (-845.109) (-845.156) (-844.830) [-845.159] * (-849.463) (-847.129) (-847.071) [-845.221] -- 0:00:47
288000 -- [-845.983] (-848.131) (-847.069) (-848.125) * (-845.153) [-847.013] (-845.193) (-845.926) -- 0:00:46
288500 -- (-844.773) (-848.379) [-850.331] (-847.909) * (-848.827) (-847.907) (-845.228) [-845.728] -- 0:00:46
289000 -- (-845.418) [-848.701] (-847.283) (-848.761) * (-852.355) [-845.281] (-847.633) (-846.709) -- 0:00:46
289500 -- (-845.019) (-845.653) (-845.390) [-846.078] * (-846.526) (-844.076) (-846.060) [-845.290] -- 0:00:46
290000 -- (-844.801) [-844.601] (-845.356) (-844.619) * [-845.818] (-846.808) (-847.860) (-845.274) -- 0:00:46
Average standard deviation of split frequencies: 0.016986
290500 -- (-846.657) (-847.234) (-847.770) [-845.849] * (-847.991) (-846.561) [-846.121] (-846.993) -- 0:00:46
291000 -- (-846.830) [-844.970] (-849.874) (-846.303) * (-845.911) (-845.997) [-844.313] (-844.752) -- 0:00:46
291500 -- [-845.503] (-847.630) (-846.817) (-846.297) * (-845.392) (-845.697) [-846.396] (-851.249) -- 0:00:46
292000 -- (-845.378) (-845.588) [-847.118] (-846.472) * [-846.220] (-846.161) (-846.915) (-846.753) -- 0:00:46
292500 -- [-849.184] (-846.131) (-847.345) (-848.289) * (-845.843) (-846.231) [-847.502] (-846.948) -- 0:00:45
293000 -- (-847.694) [-844.702] (-848.597) (-848.329) * (-849.664) [-846.689] (-844.673) (-844.708) -- 0:00:45
293500 -- (-847.168) (-845.299) [-847.235] (-846.986) * (-844.494) (-849.856) [-845.272] (-844.961) -- 0:00:45
294000 -- (-849.800) (-844.627) (-846.605) [-845.094] * (-844.783) (-846.873) [-845.656] (-848.285) -- 0:00:48
294500 -- (-848.944) (-845.773) (-845.389) [-844.830] * (-844.112) (-850.310) (-845.532) [-844.558] -- 0:00:47
295000 -- (-846.908) (-845.790) [-845.427] (-847.375) * (-845.208) (-848.826) [-845.964] (-845.990) -- 0:00:47
Average standard deviation of split frequencies: 0.016345
295500 -- (-845.314) (-847.815) [-845.401] (-848.004) * (-848.595) (-845.524) [-846.684] (-846.715) -- 0:00:47
296000 -- (-844.306) (-846.442) [-846.383] (-847.210) * (-848.627) [-846.087] (-844.735) (-846.120) -- 0:00:47
296500 -- (-844.625) [-847.064] (-846.062) (-845.607) * [-848.557] (-845.470) (-847.381) (-845.491) -- 0:00:47
297000 -- (-845.070) [-848.059] (-847.189) (-847.159) * (-845.630) (-845.371) [-849.140] (-845.937) -- 0:00:47
297500 -- (-849.695) (-849.376) [-844.285] (-846.892) * [-846.482] (-844.576) (-847.931) (-847.991) -- 0:00:47
298000 -- [-845.783] (-846.759) (-844.623) (-847.565) * (-845.769) (-844.514) [-847.362] (-846.976) -- 0:00:47
298500 -- (-852.552) (-847.718) [-844.412] (-845.956) * (-848.013) [-845.796] (-845.926) (-848.305) -- 0:00:47
299000 -- (-847.850) [-845.612] (-844.740) (-846.358) * (-846.492) (-845.106) [-845.229] (-847.853) -- 0:00:46
299500 -- (-849.046) [-844.471] (-847.644) (-845.900) * [-844.874] (-845.820) (-849.608) (-846.200) -- 0:00:46
300000 -- (-847.786) [-844.541] (-845.884) (-845.690) * (-845.024) [-848.210] (-846.115) (-846.032) -- 0:00:46
Average standard deviation of split frequencies: 0.016256
300500 -- (-849.053) (-844.553) [-847.894] (-845.793) * (-845.414) [-844.148] (-847.580) (-846.664) -- 0:00:46
301000 -- (-845.062) (-844.935) (-845.516) [-845.793] * (-845.538) (-844.018) [-845.611] (-844.886) -- 0:00:46
301500 -- (-845.284) (-845.011) (-845.209) [-845.283] * [-844.982] (-844.439) (-845.134) (-847.661) -- 0:00:46
302000 -- (-845.709) [-845.427] (-847.296) (-848.388) * (-845.018) [-845.365] (-844.980) (-847.149) -- 0:00:46
302500 -- (-847.235) (-847.015) [-845.797] (-847.314) * [-845.488] (-844.477) (-846.362) (-847.035) -- 0:00:46
303000 -- (-844.644) (-844.022) (-846.077) [-847.612] * [-847.094] (-845.219) (-854.766) (-846.568) -- 0:00:46
303500 -- [-846.430] (-844.701) (-845.481) (-846.015) * (-846.184) (-845.308) (-850.433) [-847.400] -- 0:00:45
304000 -- (-847.022) [-844.702] (-847.096) (-848.299) * (-846.288) [-845.641] (-848.103) (-847.437) -- 0:00:45
304500 -- (-847.113) [-844.999] (-845.215) (-846.397) * (-847.958) (-844.829) (-846.398) [-845.152] -- 0:00:45
305000 -- (-848.510) [-845.281] (-845.201) (-848.190) * (-844.801) [-846.384] (-843.965) (-852.613) -- 0:00:45
Average standard deviation of split frequencies: 0.016459
305500 -- (-845.534) (-847.090) [-845.473] (-851.664) * [-845.108] (-847.896) (-848.470) (-853.056) -- 0:00:45
306000 -- (-846.809) (-845.269) (-848.173) [-848.059] * (-850.864) (-845.339) [-844.517] (-848.880) -- 0:00:45
306500 -- (-846.679) [-846.403] (-845.862) (-845.549) * [-846.331] (-845.073) (-846.131) (-850.613) -- 0:00:45
307000 -- [-846.620] (-846.965) (-850.169) (-851.881) * (-850.514) (-845.799) (-847.042) [-846.308] -- 0:00:45
307500 -- (-847.495) [-846.666] (-845.432) (-850.505) * (-845.554) (-846.038) [-845.141] (-844.872) -- 0:00:45
308000 -- [-845.476] (-844.208) (-845.394) (-849.444) * [-845.345] (-844.848) (-845.618) (-845.537) -- 0:00:44
308500 -- (-848.936) [-846.461] (-847.137) (-848.953) * (-847.011) [-846.127] (-846.000) (-847.003) -- 0:00:44
309000 -- (-847.274) (-844.776) [-845.246] (-844.519) * (-846.164) (-844.638) (-849.461) [-845.560] -- 0:00:44
309500 -- (-844.741) [-845.239] (-845.161) (-847.018) * (-844.612) (-846.646) (-845.137) [-848.034] -- 0:00:44
310000 -- [-844.140] (-846.567) (-845.827) (-846.715) * [-844.378] (-847.205) (-845.200) (-845.597) -- 0:00:44
Average standard deviation of split frequencies: 0.015893
310500 -- [-843.913] (-847.666) (-847.702) (-846.931) * (-845.281) (-846.195) (-845.537) [-846.841] -- 0:00:46
311000 -- (-847.203) (-848.885) [-847.553] (-845.770) * (-845.667) [-844.423] (-844.775) (-848.346) -- 0:00:46
311500 -- (-845.217) (-846.331) [-848.669] (-846.672) * (-845.518) (-846.824) [-844.367] (-845.686) -- 0:00:46
312000 -- (-845.101) (-846.099) (-850.227) [-846.193] * (-851.949) (-845.032) [-844.952] (-845.584) -- 0:00:46
312500 -- [-845.698] (-846.157) (-849.866) (-847.209) * (-848.375) (-845.763) (-846.939) [-847.502] -- 0:00:46
313000 -- [-846.693] (-849.103) (-848.404) (-847.832) * (-846.092) [-846.428] (-844.713) (-846.484) -- 0:00:46
313500 -- [-847.232] (-850.264) (-849.504) (-853.185) * [-846.194] (-845.447) (-845.720) (-851.105) -- 0:00:45
314000 -- [-845.202] (-849.336) (-851.128) (-848.841) * (-845.428) [-844.957] (-848.295) (-844.625) -- 0:00:45
314500 -- (-844.338) (-850.595) [-848.364] (-851.645) * (-845.649) [-845.501] (-848.313) (-845.000) -- 0:00:45
315000 -- (-846.053) (-846.392) [-845.073] (-848.215) * (-847.557) (-844.962) [-847.823] (-849.080) -- 0:00:45
Average standard deviation of split frequencies: 0.015001
315500 -- (-849.236) (-844.719) (-848.838) [-844.969] * [-844.506] (-845.201) (-849.427) (-846.054) -- 0:00:45
316000 -- (-844.936) [-845.665] (-846.353) (-846.011) * (-844.764) [-847.166] (-846.255) (-846.992) -- 0:00:45
316500 -- [-844.477] (-846.061) (-845.687) (-846.040) * (-845.193) [-844.340] (-845.452) (-847.938) -- 0:00:45
317000 -- (-845.842) [-845.504] (-847.589) (-845.423) * (-845.190) (-846.737) (-844.532) [-849.627] -- 0:00:45
317500 -- (-847.618) (-844.676) (-845.048) [-845.893] * (-845.086) (-847.890) (-847.716) [-845.885] -- 0:00:45
318000 -- (-849.275) [-844.903] (-845.104) (-846.557) * (-845.410) [-845.090] (-847.841) (-847.924) -- 0:00:45
318500 -- (-849.314) [-846.272] (-847.355) (-845.998) * (-845.791) [-848.220] (-847.474) (-846.647) -- 0:00:44
319000 -- (-845.581) (-847.020) (-844.823) [-844.617] * [-845.250] (-844.077) (-847.395) (-846.642) -- 0:00:44
319500 -- (-845.157) (-848.602) [-846.281] (-847.123) * (-847.645) [-845.121] (-848.138) (-847.362) -- 0:00:44
320000 -- (-845.247) (-849.453) (-846.370) [-846.136] * [-844.672] (-845.902) (-848.724) (-846.187) -- 0:00:44
Average standard deviation of split frequencies: 0.013721
320500 -- [-848.265] (-845.603) (-854.748) (-848.005) * [-845.334] (-846.475) (-854.408) (-846.790) -- 0:00:44
321000 -- [-845.887] (-847.637) (-846.404) (-845.072) * (-847.287) (-848.467) [-844.499] (-845.858) -- 0:00:44
321500 -- [-845.939] (-848.656) (-845.906) (-846.685) * (-847.724) [-846.387] (-844.350) (-847.494) -- 0:00:44
322000 -- (-848.033) (-848.177) [-849.437] (-850.996) * (-847.254) [-847.643] (-845.608) (-847.958) -- 0:00:44
322500 -- (-854.542) [-847.684] (-846.592) (-852.327) * (-846.391) (-847.457) (-845.614) [-845.787] -- 0:00:44
323000 -- (-850.628) (-848.986) [-844.116] (-846.543) * (-845.610) (-846.934) (-846.992) [-845.286] -- 0:00:44
323500 -- (-847.058) (-850.362) (-845.786) [-845.668] * [-844.545] (-845.171) (-845.976) (-847.399) -- 0:00:43
324000 -- (-844.340) (-846.056) (-845.235) [-845.715] * [-844.374] (-844.700) (-847.114) (-848.041) -- 0:00:43
324500 -- (-847.063) (-845.908) (-847.338) [-845.127] * [-844.090] (-844.140) (-845.642) (-846.057) -- 0:00:43
325000 -- (-844.827) (-844.801) (-845.802) [-845.297] * [-848.068] (-844.453) (-844.780) (-846.217) -- 0:00:43
Average standard deviation of split frequencies: 0.013547
325500 -- (-845.254) (-848.955) [-848.110] (-847.508) * (-848.524) (-845.817) (-845.086) [-849.675] -- 0:00:43
326000 -- (-845.024) (-845.754) [-844.517] (-849.849) * (-845.715) (-846.070) [-845.030] (-846.633) -- 0:00:43
326500 -- (-844.644) (-846.207) [-845.132] (-850.365) * (-847.728) (-848.324) [-845.798] (-848.697) -- 0:00:43
327000 -- (-845.100) [-848.097] (-845.603) (-854.494) * (-845.341) (-851.452) (-845.653) [-844.891] -- 0:00:45
327500 -- [-847.319] (-849.343) (-845.637) (-845.742) * (-845.130) [-849.581] (-844.430) (-847.567) -- 0:00:45
328000 -- (-848.997) [-846.933] (-844.017) (-845.790) * (-845.104) (-847.492) (-848.474) [-845.297] -- 0:00:45
328500 -- (-846.799) (-846.824) (-849.082) [-846.413] * [-845.714] (-848.497) (-846.967) (-845.016) -- 0:00:44
329000 -- (-852.598) (-844.557) (-847.978) [-844.867] * (-844.883) (-850.765) (-847.238) [-846.779] -- 0:00:44
329500 -- (-849.355) (-844.531) (-844.991) [-846.774] * (-844.544) (-846.427) (-848.210) [-846.012] -- 0:00:44
330000 -- [-845.313] (-845.182) (-848.275) (-846.260) * [-844.376] (-845.161) (-846.585) (-847.083) -- 0:00:44
Average standard deviation of split frequencies: 0.013506
330500 -- (-845.093) (-845.763) (-846.191) [-844.725] * [-847.488] (-845.632) (-845.671) (-849.662) -- 0:00:44
331000 -- (-851.809) (-845.616) (-846.311) [-844.302] * [-847.449] (-846.918) (-845.360) (-850.220) -- 0:00:44
331500 -- (-846.816) [-845.202] (-846.708) (-848.545) * (-849.413) [-846.853] (-846.455) (-848.223) -- 0:00:44
332000 -- (-849.445) (-848.609) (-845.694) [-851.338] * [-850.688] (-847.847) (-847.415) (-847.549) -- 0:00:44
332500 -- (-848.336) (-849.009) [-844.833] (-849.621) * (-845.654) (-848.093) [-846.001] (-849.696) -- 0:00:44
333000 -- (-850.173) [-850.903] (-847.470) (-847.004) * (-844.372) [-845.687] (-846.790) (-845.849) -- 0:00:44
333500 -- [-844.168] (-846.764) (-847.488) (-848.999) * (-844.271) (-847.634) [-844.423] (-846.130) -- 0:00:43
334000 -- (-846.036) [-848.048] (-846.427) (-847.437) * (-852.194) (-847.501) [-845.860] (-848.675) -- 0:00:43
334500 -- (-845.992) (-846.208) [-844.490] (-845.603) * (-850.227) (-847.261) (-847.583) [-846.518] -- 0:00:43
335000 -- (-848.358) [-845.592] (-845.490) (-845.272) * (-849.317) (-846.436) [-844.439] (-844.490) -- 0:00:43
Average standard deviation of split frequencies: 0.013735
335500 -- [-848.595] (-852.017) (-845.010) (-846.675) * (-846.331) (-848.658) (-845.999) [-844.808] -- 0:00:43
336000 -- (-847.597) [-846.363] (-844.565) (-845.928) * (-846.127) (-848.823) [-847.550] (-845.077) -- 0:00:43
336500 -- (-849.450) (-844.583) (-847.030) [-846.324] * (-845.216) [-845.246] (-849.069) (-845.000) -- 0:00:43
337000 -- (-850.122) (-845.533) (-848.315) [-846.222] * [-846.136] (-847.325) (-848.333) (-850.081) -- 0:00:43
337500 -- (-845.310) (-846.168) [-847.116] (-850.202) * (-848.621) (-844.492) [-845.196] (-846.904) -- 0:00:43
338000 -- (-845.200) (-846.602) [-850.354] (-845.821) * (-845.431) (-847.308) (-847.542) [-846.837] -- 0:00:43
338500 -- (-847.220) [-845.320] (-845.342) (-847.875) * (-845.712) [-848.255] (-846.950) (-847.086) -- 0:00:42
339000 -- [-849.576] (-851.177) (-845.306) (-846.396) * (-846.145) (-845.203) (-846.466) [-850.054] -- 0:00:42
339500 -- (-846.144) [-847.952] (-847.785) (-845.103) * (-846.397) (-848.482) (-845.461) [-844.694] -- 0:00:42
340000 -- (-846.993) (-846.511) (-844.364) [-844.406] * (-850.772) (-848.472) [-845.362] (-849.731) -- 0:00:42
Average standard deviation of split frequencies: 0.013069
340500 -- (-844.562) (-852.377) [-845.040] (-849.521) * (-846.470) (-846.865) [-845.248] (-846.161) -- 0:00:42
341000 -- (-846.834) (-849.774) [-849.209] (-848.088) * (-848.128) (-847.994) [-845.168] (-846.700) -- 0:00:42
341500 -- (-846.646) [-844.407] (-847.406) (-845.951) * [-847.663] (-845.360) (-845.992) (-845.758) -- 0:00:42
342000 -- (-846.068) [-848.160] (-847.133) (-847.099) * (-847.040) (-851.418) (-845.610) [-844.412] -- 0:00:42
342500 -- (-852.439) (-845.805) [-846.125] (-845.707) * (-845.279) (-851.770) [-847.159] (-845.853) -- 0:00:42
343000 -- (-846.476) (-847.035) [-845.599] (-846.242) * (-844.290) [-847.816] (-846.707) (-845.456) -- 0:00:42
343500 -- (-848.879) [-847.172] (-846.802) (-845.922) * (-844.996) (-847.904) (-847.833) [-848.182] -- 0:00:43
344000 -- (-853.634) [-845.232] (-848.507) (-845.181) * (-849.226) (-849.179) [-848.734] (-849.911) -- 0:00:43
344500 -- [-846.806] (-845.732) (-847.100) (-845.996) * (-851.902) [-847.554] (-846.783) (-848.587) -- 0:00:43
345000 -- [-846.841] (-844.949) (-849.321) (-844.554) * [-848.165] (-848.510) (-845.290) (-849.649) -- 0:00:43
Average standard deviation of split frequencies: 0.012111
345500 -- (-845.369) (-845.462) (-848.550) [-843.957] * (-845.781) [-850.376] (-846.941) (-844.410) -- 0:00:43
346000 -- (-846.933) (-845.341) (-848.118) [-844.277] * [-845.310] (-845.372) (-848.091) (-844.401) -- 0:00:43
346500 -- [-845.357] (-845.885) (-847.068) (-845.441) * (-846.624) [-845.193] (-846.746) (-845.840) -- 0:00:43
347000 -- (-844.133) (-844.714) [-845.627] (-846.327) * [-844.912] (-845.133) (-846.670) (-847.514) -- 0:00:43
347500 -- (-845.684) (-846.873) [-845.809] (-846.342) * [-844.672] (-846.127) (-845.605) (-846.063) -- 0:00:43
348000 -- (-846.677) (-850.572) (-846.085) [-845.229] * (-846.660) [-847.626] (-845.238) (-844.548) -- 0:00:43
348500 -- (-849.276) (-845.746) [-846.011] (-845.858) * (-845.364) (-847.807) [-844.805] (-847.054) -- 0:00:42
349000 -- (-847.807) (-846.474) [-845.321] (-845.025) * (-846.399) [-846.602] (-844.633) (-847.866) -- 0:00:42
349500 -- (-845.138) (-849.040) [-847.666] (-844.841) * (-844.932) (-845.521) [-845.377] (-849.911) -- 0:00:42
350000 -- (-845.142) (-846.738) (-845.548) [-846.084] * (-849.159) [-845.182] (-845.265) (-847.161) -- 0:00:42
Average standard deviation of split frequencies: 0.011703
350500 -- (-847.337) (-845.194) [-847.681] (-844.684) * [-845.453] (-845.701) (-846.953) (-844.561) -- 0:00:42
351000 -- (-844.836) [-844.792] (-846.942) (-845.770) * (-846.897) [-849.147] (-845.426) (-844.409) -- 0:00:42
351500 -- (-845.477) (-846.470) [-845.686] (-845.642) * (-845.932) [-849.296] (-845.344) (-848.625) -- 0:00:42
352000 -- (-846.726) (-847.765) (-845.312) [-848.431] * [-845.181] (-847.537) (-845.627) (-846.664) -- 0:00:42
352500 -- (-845.544) [-847.793] (-844.819) (-844.548) * (-846.770) (-846.898) (-849.255) [-845.669] -- 0:00:42
353000 -- (-844.247) (-847.307) (-846.870) [-844.604] * (-845.083) [-845.096] (-846.589) (-844.423) -- 0:00:42
353500 -- (-846.012) (-846.074) [-844.216] (-847.224) * [-846.857] (-846.177) (-846.668) (-847.608) -- 0:00:42
354000 -- (-847.561) [-847.159] (-846.547) (-847.195) * (-845.837) [-845.779] (-848.535) (-848.055) -- 0:00:41
354500 -- [-845.350] (-846.257) (-845.653) (-845.766) * (-845.688) (-846.980) (-847.849) [-846.554] -- 0:00:41
355000 -- (-845.410) (-844.658) [-844.518] (-846.080) * (-846.090) (-846.380) (-849.574) [-846.253] -- 0:00:41
Average standard deviation of split frequencies: 0.011991
355500 -- (-849.374) (-846.440) (-849.613) [-845.700] * (-848.899) (-845.490) (-847.437) [-846.333] -- 0:00:41
356000 -- (-846.644) (-847.773) (-845.763) [-845.658] * [-846.264] (-845.731) (-847.420) (-844.689) -- 0:00:41
356500 -- (-846.536) (-849.019) (-848.768) [-846.605] * (-850.240) (-844.436) (-852.221) [-848.051] -- 0:00:41
357000 -- (-846.926) (-846.488) (-849.667) [-844.197] * [-844.740] (-844.241) (-852.052) (-846.984) -- 0:00:41
357500 -- (-847.902) (-846.316) (-846.707) [-847.577] * [-846.557] (-846.597) (-850.750) (-846.877) -- 0:00:41
358000 -- (-845.151) (-845.269) (-844.268) [-846.891] * [-844.693] (-847.310) (-844.686) (-846.004) -- 0:00:41
358500 -- [-846.513] (-847.129) (-845.328) (-847.639) * (-850.466) [-848.053] (-846.686) (-845.696) -- 0:00:41
359000 -- [-844.782] (-846.231) (-846.587) (-846.016) * (-844.746) (-845.587) (-847.059) [-844.769] -- 0:00:41
359500 -- (-849.330) [-844.834] (-845.377) (-847.750) * [-845.090] (-844.763) (-846.067) (-846.734) -- 0:00:40
360000 -- (-845.892) (-845.111) [-848.683] (-847.797) * [-849.597] (-844.276) (-847.878) (-845.414) -- 0:00:42
Average standard deviation of split frequencies: 0.010747
360500 -- (-846.264) (-846.090) [-845.176] (-844.935) * (-846.081) (-845.032) (-845.808) [-845.352] -- 0:00:42
361000 -- (-847.471) (-846.429) [-845.023] (-846.349) * (-845.837) (-845.707) (-844.819) [-848.046] -- 0:00:42
361500 -- (-846.519) (-848.000) [-845.448] (-845.045) * (-850.900) (-845.721) [-844.823] (-845.559) -- 0:00:42
362000 -- (-845.330) [-848.083] (-845.305) (-846.188) * (-846.459) (-848.461) [-848.522] (-845.052) -- 0:00:42
362500 -- (-847.449) (-848.622) (-849.220) [-846.727] * (-846.828) (-845.085) [-844.691] (-845.370) -- 0:00:42
363000 -- (-846.234) (-846.179) (-846.854) [-846.106] * (-852.550) [-845.087] (-845.189) (-845.954) -- 0:00:42
363500 -- (-845.057) (-846.208) (-846.954) [-844.330] * (-846.066) [-845.514] (-844.433) (-847.094) -- 0:00:42
364000 -- (-846.653) [-848.497] (-846.579) (-845.534) * (-847.276) (-847.634) [-849.128] (-847.715) -- 0:00:41
364500 -- (-847.570) (-844.600) [-846.794] (-846.105) * (-848.485) [-849.006] (-848.827) (-848.178) -- 0:00:41
365000 -- [-846.001] (-845.230) (-851.782) (-845.890) * [-844.861] (-844.523) (-845.675) (-847.282) -- 0:00:41
Average standard deviation of split frequencies: 0.011377
365500 -- [-849.827] (-846.448) (-846.374) (-852.834) * (-849.115) (-845.099) (-848.873) [-847.132] -- 0:00:41
366000 -- (-845.238) [-845.344] (-847.362) (-849.997) * (-848.910) (-845.159) [-846.314] (-848.213) -- 0:00:41
366500 -- (-846.217) (-845.458) (-845.510) [-849.974] * (-846.549) (-845.902) [-846.259] (-845.694) -- 0:00:41
367000 -- (-845.764) [-846.970] (-847.242) (-847.661) * (-845.297) (-845.304) [-845.762] (-849.250) -- 0:00:41
367500 -- [-845.420] (-844.813) (-846.780) (-847.463) * (-847.817) [-844.971] (-846.691) (-844.813) -- 0:00:41
368000 -- (-849.211) [-845.556] (-847.076) (-846.978) * (-850.024) (-853.872) (-845.886) [-849.022] -- 0:00:41
368500 -- (-847.157) (-845.632) (-845.709) [-844.678] * (-846.673) (-844.605) (-848.123) [-851.162] -- 0:00:41
369000 -- (-845.666) (-845.206) [-846.092] (-847.424) * (-847.127) (-845.499) (-845.837) [-846.180] -- 0:00:41
369500 -- (-845.039) (-845.333) [-846.078] (-846.669) * (-851.446) (-845.720) (-845.286) [-848.705] -- 0:00:40
370000 -- (-844.501) (-848.312) [-845.737] (-849.877) * (-847.990) (-845.197) [-844.912] (-848.303) -- 0:00:40
Average standard deviation of split frequencies: 0.011446
370500 -- [-847.119] (-845.992) (-850.553) (-849.764) * (-847.183) (-847.482) (-846.893) [-846.630] -- 0:00:40
371000 -- (-849.169) [-847.077] (-846.008) (-851.981) * [-848.210] (-849.690) (-847.046) (-849.621) -- 0:00:40
371500 -- (-845.824) (-849.591) (-844.443) [-844.381] * (-845.744) [-849.521] (-846.094) (-849.327) -- 0:00:40
372000 -- [-848.324] (-848.810) (-848.628) (-844.673) * (-846.874) [-844.672] (-847.186) (-851.846) -- 0:00:40
372500 -- (-844.902) [-846.650] (-850.656) (-847.408) * (-845.838) (-844.665) (-849.151) [-847.241] -- 0:00:40
373000 -- (-845.088) (-844.574) (-849.978) [-850.733] * (-847.091) [-844.844] (-846.344) (-845.116) -- 0:00:40
373500 -- [-844.695] (-844.834) (-845.483) (-848.238) * (-845.819) [-844.524] (-844.683) (-845.682) -- 0:00:40
374000 -- (-845.560) [-849.600] (-844.764) (-846.660) * (-845.486) (-844.343) [-845.086] (-845.537) -- 0:00:40
374500 -- (-846.188) (-845.347) [-847.205] (-844.376) * [-847.124] (-844.763) (-846.045) (-844.498) -- 0:00:40
375000 -- [-844.751] (-848.368) (-844.895) (-850.082) * [-844.654] (-850.043) (-850.657) (-847.042) -- 0:00:40
Average standard deviation of split frequencies: 0.011562
375500 -- [-846.510] (-846.017) (-846.975) (-846.384) * (-853.624) (-847.900) [-847.002] (-847.396) -- 0:00:39
376000 -- (-848.684) (-847.603) [-846.376] (-846.792) * (-847.425) (-845.107) (-847.630) [-845.848] -- 0:00:39
376500 -- (-846.909) (-847.258) [-850.357] (-848.477) * [-847.515] (-845.969) (-847.764) (-844.758) -- 0:00:41
377000 -- (-846.180) (-846.556) (-844.781) [-846.288] * (-847.203) (-845.777) (-846.937) [-845.740] -- 0:00:41
377500 -- [-846.146] (-847.333) (-848.269) (-845.720) * (-845.495) (-848.316) [-845.804] (-845.841) -- 0:00:41
378000 -- (-845.272) (-846.368) (-845.591) [-845.721] * (-845.595) (-845.854) [-844.840] (-844.073) -- 0:00:41
378500 -- [-844.849] (-848.793) (-845.670) (-851.289) * (-845.777) (-846.023) [-845.068] (-844.322) -- 0:00:41
379000 -- (-847.337) (-845.568) (-845.673) [-848.774] * [-846.054] (-845.292) (-844.836) (-844.907) -- 0:00:40
379500 -- (-848.381) (-848.435) [-848.524] (-852.944) * (-845.487) (-845.523) (-844.303) [-845.676] -- 0:00:40
380000 -- (-847.195) (-848.049) (-843.905) [-846.543] * (-845.515) (-845.585) [-845.215] (-845.676) -- 0:00:40
Average standard deviation of split frequencies: 0.011218
380500 -- (-845.825) (-844.208) (-846.732) [-851.628] * (-846.544) [-845.624] (-848.614) (-845.947) -- 0:00:40
381000 -- (-847.146) [-846.664] (-844.868) (-847.440) * (-849.150) (-846.370) [-846.231] (-848.644) -- 0:00:40
381500 -- (-848.105) [-845.609] (-845.523) (-848.018) * (-846.552) (-846.132) (-849.790) [-848.896] -- 0:00:40
382000 -- (-848.309) [-845.099] (-844.052) (-850.216) * (-845.485) (-845.895) [-844.885] (-845.709) -- 0:00:40
382500 -- (-845.964) [-844.046] (-845.416) (-845.238) * [-847.687] (-845.783) (-848.246) (-845.495) -- 0:00:40
383000 -- [-845.449] (-846.441) (-846.879) (-844.991) * (-845.894) [-846.699] (-848.889) (-847.084) -- 0:00:40
383500 -- (-849.785) [-845.480] (-846.948) (-844.250) * (-849.696) (-844.521) [-848.232] (-848.322) -- 0:00:40
384000 -- (-847.947) (-844.481) [-846.247] (-848.182) * (-845.964) (-847.317) [-848.328] (-846.724) -- 0:00:40
384500 -- [-844.343] (-847.177) (-849.294) (-846.106) * (-847.364) (-847.204) [-847.753] (-846.245) -- 0:00:40
385000 -- (-844.469) [-846.080] (-845.427) (-848.221) * [-845.075] (-846.270) (-844.263) (-846.841) -- 0:00:39
Average standard deviation of split frequencies: 0.011350
385500 -- (-847.265) [-846.925] (-846.755) (-845.246) * (-846.300) (-845.993) [-844.821] (-846.540) -- 0:00:39
386000 -- [-845.132] (-846.318) (-848.200) (-845.250) * (-846.212) (-847.894) (-847.143) [-845.306] -- 0:00:39
386500 -- (-844.940) [-845.939] (-848.293) (-844.278) * (-845.893) (-844.600) (-845.057) [-845.787] -- 0:00:39
387000 -- (-845.244) (-847.623) (-845.687) [-847.220] * [-844.677] (-846.398) (-845.057) (-846.895) -- 0:00:39
387500 -- (-844.565) (-844.307) (-845.384) [-847.044] * (-844.992) (-846.291) (-844.882) [-845.905] -- 0:00:39
388000 -- (-848.330) (-845.390) (-845.127) [-848.715] * (-847.451) [-848.492] (-846.290) (-847.805) -- 0:00:39
388500 -- (-845.131) [-845.215] (-846.112) (-847.190) * (-844.487) (-847.151) [-846.775] (-844.711) -- 0:00:39
389000 -- [-846.790] (-844.795) (-846.984) (-844.373) * (-845.252) (-847.705) [-846.433] (-844.426) -- 0:00:39
389500 -- (-846.449) (-845.279) [-845.974] (-844.582) * [-845.168] (-845.123) (-844.391) (-845.702) -- 0:00:39
390000 -- (-844.751) (-844.000) (-846.097) [-844.649] * (-845.139) [-847.099] (-846.622) (-849.313) -- 0:00:39
Average standard deviation of split frequencies: 0.011357
390500 -- (-845.339) (-845.735) (-846.668) [-846.025] * (-848.219) (-847.090) [-845.507] (-852.393) -- 0:00:39
391000 -- [-845.718] (-847.457) (-847.357) (-847.294) * (-846.670) (-850.939) [-844.405] (-848.904) -- 0:00:38
391500 -- (-845.070) (-844.203) (-847.013) [-850.691] * (-849.570) (-844.057) [-850.660] (-844.910) -- 0:00:38
392000 -- [-846.264] (-845.880) (-846.844) (-848.262) * (-847.888) (-846.900) [-845.751] (-844.797) -- 0:00:38
392500 -- (-846.996) (-846.216) (-846.868) [-847.120] * (-850.397) (-849.152) (-847.658) [-844.859] -- 0:00:38
393000 -- (-845.330) [-848.716] (-848.499) (-845.514) * (-846.423) (-846.795) [-845.836] (-845.764) -- 0:00:40
393500 -- [-847.215] (-845.734) (-844.495) (-846.717) * (-852.688) (-847.254) [-848.506] (-844.381) -- 0:00:40
394000 -- (-847.250) (-845.405) (-849.438) [-850.480] * [-851.400] (-846.233) (-846.533) (-845.718) -- 0:00:39
394500 -- (-846.343) [-845.088] (-847.295) (-847.112) * (-847.833) (-846.644) [-845.515] (-852.479) -- 0:00:39
395000 -- [-844.932] (-848.583) (-848.605) (-848.910) * [-849.143] (-845.904) (-845.096) (-847.728) -- 0:00:39
Average standard deviation of split frequencies: 0.010574
395500 -- (-846.312) [-847.867] (-845.882) (-848.736) * (-845.335) (-846.737) (-845.129) [-845.721] -- 0:00:39
396000 -- [-846.277] (-848.267) (-845.828) (-846.995) * [-848.259] (-844.425) (-845.663) (-846.285) -- 0:00:39
396500 -- [-845.157] (-846.657) (-847.609) (-849.714) * [-845.968] (-848.044) (-848.710) (-847.830) -- 0:00:39
397000 -- (-845.572) [-845.979] (-849.465) (-847.729) * (-846.967) (-848.966) (-846.573) [-845.367] -- 0:00:39
397500 -- (-847.656) (-845.607) (-846.986) [-847.135] * (-846.226) (-847.537) (-853.449) [-844.265] -- 0:00:39
398000 -- (-846.603) (-844.259) [-846.760] (-849.050) * (-846.585) [-853.554] (-845.394) (-846.452) -- 0:00:39
398500 -- (-847.640) [-846.812] (-846.100) (-845.316) * (-845.656) (-846.792) (-848.874) [-848.565] -- 0:00:39
399000 -- (-851.175) (-847.890) (-845.493) [-845.240] * (-846.287) [-846.412] (-847.662) (-846.376) -- 0:00:39
399500 -- (-846.403) [-844.859] (-844.532) (-846.320) * [-845.516] (-848.596) (-846.223) (-846.737) -- 0:00:39
400000 -- (-847.758) (-847.190) [-844.061] (-846.885) * (-846.716) (-844.447) (-846.362) [-846.748] -- 0:00:39
Average standard deviation of split frequencies: 0.010442
400500 -- (-845.660) (-847.160) (-851.503) [-846.300] * (-850.186) [-846.344] (-846.098) (-847.369) -- 0:00:38
401000 -- (-846.722) (-846.884) (-848.052) [-846.404] * (-845.388) [-846.393] (-848.934) (-853.306) -- 0:00:38
401500 -- [-844.847] (-846.497) (-845.886) (-846.076) * [-847.246] (-850.075) (-845.173) (-848.149) -- 0:00:38
402000 -- (-845.566) (-848.866) [-846.128] (-850.886) * [-846.884] (-845.954) (-845.429) (-846.346) -- 0:00:38
402500 -- [-844.969] (-845.309) (-845.408) (-845.579) * (-845.776) (-845.923) [-847.139] (-845.485) -- 0:00:38
403000 -- (-846.364) (-846.029) [-847.214] (-846.541) * [-846.617] (-853.105) (-846.951) (-846.819) -- 0:00:38
403500 -- (-846.560) [-846.917] (-848.418) (-845.841) * (-847.394) (-846.973) [-851.668] (-847.824) -- 0:00:38
404000 -- (-846.736) (-845.930) (-847.506) [-845.486] * (-848.837) (-846.035) [-845.104] (-846.740) -- 0:00:38
404500 -- (-845.471) (-847.321) (-846.699) [-845.760] * (-846.878) (-846.034) [-848.458] (-844.486) -- 0:00:38
405000 -- (-845.645) (-845.500) [-845.645] (-846.134) * [-846.479] (-846.020) (-847.712) (-845.885) -- 0:00:38
Average standard deviation of split frequencies: 0.009797
405500 -- (-851.334) (-845.064) (-844.739) [-845.894] * [-845.038] (-848.282) (-847.616) (-843.982) -- 0:00:38
406000 -- (-849.671) [-845.155] (-845.697) (-847.660) * (-849.797) [-845.304] (-850.802) (-847.281) -- 0:00:38
406500 -- (-847.036) [-844.060] (-845.622) (-847.438) * (-845.374) (-844.381) [-852.014] (-845.578) -- 0:00:37
407000 -- (-844.431) (-848.067) (-845.923) [-845.383] * (-846.232) (-846.080) [-845.989] (-846.913) -- 0:00:37
407500 -- (-847.012) [-846.432] (-848.340) (-845.941) * (-846.356) (-844.666) (-845.905) [-846.477] -- 0:00:37
408000 -- (-847.063) (-848.639) [-847.594] (-844.763) * [-845.025] (-845.884) (-846.684) (-848.259) -- 0:00:37
408500 -- (-851.741) (-846.587) [-845.110] (-847.770) * (-845.935) (-850.467) (-848.637) [-844.767] -- 0:00:37
409000 -- (-848.499) [-845.713] (-848.581) (-847.161) * [-845.839] (-848.252) (-848.225) (-847.871) -- 0:00:37
409500 -- (-847.379) (-846.553) [-847.345] (-850.864) * (-845.535) [-847.525] (-846.462) (-847.037) -- 0:00:38
410000 -- (-845.260) [-844.324] (-845.439) (-848.850) * (-845.087) (-846.259) (-846.019) [-851.003] -- 0:00:38
Average standard deviation of split frequencies: 0.009972
410500 -- (-848.146) (-845.055) [-845.948] (-844.997) * [-845.298] (-846.489) (-848.202) (-844.788) -- 0:00:38
411000 -- (-847.632) (-844.541) [-845.188] (-844.260) * (-846.774) (-848.195) [-847.314] (-846.347) -- 0:00:38
411500 -- (-852.838) (-847.326) (-845.177) [-845.590] * (-847.480) [-847.480] (-846.715) (-846.245) -- 0:00:38
412000 -- (-849.827) (-845.949) [-846.957] (-845.089) * (-846.760) [-847.418] (-846.136) (-848.296) -- 0:00:38
412500 -- (-850.176) (-848.475) (-847.409) [-846.522] * (-845.854) (-848.099) (-846.316) [-846.970] -- 0:00:38
413000 -- [-848.061] (-847.867) (-849.948) (-844.649) * (-847.246) [-845.814] (-845.292) (-845.218) -- 0:00:38
413500 -- [-845.949] (-848.904) (-845.489) (-845.199) * (-850.511) [-847.114] (-847.468) (-847.091) -- 0:00:38
414000 -- [-844.618] (-845.131) (-844.667) (-852.580) * (-849.729) [-845.959] (-844.295) (-846.003) -- 0:00:38
414500 -- (-846.640) [-847.335] (-846.984) (-851.980) * (-849.579) (-845.588) [-844.954] (-845.583) -- 0:00:38
415000 -- (-846.388) [-846.179] (-849.983) (-851.989) * [-849.452] (-846.562) (-845.076) (-847.261) -- 0:00:38
Average standard deviation of split frequencies: 0.009845
415500 -- [-852.710] (-846.809) (-846.076) (-847.341) * (-845.279) (-848.951) (-846.584) [-847.705] -- 0:00:37
416000 -- (-847.020) (-846.085) (-848.815) [-846.468] * (-844.272) (-846.617) [-844.603] (-845.188) -- 0:00:37
416500 -- (-848.994) (-845.772) (-844.407) [-846.215] * (-845.434) [-846.578] (-846.731) (-845.816) -- 0:00:37
417000 -- (-848.169) (-844.804) [-845.366] (-849.543) * (-852.264) (-847.134) (-844.607) [-844.745] -- 0:00:37
417500 -- [-844.474] (-847.642) (-847.787) (-853.263) * (-846.149) (-847.843) [-845.156] (-844.349) -- 0:00:37
418000 -- [-845.212] (-844.745) (-846.659) (-848.196) * (-844.578) (-851.040) [-845.775] (-844.440) -- 0:00:37
418500 -- (-847.929) (-845.614) (-846.642) [-847.488] * (-846.613) (-846.798) (-848.362) [-845.116] -- 0:00:37
419000 -- [-844.759] (-845.628) (-850.296) (-848.140) * (-845.884) (-848.565) (-848.346) [-845.556] -- 0:00:37
419500 -- (-844.965) (-844.730) [-848.831] (-846.861) * (-847.273) (-846.350) (-848.927) [-847.246] -- 0:00:37
420000 -- (-845.474) (-844.403) [-847.590] (-844.850) * (-848.217) (-845.204) (-848.478) [-844.644] -- 0:00:37
Average standard deviation of split frequencies: 0.009245
420500 -- (-846.340) [-846.989] (-848.304) (-844.363) * (-844.344) (-847.339) [-844.352] (-847.432) -- 0:00:37
421000 -- (-846.713) [-844.760] (-847.531) (-845.005) * (-845.926) (-847.646) [-844.660] (-845.759) -- 0:00:37
421500 -- [-844.530] (-845.970) (-847.376) (-844.664) * (-848.242) (-845.185) [-844.827] (-845.103) -- 0:00:37
422000 -- (-847.596) (-847.261) [-844.640] (-845.086) * (-845.786) [-845.059] (-844.115) (-845.042) -- 0:00:36
422500 -- (-848.398) (-847.619) (-844.884) [-845.769] * (-845.036) [-846.314] (-844.803) (-846.356) -- 0:00:36
423000 -- (-846.315) (-844.807) [-845.691] (-846.876) * (-844.465) (-845.985) (-848.012) [-845.861] -- 0:00:36
423500 -- [-846.826] (-847.991) (-849.265) (-846.036) * (-844.965) [-849.076] (-846.980) (-844.944) -- 0:00:36
424000 -- [-846.958] (-846.339) (-846.509) (-849.799) * (-847.021) (-849.621) (-847.374) [-846.950] -- 0:00:36
424500 -- (-846.010) (-847.006) (-844.901) [-850.754] * [-845.837] (-847.109) (-847.405) (-844.021) -- 0:00:36
425000 -- (-844.935) [-849.455] (-848.658) (-846.098) * (-845.938) (-846.030) (-844.520) [-844.014] -- 0:00:36
Average standard deviation of split frequencies: 0.009198
425500 -- (-845.266) (-846.547) [-844.524] (-846.908) * [-845.294] (-846.164) (-845.523) (-844.503) -- 0:00:36
426000 -- (-851.990) [-845.391] (-845.545) (-845.467) * (-845.656) [-845.339] (-845.858) (-846.477) -- 0:00:37
426500 -- (-850.990) [-847.407] (-844.795) (-848.430) * (-844.657) (-847.345) (-844.990) [-845.535] -- 0:00:37
427000 -- (-844.634) [-847.585] (-846.244) (-850.780) * [-846.653] (-849.537) (-849.079) (-844.536) -- 0:00:37
427500 -- (-849.677) [-844.805] (-851.414) (-844.757) * (-846.831) [-847.317] (-847.212) (-844.063) -- 0:00:37
428000 -- (-844.642) [-846.286] (-855.973) (-846.828) * (-844.514) [-848.258] (-847.716) (-844.072) -- 0:00:37
428500 -- (-847.766) (-846.934) [-850.949] (-845.748) * [-845.304] (-845.618) (-848.926) (-844.871) -- 0:00:37
429000 -- [-845.414] (-847.174) (-847.257) (-847.910) * (-846.089) (-844.304) (-845.175) [-845.333] -- 0:00:37
429500 -- [-846.505] (-847.111) (-846.949) (-846.420) * [-844.275] (-845.910) (-847.357) (-845.816) -- 0:00:37
430000 -- [-844.860] (-845.682) (-847.234) (-844.525) * (-845.420) [-846.926] (-848.781) (-847.201) -- 0:00:37
Average standard deviation of split frequencies: 0.009099
430500 -- (-854.539) (-849.424) [-844.798] (-846.192) * (-844.948) (-846.033) [-848.946] (-845.512) -- 0:00:37
431000 -- (-845.920) [-845.284] (-847.305) (-848.378) * (-846.332) (-848.046) [-846.183] (-845.546) -- 0:00:36
431500 -- (-846.922) (-844.952) (-851.595) [-847.146] * (-848.848) [-845.739] (-846.257) (-846.985) -- 0:00:36
432000 -- (-846.432) (-845.429) (-848.995) [-845.640] * [-849.843] (-848.592) (-849.571) (-846.346) -- 0:00:36
432500 -- (-847.498) [-844.421] (-846.377) (-847.953) * (-845.328) (-845.823) [-845.316] (-847.091) -- 0:00:36
433000 -- (-845.747) (-846.206) (-847.835) [-850.652] * (-844.778) (-846.161) [-847.280] (-846.650) -- 0:00:36
433500 -- [-845.236] (-846.730) (-846.357) (-845.269) * (-845.756) (-847.285) (-847.028) [-845.693] -- 0:00:36
434000 -- (-848.775) (-846.810) [-845.548] (-845.890) * (-845.007) [-849.059] (-847.266) (-846.361) -- 0:00:36
434500 -- (-844.960) [-844.855] (-846.140) (-844.368) * (-847.311) (-849.041) [-851.998] (-847.626) -- 0:00:36
435000 -- (-849.554) (-844.508) (-848.019) [-844.224] * (-849.053) [-847.036] (-844.586) (-845.399) -- 0:00:36
Average standard deviation of split frequencies: 0.009922
435500 -- [-845.512] (-849.325) (-848.999) (-844.598) * (-845.354) (-848.045) (-848.796) [-847.830] -- 0:00:36
436000 -- (-846.242) [-845.204] (-846.124) (-844.459) * (-846.880) [-846.564] (-846.385) (-845.421) -- 0:00:36
436500 -- (-845.066) [-845.731] (-846.682) (-846.380) * (-846.780) [-846.192] (-844.735) (-845.563) -- 0:00:36
437000 -- (-845.427) [-847.942] (-844.830) (-848.227) * (-845.523) (-847.404) [-845.444] (-844.964) -- 0:00:36
437500 -- (-849.248) (-847.021) (-848.579) [-845.259] * (-849.967) (-845.031) (-846.867) [-844.460] -- 0:00:36
438000 -- (-847.786) (-845.457) [-845.855] (-847.462) * (-847.995) [-846.063] (-845.113) (-846.913) -- 0:00:35
438500 -- (-846.761) (-847.101) (-844.673) [-847.946] * (-847.197) (-845.945) [-847.464] (-845.315) -- 0:00:35
439000 -- (-845.982) (-850.394) (-847.792) [-845.505] * (-846.013) (-849.987) [-846.558] (-845.315) -- 0:00:35
439500 -- (-843.998) (-848.293) [-845.106] (-845.044) * (-846.067) (-846.515) [-846.631] (-846.647) -- 0:00:35
440000 -- (-846.336) (-849.237) [-844.369] (-845.071) * (-845.442) (-845.267) [-846.419] (-844.098) -- 0:00:35
Average standard deviation of split frequencies: 0.008936
440500 -- (-845.625) (-848.169) [-844.663] (-845.519) * (-844.428) (-846.876) (-849.745) [-845.105] -- 0:00:35
441000 -- (-844.998) (-854.101) (-846.069) [-851.475] * (-844.549) (-847.059) [-844.496] (-846.339) -- 0:00:35
441500 -- [-847.887] (-845.804) (-847.366) (-846.488) * (-847.081) [-845.547] (-844.428) (-849.446) -- 0:00:35
442000 -- [-845.701] (-847.105) (-847.786) (-845.033) * (-846.475) [-847.782] (-845.042) (-849.218) -- 0:00:35
442500 -- (-847.704) (-847.031) (-846.239) [-844.821] * (-847.088) (-848.280) (-845.138) [-845.229] -- 0:00:36
443000 -- (-848.063) [-845.093] (-845.879) (-847.014) * (-847.355) (-849.297) (-844.989) [-848.013] -- 0:00:36
443500 -- [-847.358] (-845.264) (-845.168) (-846.653) * (-845.194) (-848.753) [-844.629] (-848.191) -- 0:00:36
444000 -- (-846.615) (-845.304) [-844.653] (-851.265) * (-844.434) (-847.950) [-847.299] (-848.396) -- 0:00:36
444500 -- (-846.105) (-846.298) [-849.932] (-848.343) * (-848.558) (-847.153) [-849.976] (-849.937) -- 0:00:36
445000 -- (-845.976) [-845.809] (-847.338) (-849.417) * (-846.561) (-847.248) (-848.042) [-847.849] -- 0:00:36
Average standard deviation of split frequencies: 0.008145
445500 -- (-845.920) (-844.941) (-852.643) [-845.258] * (-845.857) [-845.179] (-845.925) (-847.961) -- 0:00:36
446000 -- [-845.712] (-844.773) (-847.786) (-846.409) * [-847.240] (-847.471) (-844.824) (-844.769) -- 0:00:36
446500 -- (-845.615) (-844.206) (-845.606) [-844.839] * (-846.009) [-844.829] (-844.376) (-844.501) -- 0:00:35
447000 -- (-846.856) (-847.419) [-844.505] (-847.059) * (-847.696) (-846.771) [-844.381] (-844.712) -- 0:00:35
447500 -- (-847.439) (-849.451) (-846.360) [-845.153] * (-845.971) (-850.229) (-844.451) [-844.477] -- 0:00:35
448000 -- [-846.348] (-849.517) (-846.534) (-853.199) * (-846.356) (-849.786) (-844.329) [-847.114] -- 0:00:35
448500 -- (-844.807) (-847.447) [-849.364] (-845.509) * (-845.974) (-847.032) [-845.269] (-847.692) -- 0:00:35
449000 -- [-850.153] (-847.217) (-847.088) (-845.287) * (-846.758) (-850.316) (-849.889) [-844.937] -- 0:00:35
449500 -- (-848.242) [-844.492] (-848.961) (-844.655) * (-850.947) [-844.746] (-846.173) (-845.122) -- 0:00:35
450000 -- (-846.900) (-846.178) (-847.764) [-845.492] * (-844.049) [-845.462] (-845.201) (-849.987) -- 0:00:35
Average standard deviation of split frequencies: 0.007630
450500 -- [-844.934] (-847.216) (-846.770) (-846.584) * (-844.747) (-845.113) (-845.710) [-845.726] -- 0:00:35
451000 -- (-845.750) [-845.823] (-852.066) (-844.534) * (-845.639) (-845.684) (-845.298) [-845.502] -- 0:00:35
451500 -- (-845.058) [-845.071] (-846.664) (-845.579) * [-845.165] (-845.777) (-848.930) (-846.764) -- 0:00:35
452000 -- (-846.965) (-847.468) [-847.867] (-844.445) * (-845.221) [-846.107] (-845.639) (-844.973) -- 0:00:35
452500 -- (-846.351) (-846.612) [-851.491] (-850.674) * (-845.441) (-845.924) [-846.035] (-847.632) -- 0:00:35
453000 -- [-847.824] (-844.504) (-846.055) (-845.879) * (-845.334) [-847.218] (-847.672) (-845.486) -- 0:00:35
453500 -- (-852.943) (-845.406) (-850.539) [-848.359] * (-844.929) [-847.368] (-847.605) (-844.487) -- 0:00:34
454000 -- (-845.770) (-846.078) [-844.478] (-846.303) * (-847.349) [-846.122] (-848.067) (-847.246) -- 0:00:34
454500 -- (-847.100) [-847.901] (-845.902) (-845.109) * (-848.260) (-846.735) [-847.191] (-847.577) -- 0:00:34
455000 -- [-845.737] (-846.997) (-845.628) (-845.351) * (-844.470) (-845.249) [-849.088] (-846.303) -- 0:00:34
Average standard deviation of split frequencies: 0.007541
455500 -- (-850.865) (-846.162) (-844.101) [-844.713] * (-845.351) (-846.010) [-845.589] (-846.221) -- 0:00:34
456000 -- (-847.035) (-847.241) [-844.223] (-844.572) * (-845.248) (-845.393) (-847.124) [-845.309] -- 0:00:34
456500 -- [-847.333] (-846.050) (-844.717) (-844.343) * (-844.551) (-846.318) (-846.622) [-846.431] -- 0:00:34
457000 -- (-846.783) (-845.468) (-847.937) [-844.635] * (-848.383) (-845.476) (-844.390) [-844.729] -- 0:00:34
457500 -- (-852.472) (-845.241) (-850.441) [-846.854] * (-846.216) (-844.634) (-845.402) [-845.198] -- 0:00:34
458000 -- [-844.232] (-846.887) (-850.999) (-847.539) * [-846.910] (-844.554) (-845.633) (-849.668) -- 0:00:34
458500 -- (-843.961) (-845.094) (-844.576) [-844.043] * (-846.229) (-847.763) [-846.757] (-846.572) -- 0:00:34
459000 -- (-844.395) (-845.544) [-846.005] (-844.739) * (-847.092) (-846.486) [-848.367] (-846.553) -- 0:00:35
459500 -- [-853.344] (-844.656) (-846.365) (-848.446) * (-850.383) (-848.153) (-846.661) [-847.395] -- 0:00:35
460000 -- (-848.284) (-844.289) [-847.304] (-848.384) * (-846.302) [-845.609] (-844.992) (-846.421) -- 0:00:35
Average standard deviation of split frequencies: 0.008427
460500 -- (-847.837) (-845.665) [-845.081] (-851.238) * (-846.246) (-844.820) [-850.033] (-845.587) -- 0:00:35
461000 -- (-849.349) (-850.523) [-845.769] (-847.301) * (-845.600) [-845.975] (-847.818) (-849.681) -- 0:00:35
461500 -- (-847.173) (-847.617) [-846.156] (-846.825) * [-846.185] (-844.869) (-847.681) (-849.920) -- 0:00:35
462000 -- (-845.149) [-845.573] (-845.136) (-846.032) * (-844.327) [-844.478] (-845.258) (-848.768) -- 0:00:34
462500 -- [-847.263] (-844.697) (-845.590) (-844.440) * (-845.229) (-845.222) (-845.292) [-847.381] -- 0:00:34
463000 -- [-848.519] (-846.401) (-848.277) (-848.167) * (-846.845) [-844.623] (-845.627) (-847.969) -- 0:00:34
463500 -- [-845.574] (-846.170) (-845.648) (-847.507) * (-849.475) (-844.511) [-847.014] (-847.422) -- 0:00:34
464000 -- (-844.281) (-846.729) [-844.799] (-844.787) * [-850.572] (-846.611) (-846.175) (-848.927) -- 0:00:34
464500 -- (-845.584) [-846.650] (-845.094) (-844.978) * (-849.881) [-850.011] (-849.245) (-848.593) -- 0:00:34
465000 -- (-849.030) (-848.899) [-847.902] (-845.161) * (-846.279) [-845.902] (-849.321) (-846.413) -- 0:00:34
Average standard deviation of split frequencies: 0.009045
465500 -- [-850.188] (-844.904) (-845.287) (-846.037) * (-845.809) (-847.167) (-847.049) [-844.962] -- 0:00:34
466000 -- [-846.824] (-844.489) (-844.096) (-849.254) * [-845.434] (-847.781) (-846.252) (-844.714) -- 0:00:34
466500 -- (-847.725) (-844.105) [-848.226] (-846.447) * [-846.540] (-851.918) (-851.044) (-851.934) -- 0:00:34
467000 -- [-844.972] (-844.418) (-847.611) (-848.371) * [-844.580] (-851.159) (-848.946) (-847.481) -- 0:00:34
467500 -- [-844.794] (-845.251) (-846.974) (-845.087) * [-845.074] (-848.584) (-846.304) (-846.142) -- 0:00:34
468000 -- (-844.391) [-845.398] (-849.587) (-845.154) * (-846.026) (-846.354) (-848.557) [-846.189] -- 0:00:34
468500 -- (-844.258) [-848.137] (-844.372) (-846.534) * (-845.198) [-846.100] (-846.325) (-848.148) -- 0:00:34
469000 -- (-844.261) (-845.466) [-847.732] (-844.768) * (-847.281) (-849.973) [-847.092] (-846.742) -- 0:00:33
469500 -- (-846.645) (-844.647) [-844.995] (-844.734) * (-848.732) (-847.061) (-846.405) [-846.797] -- 0:00:33
470000 -- (-845.576) (-844.685) (-852.938) [-846.128] * (-848.029) [-847.520] (-845.524) (-846.551) -- 0:00:33
Average standard deviation of split frequencies: 0.009014
470500 -- [-844.857] (-848.975) (-847.575) (-844.870) * [-846.132] (-849.262) (-848.698) (-845.628) -- 0:00:33
471000 -- [-844.976] (-854.057) (-846.987) (-844.894) * (-845.917) (-845.493) [-845.118] (-845.540) -- 0:00:33
471500 -- (-850.567) [-850.369] (-845.596) (-846.899) * (-848.464) [-845.338] (-845.910) (-846.087) -- 0:00:33
472000 -- (-844.285) [-845.836] (-845.350) (-847.701) * (-850.775) (-846.904) (-844.721) [-848.089] -- 0:00:33
472500 -- (-845.954) [-844.903] (-847.428) (-844.366) * (-849.266) (-846.888) [-844.341] (-845.987) -- 0:00:33
473000 -- (-847.087) (-845.620) [-846.010] (-846.041) * (-850.739) (-848.036) (-847.889) [-846.590] -- 0:00:33
473500 -- (-844.656) [-845.116] (-845.703) (-846.014) * [-845.456] (-845.570) (-850.024) (-846.398) -- 0:00:33
474000 -- (-845.535) [-846.898] (-848.522) (-844.970) * (-846.014) (-845.396) (-847.157) [-844.858] -- 0:00:33
474500 -- (-844.543) (-847.226) (-849.714) [-844.719] * (-849.737) (-847.676) (-845.463) [-844.678] -- 0:00:33
475000 -- (-846.046) (-847.219) (-849.316) [-846.178] * (-845.292) (-844.314) [-844.683] (-847.891) -- 0:00:33
Average standard deviation of split frequencies: 0.008272
475500 -- [-845.734] (-845.932) (-846.581) (-849.637) * [-844.458] (-844.610) (-845.752) (-849.032) -- 0:00:34
476000 -- (-845.107) [-846.231] (-850.765) (-846.019) * [-844.732] (-845.025) (-845.932) (-847.125) -- 0:00:34
476500 -- (-848.154) (-845.438) (-847.679) [-846.012] * [-845.495] (-846.084) (-844.254) (-846.736) -- 0:00:34
477000 -- (-849.125) (-845.115) (-844.577) [-844.132] * (-845.908) (-851.108) [-844.363] (-852.135) -- 0:00:33
477500 -- (-849.830) (-845.065) [-846.021] (-847.519) * (-851.223) (-849.741) (-844.773) [-845.458] -- 0:00:33
478000 -- (-845.072) (-845.684) [-847.922] (-848.601) * (-846.826) [-848.386] (-849.205) (-845.222) -- 0:00:33
478500 -- (-847.050) (-850.240) (-845.629) [-845.320] * (-846.891) [-848.401] (-852.824) (-846.704) -- 0:00:33
479000 -- [-846.159] (-846.285) (-848.497) (-845.530) * (-847.534) (-847.538) [-850.665] (-846.383) -- 0:00:33
479500 -- [-845.114] (-846.762) (-848.877) (-847.497) * (-846.542) [-844.897] (-846.512) (-845.131) -- 0:00:33
480000 -- (-845.756) (-846.595) (-847.415) [-846.162] * (-846.840) [-845.393] (-845.762) (-846.463) -- 0:00:33
Average standard deviation of split frequencies: 0.007557
480500 -- (-844.758) [-847.926] (-845.839) (-851.703) * (-845.220) (-846.082) (-845.742) [-844.987] -- 0:00:33
481000 -- [-844.728] (-844.927) (-847.960) (-848.073) * (-847.524) (-845.076) (-846.055) [-845.235] -- 0:00:33
481500 -- (-845.793) (-847.920) (-850.004) [-846.556] * (-846.546) [-846.363] (-846.920) (-845.234) -- 0:00:33
482000 -- (-844.694) (-848.005) [-845.244] (-846.752) * (-845.139) [-850.310] (-846.530) (-844.631) -- 0:00:33
482500 -- [-844.034] (-847.927) (-846.297) (-849.015) * (-848.005) (-847.771) [-846.066] (-850.351) -- 0:00:33
483000 -- (-844.040) (-850.200) (-846.806) [-848.463] * [-845.096] (-848.504) (-844.383) (-848.193) -- 0:00:33
483500 -- (-844.040) (-847.219) (-846.620) [-845.187] * (-844.499) (-848.904) (-847.283) [-845.228] -- 0:00:33
484000 -- [-843.953] (-846.357) (-845.135) (-848.606) * (-850.442) (-847.346) [-845.232] (-845.326) -- 0:00:33
484500 -- (-845.206) (-844.039) (-846.142) [-846.689] * (-845.042) [-845.746] (-846.077) (-845.882) -- 0:00:32
485000 -- (-845.520) [-846.804] (-845.627) (-846.768) * (-846.763) [-844.756] (-846.428) (-845.844) -- 0:00:32
Average standard deviation of split frequencies: 0.008083
485500 -- (-846.083) (-847.954) (-845.296) [-846.751] * (-847.774) [-846.565] (-846.394) (-847.104) -- 0:00:32
486000 -- (-851.824) [-844.379] (-844.275) (-847.914) * (-848.174) (-850.716) [-846.693] (-845.901) -- 0:00:32
486500 -- [-847.088] (-844.314) (-844.383) (-849.765) * [-848.038] (-846.054) (-848.538) (-848.341) -- 0:00:32
487000 -- (-848.193) (-844.312) (-845.233) [-848.113] * (-846.297) (-844.811) [-846.480] (-852.777) -- 0:00:32
487500 -- (-845.438) [-846.613] (-845.601) (-847.312) * (-852.709) (-849.437) [-846.071] (-845.380) -- 0:00:32
488000 -- (-845.390) (-848.992) (-846.351) [-847.788] * (-848.086) (-845.234) (-847.754) [-845.516] -- 0:00:32
488500 -- [-847.033] (-852.535) (-846.203) (-846.540) * [-844.996] (-847.861) (-845.455) (-846.143) -- 0:00:32
489000 -- (-845.759) (-850.636) (-844.373) [-847.171] * (-845.523) [-844.601] (-844.871) (-844.906) -- 0:00:32
489500 -- (-846.672) (-844.378) [-846.364] (-845.402) * (-848.816) (-844.897) [-850.275] (-845.210) -- 0:00:32
490000 -- [-849.102] (-849.205) (-846.460) (-845.974) * [-844.420] (-845.320) (-845.174) (-845.403) -- 0:00:32
Average standard deviation of split frequencies: 0.007686
490500 -- (-848.219) (-849.393) [-846.638] (-845.934) * (-845.725) (-845.052) (-844.700) [-848.207] -- 0:00:32
491000 -- (-847.116) (-847.802) [-847.232] (-847.146) * [-845.821] (-846.755) (-844.387) (-846.259) -- 0:00:32
491500 -- (-845.805) (-848.117) [-845.839] (-846.105) * (-846.803) [-846.865] (-847.085) (-845.615) -- 0:00:32
492000 -- (-845.819) (-845.953) [-845.203] (-846.989) * (-849.063) [-844.478] (-846.593) (-845.055) -- 0:00:32
492500 -- (-850.450) (-846.520) [-846.203] (-846.665) * [-847.189] (-857.378) (-846.208) (-845.875) -- 0:00:32
493000 -- (-847.405) (-846.290) [-845.846] (-844.949) * [-846.954] (-850.554) (-846.258) (-846.326) -- 0:00:32
493500 -- (-847.485) (-847.039) (-846.452) [-844.955] * (-845.794) (-849.319) [-846.793] (-845.713) -- 0:00:32
494000 -- (-846.387) [-845.567] (-848.685) (-844.682) * (-847.759) (-848.184) (-846.115) [-846.566] -- 0:00:32
494500 -- [-846.889] (-847.878) (-845.633) (-844.432) * (-846.835) (-848.720) [-845.698] (-844.793) -- 0:00:32
495000 -- (-847.065) (-847.127) [-847.228] (-847.422) * [-846.941] (-852.112) (-844.207) (-848.008) -- 0:00:32
Average standard deviation of split frequencies: 0.007324
495500 -- (-845.072) (-846.732) (-844.834) [-845.524] * (-848.065) [-846.839] (-851.023) (-846.451) -- 0:00:32
496000 -- (-845.408) (-850.264) (-845.464) [-846.149] * [-846.765] (-846.474) (-848.124) (-847.049) -- 0:00:32
496500 -- (-846.058) [-846.016] (-845.239) (-844.893) * (-846.414) (-844.455) (-846.390) [-844.165] -- 0:00:32
497000 -- (-845.095) (-847.698) (-846.988) [-846.759] * (-848.777) (-847.469) [-846.849] (-845.220) -- 0:00:32
497500 -- (-845.168) (-850.651) (-847.675) [-846.006] * [-848.442] (-844.480) (-847.178) (-845.663) -- 0:00:32
498000 -- [-850.430] (-849.911) (-846.453) (-847.075) * (-848.210) (-845.348) [-846.140] (-845.375) -- 0:00:32
498500 -- (-845.698) (-851.136) (-849.397) [-844.821] * (-845.856) (-846.120) [-845.632] (-845.576) -- 0:00:32
499000 -- (-848.009) (-848.159) [-844.841] (-845.516) * (-844.550) (-846.310) (-844.374) [-847.595] -- 0:00:32
499500 -- (-846.298) (-848.783) [-843.991] (-845.771) * (-845.097) (-845.857) [-845.051] (-848.710) -- 0:00:32
500000 -- (-846.371) (-850.556) (-845.264) [-846.570] * [-844.395] (-847.344) (-849.554) (-847.482) -- 0:00:32
Average standard deviation of split frequencies: 0.007366
500500 -- [-846.482] (-847.477) (-844.120) (-846.684) * [-846.491] (-844.691) (-845.125) (-846.090) -- 0:00:31
501000 -- [-847.589] (-846.438) (-844.267) (-846.766) * (-846.946) [-846.824] (-845.098) (-847.337) -- 0:00:31
501500 -- (-844.793) (-845.362) [-845.806] (-847.133) * (-844.613) [-845.012] (-848.395) (-845.748) -- 0:00:31
502000 -- (-846.710) [-844.760] (-845.302) (-847.790) * (-845.714) [-847.976] (-846.297) (-848.891) -- 0:00:31
502500 -- (-849.405) (-849.094) [-845.805] (-845.182) * (-847.188) (-847.650) (-848.951) [-849.023] -- 0:00:31
503000 -- (-847.150) [-844.084] (-845.336) (-846.297) * (-849.295) (-845.785) [-849.980] (-853.155) -- 0:00:31
503500 -- [-844.482] (-844.720) (-844.065) (-846.093) * [-844.866] (-845.500) (-845.469) (-846.997) -- 0:00:31
504000 -- [-846.014] (-844.945) (-844.106) (-845.361) * [-848.905] (-844.748) (-850.957) (-854.037) -- 0:00:31
504500 -- (-846.133) [-845.576] (-845.513) (-850.201) * (-847.019) [-845.147] (-846.465) (-852.908) -- 0:00:31
505000 -- (-845.505) [-845.287] (-844.835) (-844.416) * (-844.333) (-848.777) [-846.421] (-848.369) -- 0:00:31
Average standard deviation of split frequencies: 0.007782
505500 -- (-844.450) (-847.623) (-845.144) [-844.961] * (-846.131) (-845.224) (-846.698) [-844.516] -- 0:00:31
506000 -- (-847.289) (-845.679) [-848.439] (-845.474) * (-845.545) [-845.220] (-846.206) (-846.219) -- 0:00:31
506500 -- (-845.045) (-845.527) [-846.123] (-850.262) * (-846.198) (-845.220) [-844.943] (-847.707) -- 0:00:31
507000 -- (-848.469) (-845.509) (-846.153) [-851.410] * (-849.177) (-845.838) (-845.941) [-844.818] -- 0:00:31
507500 -- (-849.507) (-845.094) (-845.660) [-848.175] * (-845.784) (-846.262) [-845.400] (-849.560) -- 0:00:31
508000 -- (-846.229) (-844.874) (-845.391) [-845.095] * (-846.441) (-849.404) (-846.379) [-845.719] -- 0:00:30
508500 -- (-846.917) (-846.503) [-846.669] (-846.002) * [-847.936] (-850.701) (-844.709) (-845.589) -- 0:00:30
509000 -- (-845.813) (-845.076) (-846.023) [-848.775] * (-846.719) (-846.055) [-845.217] (-845.187) -- 0:00:31
509500 -- (-845.246) (-845.389) [-845.904] (-849.457) * (-847.427) (-845.937) (-845.161) [-844.841] -- 0:00:31
510000 -- (-847.823) (-849.160) (-847.404) [-845.435] * (-847.848) (-845.082) (-844.576) [-849.278] -- 0:00:31
Average standard deviation of split frequencies: 0.007548
510500 -- [-846.097] (-845.401) (-845.580) (-847.240) * (-848.913) (-844.283) [-845.849] (-846.034) -- 0:00:31
511000 -- (-845.514) (-845.239) (-848.875) [-846.101] * (-848.426) (-844.202) [-846.163] (-844.647) -- 0:00:31
511500 -- (-847.158) (-850.120) [-846.965] (-846.327) * (-846.545) (-848.574) (-849.786) [-846.605] -- 0:00:31
512000 -- [-845.491] (-847.496) (-849.725) (-853.282) * [-844.576] (-846.306) (-846.309) (-844.895) -- 0:00:31
512500 -- (-847.245) (-845.737) [-845.564] (-848.665) * (-844.588) [-846.141] (-849.056) (-845.652) -- 0:00:31
513000 -- (-846.277) [-845.558] (-846.221) (-846.142) * (-845.816) [-847.204] (-846.385) (-847.947) -- 0:00:31
513500 -- [-844.223] (-850.802) (-850.182) (-846.244) * (-845.312) [-846.745] (-845.980) (-845.576) -- 0:00:31
514000 -- (-845.319) (-845.763) (-850.171) [-846.044] * (-844.955) (-846.228) [-845.797] (-847.472) -- 0:00:31
514500 -- (-845.346) (-846.870) (-852.098) [-845.845] * (-845.979) [-846.114] (-844.736) (-844.637) -- 0:00:31
515000 -- (-846.715) [-844.982] (-848.054) (-845.486) * (-845.401) [-845.546] (-846.102) (-844.637) -- 0:00:31
Average standard deviation of split frequencies: 0.006932
515500 -- [-844.624] (-847.605) (-850.671) (-845.533) * (-849.308) (-845.741) (-846.842) [-845.169] -- 0:00:31
516000 -- (-844.616) [-846.212] (-849.196) (-847.285) * (-853.804) (-844.900) [-845.297] (-846.349) -- 0:00:30
516500 -- (-846.275) [-846.126] (-846.187) (-844.944) * (-847.619) (-846.404) (-844.178) [-846.283] -- 0:00:30
517000 -- (-847.310) (-847.454) (-845.628) [-845.810] * (-850.881) (-845.993) [-844.204] (-848.285) -- 0:00:30
517500 -- (-848.375) (-847.272) (-848.727) [-845.736] * (-852.375) (-846.310) [-847.875] (-845.221) -- 0:00:30
518000 -- (-846.735) (-844.075) [-847.012] (-845.998) * (-845.080) (-847.776) [-848.569] (-845.395) -- 0:00:30
518500 -- (-852.580) (-848.378) [-845.353] (-845.771) * (-845.378) [-845.605] (-847.355) (-848.414) -- 0:00:30
519000 -- (-845.975) [-848.077] (-851.885) (-846.812) * (-845.629) (-846.170) (-848.770) [-851.137] -- 0:00:30
519500 -- (-845.246) (-847.459) [-848.533] (-847.002) * (-849.705) (-845.647) [-847.916] (-847.045) -- 0:00:30
520000 -- [-845.316] (-848.782) (-849.290) (-845.367) * (-849.333) [-844.869] (-847.363) (-847.544) -- 0:00:30
Average standard deviation of split frequencies: 0.007243
520500 -- [-846.398] (-847.628) (-849.407) (-848.779) * (-844.857) [-848.678] (-847.117) (-846.068) -- 0:00:30
521000 -- (-848.259) (-847.850) [-845.951] (-854.402) * (-849.027) (-849.816) (-845.681) [-845.959] -- 0:00:30
521500 -- (-844.852) (-848.190) (-847.274) [-845.681] * (-847.411) (-847.447) (-851.983) [-845.294] -- 0:00:30
522000 -- (-844.710) (-852.524) (-846.961) [-846.423] * (-847.621) (-847.086) (-845.090) [-847.736] -- 0:00:30
522500 -- [-846.791] (-846.366) (-845.824) (-845.721) * [-845.175] (-845.072) (-845.452) (-849.867) -- 0:00:30
523000 -- (-845.567) (-846.425) [-845.295] (-846.668) * (-848.325) [-848.432] (-844.198) (-847.346) -- 0:00:30
523500 -- (-844.495) [-849.171] (-844.279) (-847.904) * [-848.286] (-845.757) (-845.703) (-846.293) -- 0:00:30
524000 -- (-845.058) [-846.311] (-845.581) (-844.680) * (-846.653) (-845.691) (-846.069) [-845.354] -- 0:00:29
524500 -- (-845.762) (-845.530) (-846.639) [-845.498] * (-845.762) (-845.224) (-848.397) [-846.791] -- 0:00:29
525000 -- (-847.200) (-852.141) (-844.931) [-847.648] * (-845.836) (-845.830) [-845.444] (-848.724) -- 0:00:29
Average standard deviation of split frequencies: 0.008016
525500 -- [-848.240] (-845.106) (-844.585) (-850.382) * (-845.852) (-844.567) (-848.385) [-849.611] -- 0:00:30
526000 -- (-846.590) (-846.782) [-847.950] (-851.940) * (-845.648) (-847.556) [-851.041] (-846.211) -- 0:00:30
526500 -- (-844.489) (-846.286) (-851.189) [-845.963] * [-845.821] (-846.064) (-845.133) (-846.151) -- 0:00:30
527000 -- (-848.084) (-847.436) (-849.510) [-849.063] * (-847.973) [-846.298] (-845.074) (-848.028) -- 0:00:30
527500 -- (-846.185) (-846.540) (-849.639) [-846.132] * (-844.450) (-848.316) (-847.617) [-844.189] -- 0:00:30
528000 -- (-847.669) [-846.047] (-846.176) (-847.002) * (-846.118) [-847.303] (-850.335) (-847.792) -- 0:00:30
528500 -- (-845.947) (-847.075) [-849.223] (-845.767) * [-844.969] (-846.818) (-845.217) (-847.879) -- 0:00:30
529000 -- (-845.383) [-852.338] (-845.939) (-847.155) * (-844.787) (-846.672) (-846.098) [-845.357] -- 0:00:30
529500 -- (-846.413) (-846.466) (-847.276) [-845.470] * (-847.391) (-847.900) [-845.430] (-845.657) -- 0:00:30
530000 -- [-845.645] (-846.191) (-847.770) (-846.044) * (-847.125) (-849.126) (-845.275) [-845.398] -- 0:00:30
Average standard deviation of split frequencies: 0.007838
530500 -- (-847.541) (-845.287) [-845.061] (-845.698) * [-846.272] (-844.892) (-846.217) (-845.407) -- 0:00:30
531000 -- (-849.455) (-844.673) [-844.216] (-847.026) * (-846.019) [-844.974] (-846.949) (-848.826) -- 0:00:30
531500 -- (-847.305) (-845.465) (-845.640) [-846.116] * [-845.028] (-844.576) (-845.719) (-847.029) -- 0:00:29
532000 -- [-846.103] (-845.368) (-844.889) (-846.535) * (-846.948) (-846.639) [-845.417] (-844.466) -- 0:00:29
532500 -- [-845.191] (-849.020) (-848.100) (-848.059) * (-848.361) [-845.056] (-845.109) (-844.393) -- 0:00:29
533000 -- (-845.527) (-845.806) (-846.576) [-848.603] * [-847.379] (-846.963) (-844.919) (-848.676) -- 0:00:29
533500 -- (-845.299) [-847.310] (-849.704) (-847.770) * (-845.298) [-845.460] (-846.608) (-845.163) -- 0:00:29
534000 -- (-848.679) (-847.924) [-850.732] (-846.693) * (-846.856) (-846.213) (-847.733) [-845.469] -- 0:00:29
534500 -- (-847.459) [-844.312] (-845.255) (-847.318) * (-848.470) (-845.825) (-845.936) [-844.320] -- 0:00:29
535000 -- [-845.149] (-845.587) (-845.483) (-846.445) * (-844.719) (-848.886) (-847.216) [-847.191] -- 0:00:29
Average standard deviation of split frequencies: 0.008019
535500 -- (-848.205) (-850.800) (-846.801) [-844.965] * (-845.794) (-845.886) (-851.448) [-847.397] -- 0:00:29
536000 -- (-845.472) (-845.302) [-847.189] (-847.788) * (-845.096) [-846.815] (-846.448) (-846.470) -- 0:00:29
536500 -- [-846.032] (-848.134) (-845.178) (-848.469) * (-844.221) (-846.744) (-846.161) [-845.219] -- 0:00:29
537000 -- [-845.464] (-846.121) (-845.697) (-849.579) * (-845.584) (-845.865) (-846.097) [-845.499] -- 0:00:29
537500 -- (-846.593) (-846.742) [-846.475] (-849.111) * [-849.274] (-847.517) (-845.643) (-845.469) -- 0:00:29
538000 -- (-845.480) (-847.262) (-844.687) [-845.874] * (-851.749) [-845.043] (-845.509) (-848.336) -- 0:00:29
538500 -- (-845.804) [-844.809] (-845.117) (-844.538) * (-847.221) [-845.399] (-846.498) (-848.173) -- 0:00:29
539000 -- (-848.468) [-848.182] (-844.700) (-847.589) * (-845.059) (-846.192) [-845.230] (-844.757) -- 0:00:29
539500 -- (-847.582) (-852.582) [-846.320] (-846.189) * (-846.440) (-845.976) (-844.431) [-847.045] -- 0:00:29
540000 -- (-847.166) (-846.233) (-845.365) [-845.717] * (-847.271) (-846.964) [-846.673] (-846.382) -- 0:00:28
Average standard deviation of split frequencies: 0.008309
540500 -- (-845.662) [-845.208] (-845.112) (-845.633) * (-844.926) (-846.725) [-846.264] (-846.662) -- 0:00:28
541000 -- (-846.916) (-846.741) [-846.852] (-846.558) * (-846.066) [-849.331] (-844.780) (-844.696) -- 0:00:28
541500 -- [-845.736] (-846.774) (-847.102) (-847.968) * (-846.070) (-845.453) [-846.700] (-846.560) -- 0:00:28
542000 -- (-846.804) (-846.769) (-847.049) [-849.113] * [-846.470] (-844.616) (-848.378) (-845.386) -- 0:00:28
542500 -- (-844.701) [-845.629] (-845.322) (-845.059) * [-846.636] (-844.767) (-847.614) (-845.888) -- 0:00:29
543000 -- [-845.697] (-844.799) (-844.803) (-845.811) * (-846.481) (-844.643) (-848.807) [-849.170] -- 0:00:29
543500 -- (-844.583) (-850.557) [-844.984] (-846.045) * [-846.421] (-848.657) (-848.184) (-846.124) -- 0:00:29
544000 -- [-845.302] (-846.883) (-845.167) (-848.935) * (-847.239) [-848.189] (-850.386) (-845.055) -- 0:00:29
544500 -- (-847.805) [-845.323] (-847.055) (-844.626) * (-844.468) [-846.901] (-846.568) (-844.884) -- 0:00:29
545000 -- (-845.043) (-844.903) [-845.174] (-846.054) * (-845.749) [-846.833] (-846.824) (-846.486) -- 0:00:29
Average standard deviation of split frequencies: 0.008329
545500 -- (-845.601) [-848.119] (-845.173) (-844.700) * (-845.280) (-843.991) [-848.348] (-845.392) -- 0:00:29
546000 -- [-845.570] (-845.662) (-846.582) (-846.917) * (-847.160) (-844.940) (-846.977) [-845.278] -- 0:00:29
546500 -- [-846.465] (-846.426) (-845.922) (-847.411) * [-846.459] (-847.332) (-844.257) (-845.435) -- 0:00:29
547000 -- [-845.315] (-846.628) (-845.203) (-848.366) * [-844.923] (-847.044) (-844.339) (-847.766) -- 0:00:28
547500 -- (-845.260) (-847.394) [-846.231] (-847.019) * (-846.715) (-844.604) [-845.231] (-848.222) -- 0:00:28
548000 -- (-845.277) (-845.875) (-844.974) [-845.372] * (-847.179) [-844.550] (-849.277) (-845.221) -- 0:00:28
548500 -- (-847.578) (-845.998) [-845.993] (-845.493) * (-846.927) (-853.636) (-851.481) [-847.333] -- 0:00:28
549000 -- (-849.228) [-846.229] (-847.388) (-845.146) * (-846.449) [-845.450] (-846.252) (-846.298) -- 0:00:28
549500 -- (-848.876) [-845.466] (-845.802) (-846.282) * (-846.824) (-845.750) [-846.290] (-848.820) -- 0:00:28
550000 -- (-848.132) [-844.520] (-845.180) (-845.168) * (-850.303) [-850.389] (-847.800) (-847.887) -- 0:00:28
Average standard deviation of split frequencies: 0.008359
550500 -- (-845.374) (-846.847) [-844.052] (-845.103) * (-852.122) (-846.529) [-846.695] (-848.724) -- 0:00:28
551000 -- (-846.976) (-846.933) (-845.670) [-847.115] * [-846.981] (-846.254) (-846.427) (-845.480) -- 0:00:28
551500 -- (-846.344) (-845.513) [-844.926] (-848.049) * (-847.348) (-848.408) (-845.613) [-847.417] -- 0:00:28
552000 -- (-846.233) (-848.095) [-844.135] (-845.634) * (-847.351) (-847.748) (-844.762) [-846.048] -- 0:00:28
552500 -- [-845.879] (-847.858) (-843.924) (-844.345) * [-846.021] (-846.837) (-844.322) (-844.814) -- 0:00:28
553000 -- [-845.185] (-846.427) (-845.609) (-846.007) * [-844.812] (-845.100) (-846.876) (-844.705) -- 0:00:28
553500 -- (-848.865) [-844.769] (-846.768) (-845.500) * (-846.200) (-848.250) (-844.461) [-845.908] -- 0:00:28
554000 -- (-844.914) (-848.424) (-845.550) [-844.527] * (-846.212) [-844.656] (-848.206) (-845.531) -- 0:00:28
554500 -- (-844.957) (-846.273) (-844.351) [-847.366] * (-846.048) (-849.473) [-846.291] (-847.893) -- 0:00:28
555000 -- (-845.501) (-846.919) [-844.921] (-844.956) * (-848.146) [-847.962] (-847.034) (-847.116) -- 0:00:28
Average standard deviation of split frequencies: 0.008778
555500 -- (-845.736) (-845.564) (-848.135) [-846.462] * (-846.561) (-846.709) (-846.910) [-846.431] -- 0:00:28
556000 -- (-844.121) [-846.835] (-845.262) (-849.358) * (-845.890) [-847.068] (-846.400) (-846.275) -- 0:00:27
556500 -- (-844.097) (-845.318) (-845.453) [-845.339] * (-845.338) [-845.026] (-846.490) (-846.402) -- 0:00:27
557000 -- [-848.412] (-846.936) (-849.959) (-844.709) * (-845.489) (-846.640) [-845.997] (-847.023) -- 0:00:27
557500 -- (-848.941) [-844.911] (-848.234) (-849.169) * (-848.451) [-850.203] (-845.058) (-844.693) -- 0:00:27
558000 -- (-846.013) [-845.149] (-846.472) (-846.160) * (-848.796) (-846.040) [-847.504] (-844.249) -- 0:00:27
558500 -- [-845.524] (-844.461) (-848.928) (-846.315) * (-845.457) [-845.766] (-849.212) (-845.261) -- 0:00:27
559000 -- [-845.536] (-845.228) (-845.672) (-850.967) * [-850.085] (-846.343) (-844.644) (-847.411) -- 0:00:28
559500 -- (-846.675) (-844.964) (-845.796) [-845.218] * (-850.602) [-846.347] (-844.217) (-847.553) -- 0:00:28
560000 -- (-846.589) (-845.608) (-847.148) [-846.091] * (-846.330) (-844.790) (-844.160) [-846.016] -- 0:00:28
Average standard deviation of split frequencies: 0.008754
560500 -- (-846.687) (-846.179) (-851.695) [-847.744] * (-848.015) (-846.036) [-844.209] (-848.436) -- 0:00:28
561000 -- (-845.171) (-847.840) (-846.724) [-846.009] * (-845.846) (-850.289) (-848.070) [-845.495] -- 0:00:28
561500 -- (-847.917) (-847.457) [-847.149] (-846.374) * (-846.428) (-845.795) (-850.484) [-844.346] -- 0:00:28
562000 -- (-845.927) (-849.705) [-844.407] (-847.172) * (-845.632) [-845.544] (-848.720) (-848.613) -- 0:00:28
562500 -- (-850.805) (-847.844) (-845.237) [-845.783] * (-845.604) (-845.924) [-849.233] (-849.916) -- 0:00:28
563000 -- (-845.621) [-845.172] (-845.321) (-849.197) * (-846.237) (-845.016) (-846.864) [-846.135] -- 0:00:27
563500 -- (-845.865) (-846.176) [-846.276] (-849.314) * (-845.487) [-846.763] (-844.869) (-846.660) -- 0:00:27
564000 -- (-846.535) (-848.819) (-845.268) [-846.632] * [-845.105] (-849.310) (-845.922) (-846.361) -- 0:00:27
564500 -- (-845.312) (-844.817) [-844.506] (-848.759) * (-844.400) (-846.881) (-845.716) [-846.151] -- 0:00:27
565000 -- (-845.923) (-844.323) [-844.731] (-844.748) * (-844.086) [-847.616] (-846.446) (-849.713) -- 0:00:27
Average standard deviation of split frequencies: 0.009358
565500 -- (-846.862) [-845.641] (-845.799) (-847.908) * (-845.153) [-845.391] (-846.922) (-849.448) -- 0:00:27
566000 -- (-844.538) (-845.319) [-846.942] (-846.455) * [-844.824] (-844.738) (-847.860) (-847.385) -- 0:00:27
566500 -- (-847.100) (-846.892) [-847.980] (-847.091) * (-845.425) [-845.585] (-845.962) (-848.793) -- 0:00:27
567000 -- (-844.889) (-849.210) [-845.566] (-845.083) * (-844.666) (-847.421) [-843.880] (-846.503) -- 0:00:27
567500 -- (-845.978) (-846.146) [-844.427] (-846.138) * [-846.854] (-844.956) (-848.659) (-845.869) -- 0:00:27
568000 -- (-847.491) [-847.961] (-847.374) (-845.462) * (-845.725) (-844.510) (-845.774) [-846.869] -- 0:00:27
568500 -- (-845.645) [-847.256] (-845.579) (-845.528) * [-846.828] (-844.510) (-845.769) (-847.548) -- 0:00:27
569000 -- [-846.896] (-847.222) (-845.109) (-844.388) * (-846.571) (-845.199) (-844.628) [-845.701] -- 0:00:27
569500 -- (-848.328) (-845.417) [-845.233] (-844.771) * (-844.769) (-849.769) (-844.708) [-844.900] -- 0:00:27
570000 -- (-846.529) [-845.659] (-848.585) (-849.954) * (-850.673) [-844.817] (-844.714) (-845.798) -- 0:00:27
Average standard deviation of split frequencies: 0.009524
570500 -- (-846.260) [-845.922] (-847.634) (-845.853) * (-850.306) (-844.739) (-845.133) [-844.461] -- 0:00:27
571000 -- (-850.338) [-845.061] (-844.725) (-845.616) * (-845.961) [-846.219] (-846.314) (-846.602) -- 0:00:27
571500 -- (-844.954) [-846.661] (-844.981) (-844.074) * (-845.863) (-845.516) [-845.597] (-844.815) -- 0:00:26
572000 -- (-848.002) (-846.015) [-844.651] (-846.175) * (-845.953) (-846.026) (-845.197) [-844.382] -- 0:00:26
572500 -- (-846.732) (-845.150) [-845.751] (-844.152) * (-846.046) (-846.269) [-846.918] (-847.851) -- 0:00:26
573000 -- (-849.205) (-846.057) (-845.060) [-846.543] * (-844.979) (-848.537) [-845.975] (-846.736) -- 0:00:26
573500 -- (-847.116) (-846.940) (-848.533) [-844.560] * (-847.262) [-849.517] (-848.846) (-845.755) -- 0:00:26
574000 -- (-853.576) [-845.938] (-845.320) (-844.674) * (-845.589) (-847.588) [-844.737] (-846.240) -- 0:00:26
574500 -- [-845.464] (-846.211) (-845.670) (-846.019) * (-845.571) [-845.224] (-846.059) (-845.028) -- 0:00:26
575000 -- (-844.720) (-847.035) [-844.638] (-844.672) * [-845.093] (-849.144) (-850.301) (-845.059) -- 0:00:26
Average standard deviation of split frequencies: 0.009388
575500 -- (-847.275) (-846.477) (-845.373) [-846.790] * (-849.778) [-846.900] (-848.610) (-847.445) -- 0:00:27
576000 -- (-848.618) (-845.946) [-848.697] (-846.643) * (-848.127) (-848.155) [-844.845] (-847.286) -- 0:00:27
576500 -- (-846.950) [-845.100] (-846.096) (-848.626) * (-846.003) [-846.166] (-847.816) (-845.539) -- 0:00:27
577000 -- (-847.585) (-844.771) (-846.660) [-850.603] * (-845.061) [-845.075] (-847.900) (-847.505) -- 0:00:27
577500 -- (-846.115) (-844.824) (-845.854) [-845.458] * (-844.505) (-848.876) [-844.778] (-850.647) -- 0:00:27
578000 -- (-850.634) [-845.683] (-846.334) (-845.455) * (-844.795) (-847.334) (-846.828) [-844.882] -- 0:00:27
578500 -- (-848.537) (-846.714) [-846.144] (-845.754) * (-846.430) (-846.540) [-847.852] (-844.582) -- 0:00:26
579000 -- (-846.536) (-849.492) [-845.499] (-848.947) * (-846.380) [-851.384] (-849.694) (-844.887) -- 0:00:26
579500 -- [-846.129] (-846.117) (-846.118) (-844.853) * [-845.040] (-849.012) (-847.976) (-848.854) -- 0:00:26
580000 -- (-846.223) (-846.921) [-845.206] (-844.711) * (-844.728) (-845.639) [-848.326] (-846.472) -- 0:00:26
Average standard deviation of split frequencies: 0.008930
580500 -- [-845.361] (-846.333) (-846.224) (-845.689) * (-844.562) (-845.445) [-846.397] (-851.542) -- 0:00:26
581000 -- (-844.377) (-846.260) [-846.608] (-845.026) * (-844.418) [-845.584] (-845.600) (-848.671) -- 0:00:26
581500 -- (-844.331) (-848.594) [-849.150] (-844.894) * (-844.413) [-845.173] (-846.065) (-846.013) -- 0:00:26
582000 -- (-844.834) [-845.439] (-846.638) (-849.492) * [-844.189] (-851.387) (-847.870) (-846.994) -- 0:00:26
582500 -- (-844.357) [-846.306] (-848.393) (-846.724) * (-845.075) [-847.409] (-856.652) (-846.345) -- 0:00:26
583000 -- (-847.784) [-845.695] (-847.825) (-845.898) * (-848.564) [-844.563] (-847.532) (-845.089) -- 0:00:26
583500 -- (-846.878) (-845.163) [-846.029] (-845.171) * (-848.297) (-844.125) (-845.896) [-844.826] -- 0:00:26
584000 -- (-849.754) (-846.779) (-846.588) [-845.406] * (-847.500) (-845.407) [-844.401] (-844.827) -- 0:00:26
584500 -- (-848.997) [-853.169] (-847.217) (-845.858) * (-846.078) (-847.072) (-848.651) [-846.032] -- 0:00:26
585000 -- [-846.021] (-846.257) (-844.410) (-848.546) * [-846.333] (-851.493) (-846.069) (-848.074) -- 0:00:26
Average standard deviation of split frequencies: 0.009085
585500 -- (-849.363) [-851.331] (-845.285) (-847.512) * (-848.095) [-849.608] (-845.506) (-847.732) -- 0:00:26
586000 -- [-846.388] (-850.502) (-846.396) (-848.966) * (-844.841) (-849.458) (-845.803) [-845.131] -- 0:00:26
586500 -- (-851.247) (-847.006) (-845.212) [-845.344] * (-846.106) [-849.315] (-845.316) (-845.235) -- 0:00:26
587000 -- (-847.584) (-845.737) [-844.798] (-849.349) * (-846.033) (-847.730) (-847.929) [-844.638] -- 0:00:26
587500 -- (-845.789) (-847.533) [-844.913] (-852.414) * [-844.340] (-846.896) (-846.306) (-847.410) -- 0:00:25
588000 -- [-846.704] (-845.180) (-844.958) (-847.443) * [-848.894] (-845.706) (-845.045) (-844.987) -- 0:00:25
588500 -- [-845.862] (-845.397) (-846.584) (-848.896) * (-848.492) (-844.552) [-846.107] (-847.709) -- 0:00:25
589000 -- [-850.092] (-845.060) (-848.857) (-845.541) * (-847.104) [-849.777] (-845.677) (-846.197) -- 0:00:25
589500 -- [-846.151] (-845.638) (-846.040) (-846.776) * [-845.519] (-847.780) (-844.878) (-848.152) -- 0:00:25
590000 -- (-844.496) (-846.989) [-845.900] (-848.004) * [-844.956] (-851.793) (-845.486) (-845.436) -- 0:00:25
Average standard deviation of split frequencies: 0.009155
590500 -- (-846.985) [-845.565] (-844.759) (-845.334) * (-844.249) (-847.835) (-845.811) [-846.742] -- 0:00:25
591000 -- [-846.972] (-846.712) (-845.856) (-844.445) * (-844.673) (-845.760) (-845.010) [-846.862] -- 0:00:25
591500 -- (-844.711) (-846.919) [-845.887] (-846.035) * (-845.340) [-845.133] (-849.116) (-844.740) -- 0:00:25
592000 -- (-846.716) (-847.991) [-846.945] (-846.958) * [-844.530] (-847.053) (-848.768) (-849.006) -- 0:00:26
592500 -- (-851.929) [-845.735] (-846.474) (-848.239) * (-846.037) (-845.651) (-846.497) [-847.351] -- 0:00:26
593000 -- (-845.681) (-846.269) (-846.081) [-845.557] * [-847.162] (-847.010) (-844.870) (-845.471) -- 0:00:26
593500 -- (-846.887) (-845.879) [-848.267] (-844.288) * [-847.510] (-845.807) (-844.764) (-844.568) -- 0:00:26
594000 -- (-845.943) (-846.994) [-848.087] (-844.816) * (-845.288) (-846.879) (-846.577) [-845.932] -- 0:00:25
594500 -- [-846.180] (-844.660) (-845.018) (-846.117) * (-849.034) (-845.600) (-845.338) [-845.351] -- 0:00:25
595000 -- [-847.607] (-849.402) (-846.223) (-846.186) * (-848.303) (-845.649) [-844.379] (-846.991) -- 0:00:25
Average standard deviation of split frequencies: 0.009026
595500 -- (-846.579) (-846.953) (-846.284) [-846.029] * (-850.231) [-846.645] (-844.498) (-845.165) -- 0:00:25
596000 -- (-845.121) (-848.386) [-847.408] (-845.322) * [-846.638] (-846.363) (-845.993) (-846.140) -- 0:00:25
596500 -- (-846.635) [-845.914] (-853.070) (-845.285) * (-845.922) [-848.636] (-846.146) (-846.440) -- 0:00:25
597000 -- (-846.741) (-847.139) (-847.890) [-845.326] * [-844.941] (-845.148) (-852.172) (-846.039) -- 0:00:25
597500 -- (-851.285) [-846.920] (-849.880) (-848.092) * (-846.356) (-845.008) (-846.272) [-846.570] -- 0:00:25
598000 -- (-848.369) (-845.897) (-844.504) [-845.256] * [-847.287] (-845.176) (-847.448) (-846.200) -- 0:00:25
598500 -- (-844.905) (-847.478) [-844.757] (-846.868) * (-847.896) (-845.459) [-845.583] (-845.435) -- 0:00:25
599000 -- [-846.664] (-849.419) (-848.996) (-846.711) * (-846.600) (-846.100) [-845.219] (-844.866) -- 0:00:25
599500 -- (-845.808) (-851.746) (-846.085) [-850.339] * (-845.252) (-845.515) (-845.951) [-844.857] -- 0:00:25
600000 -- (-844.560) (-847.570) (-845.519) [-845.044] * (-844.837) (-847.574) (-847.985) [-845.075] -- 0:00:25
Average standard deviation of split frequencies: 0.009464
600500 -- [-844.750] (-848.123) (-846.769) (-844.502) * (-845.323) (-845.484) (-848.473) [-845.830] -- 0:00:25
601000 -- [-844.661] (-848.463) (-849.535) (-846.774) * [-845.580] (-846.500) (-846.947) (-847.003) -- 0:00:25
601500 -- (-846.156) [-845.941] (-848.020) (-845.369) * (-847.815) (-845.252) (-846.433) [-849.083] -- 0:00:25
602000 -- (-844.182) (-847.209) (-845.063) [-844.730] * (-845.667) [-848.904] (-844.947) (-847.567) -- 0:00:25
602500 -- (-847.470) (-845.332) (-845.890) [-846.653] * (-846.641) [-845.245] (-848.546) (-846.260) -- 0:00:25
603000 -- (-846.954) (-844.792) [-850.076] (-846.101) * [-846.465] (-846.310) (-847.138) (-846.005) -- 0:00:25
603500 -- (-849.177) (-845.440) (-848.247) [-847.182] * (-846.213) [-846.518] (-847.913) (-847.332) -- 0:00:24
604000 -- (-848.350) (-845.980) [-846.176] (-845.725) * (-846.661) (-846.527) (-845.451) [-847.861] -- 0:00:24
604500 -- (-849.031) [-847.119] (-845.888) (-845.059) * [-846.819] (-845.134) (-845.534) (-851.243) -- 0:00:24
605000 -- (-854.012) [-845.851] (-845.496) (-846.686) * (-846.456) (-846.347) [-845.433] (-847.225) -- 0:00:24
Average standard deviation of split frequencies: 0.009747
605500 -- (-849.659) (-845.268) [-844.483] (-847.219) * (-847.530) (-847.136) (-850.216) [-845.899] -- 0:00:24
606000 -- [-847.795] (-845.214) (-846.236) (-844.440) * (-847.193) (-849.312) [-847.462] (-846.897) -- 0:00:24
606500 -- (-845.187) (-848.296) (-845.362) [-846.321] * [-848.544] (-846.859) (-847.178) (-844.690) -- 0:00:24
607000 -- (-849.862) [-847.420] (-851.932) (-845.480) * (-847.995) (-845.845) [-846.760] (-844.227) -- 0:00:24
607500 -- (-844.599) (-846.876) [-845.561] (-850.641) * (-845.739) (-845.703) (-846.472) [-844.110] -- 0:00:24
608000 -- (-845.741) (-846.296) (-845.645) [-845.483] * (-846.590) (-845.441) [-845.920] (-844.447) -- 0:00:25
608500 -- (-844.994) [-846.241] (-844.289) (-847.266) * (-850.458) (-847.164) [-845.092] (-846.717) -- 0:00:25
609000 -- (-846.203) (-844.540) (-844.223) [-846.016] * (-844.121) (-847.240) [-847.936] (-849.640) -- 0:00:25
609500 -- (-844.710) [-844.766] (-847.210) (-847.284) * (-845.797) (-845.237) [-846.741] (-846.092) -- 0:00:24
610000 -- [-845.534] (-845.609) (-847.427) (-846.167) * (-845.761) (-848.344) (-849.175) [-846.428] -- 0:00:24
Average standard deviation of split frequencies: 0.009445
610500 -- (-847.870) (-846.283) [-847.003] (-846.683) * (-845.256) (-846.070) (-848.134) [-847.287] -- 0:00:24
611000 -- (-844.719) [-845.252] (-847.338) (-849.174) * [-845.462] (-844.511) (-850.059) (-850.531) -- 0:00:24
611500 -- (-844.706) [-846.515] (-847.262) (-844.947) * (-845.587) [-846.049] (-845.574) (-846.541) -- 0:00:24
612000 -- (-846.111) (-846.283) (-848.960) [-845.253] * (-847.141) [-844.863] (-846.365) (-846.823) -- 0:00:24
612500 -- (-844.647) (-847.289) (-850.339) [-844.946] * (-846.964) [-845.631] (-845.986) (-848.133) -- 0:00:24
613000 -- [-846.660] (-847.257) (-846.230) (-846.071) * (-844.674) (-844.529) [-845.465] (-849.662) -- 0:00:24
613500 -- (-846.146) (-845.635) (-845.241) [-845.409] * (-847.522) (-844.531) [-845.655] (-850.895) -- 0:00:24
614000 -- (-848.693) [-845.516] (-844.567) (-845.351) * [-845.715] (-845.842) (-845.279) (-847.780) -- 0:00:24
614500 -- (-846.322) [-844.906] (-846.356) (-848.639) * [-844.249] (-846.254) (-846.230) (-850.263) -- 0:00:24
615000 -- [-848.523] (-846.768) (-844.448) (-847.191) * (-845.293) (-854.844) (-855.291) [-849.040] -- 0:00:24
Average standard deviation of split frequencies: 0.009408
615500 -- (-848.853) (-845.408) (-845.181) [-844.814] * [-845.187] (-844.385) (-848.697) (-852.302) -- 0:00:24
616000 -- (-847.709) (-847.180) [-847.918] (-845.635) * (-846.314) (-844.451) (-845.411) [-849.146] -- 0:00:24
616500 -- (-849.124) (-849.603) (-845.462) [-847.322] * [-848.825] (-845.587) (-847.534) (-850.518) -- 0:00:24
617000 -- (-846.531) [-846.723] (-847.428) (-848.526) * (-847.638) (-848.686) (-849.270) [-844.212] -- 0:00:24
617500 -- [-847.564] (-847.245) (-846.788) (-846.340) * (-847.701) (-844.532) (-849.544) [-845.558] -- 0:00:24
618000 -- (-846.820) (-846.205) [-846.157] (-847.384) * (-844.783) (-845.876) (-844.559) [-846.033] -- 0:00:24
618500 -- [-846.065] (-850.360) (-844.820) (-847.542) * (-846.521) (-846.123) [-845.056] (-844.835) -- 0:00:24
619000 -- [-847.970] (-847.006) (-848.961) (-849.017) * (-844.437) [-846.739] (-846.016) (-845.594) -- 0:00:24
619500 -- (-846.134) (-847.163) (-845.073) [-844.615] * (-844.875) (-847.383) [-848.703] (-845.860) -- 0:00:23
620000 -- (-845.311) [-845.534] (-848.821) (-844.618) * [-844.174] (-850.096) (-849.632) (-844.520) -- 0:00:23
Average standard deviation of split frequencies: 0.009069
620500 -- (-845.557) (-847.287) [-844.218] (-845.698) * (-846.236) (-844.807) [-844.995] (-845.391) -- 0:00:23
621000 -- (-845.604) [-848.879] (-844.354) (-845.841) * [-846.137] (-846.368) (-845.137) (-846.413) -- 0:00:24
621500 -- [-844.362] (-850.994) (-847.462) (-845.536) * [-845.984] (-849.033) (-846.173) (-847.652) -- 0:00:24
622000 -- [-844.285] (-848.850) (-849.774) (-845.513) * (-845.007) (-855.723) [-844.558] (-845.651) -- 0:00:24
622500 -- (-845.444) (-849.220) [-844.687] (-846.828) * (-844.125) [-847.544] (-844.095) (-846.224) -- 0:00:24
623000 -- [-848.291] (-844.746) (-849.118) (-846.212) * (-849.556) (-847.942) (-848.537) [-845.953] -- 0:00:24
623500 -- (-847.396) (-846.302) [-844.599] (-848.912) * (-846.570) (-847.243) (-850.778) [-846.397] -- 0:00:24
624000 -- (-848.807) (-847.801) [-844.297] (-843.826) * [-844.417] (-845.015) (-844.372) (-847.285) -- 0:00:24
624500 -- [-845.759] (-846.885) (-844.533) (-846.453) * (-847.043) (-846.517) [-848.255] (-848.461) -- 0:00:24
625000 -- [-847.086] (-846.414) (-844.861) (-845.907) * [-845.874] (-845.047) (-845.120) (-846.466) -- 0:00:24
Average standard deviation of split frequencies: 0.008859
625500 -- (-849.447) [-846.800] (-844.798) (-845.839) * (-847.924) (-846.296) (-846.065) [-844.365] -- 0:00:23
626000 -- (-848.076) (-846.508) [-845.320] (-850.039) * (-845.340) [-844.294] (-845.362) (-844.611) -- 0:00:23
626500 -- [-846.494] (-844.725) (-844.659) (-844.989) * [-846.902] (-846.295) (-845.660) (-844.736) -- 0:00:23
627000 -- (-845.630) [-850.969] (-844.657) (-844.546) * (-845.517) (-846.707) (-846.713) [-845.704] -- 0:00:23
627500 -- (-848.769) [-845.622] (-844.877) (-846.128) * [-844.551] (-845.596) (-851.020) (-847.888) -- 0:00:23
628000 -- [-846.630] (-846.385) (-847.495) (-847.815) * [-845.429] (-845.362) (-846.417) (-845.123) -- 0:00:23
628500 -- (-846.924) [-845.365] (-844.312) (-845.161) * (-845.866) (-849.993) (-845.041) [-845.551] -- 0:00:23
629000 -- (-845.462) (-845.300) (-848.188) [-844.776] * (-845.659) [-845.846] (-847.325) (-849.179) -- 0:00:23
629500 -- (-848.202) (-851.857) [-844.353] (-845.102) * (-849.220) [-845.256] (-847.849) (-845.836) -- 0:00:23
630000 -- (-846.582) [-845.811] (-845.017) (-844.876) * [-845.925] (-845.443) (-850.701) (-846.118) -- 0:00:23
Average standard deviation of split frequencies: 0.008794
630500 -- (-847.934) (-845.049) (-845.107) [-844.395] * [-844.779] (-847.467) (-846.730) (-846.984) -- 0:00:23
631000 -- (-847.328) [-847.354] (-844.368) (-844.654) * (-846.463) (-846.243) [-847.130] (-845.704) -- 0:00:23
631500 -- (-845.661) (-844.626) (-845.017) [-844.556] * [-844.384] (-847.323) (-846.841) (-845.635) -- 0:00:23
632000 -- [-849.205] (-844.853) (-846.154) (-844.501) * (-845.241) (-849.779) [-845.209] (-845.662) -- 0:00:23
632500 -- (-847.002) (-845.479) [-845.218] (-847.447) * [-846.430] (-844.801) (-846.796) (-848.492) -- 0:00:23
633000 -- (-848.507) (-845.392) [-844.122] (-845.788) * (-845.557) (-844.439) [-849.692] (-846.814) -- 0:00:23
633500 -- [-846.626] (-845.411) (-845.300) (-846.057) * (-847.361) (-844.442) (-850.463) [-848.742] -- 0:00:23
634000 -- [-846.286] (-846.024) (-846.458) (-850.053) * [-845.034] (-844.972) (-847.749) (-847.510) -- 0:00:23
634500 -- (-844.618) [-845.046] (-847.907) (-848.279) * (-844.297) (-847.027) [-847.806] (-845.809) -- 0:00:23
635000 -- (-845.211) (-848.688) (-847.604) [-845.189] * (-845.345) (-845.749) (-846.438) [-847.264] -- 0:00:22
Average standard deviation of split frequencies: 0.008415
635500 -- (-848.083) (-845.565) (-847.915) [-845.379] * [-844.668] (-847.153) (-848.646) (-846.113) -- 0:00:22
636000 -- (-846.310) (-845.228) (-846.366) [-845.137] * [-845.809] (-844.848) (-846.942) (-846.317) -- 0:00:22
636500 -- (-846.413) (-844.328) [-847.975] (-845.468) * (-847.124) (-847.915) [-845.945] (-849.028) -- 0:00:23
637000 -- [-847.007] (-846.204) (-846.907) (-845.623) * (-847.879) (-844.851) (-847.198) [-846.409] -- 0:00:23
637500 -- (-847.433) (-848.771) (-846.612) [-847.197] * [-848.469] (-844.689) (-846.364) (-847.171) -- 0:00:23
638000 -- (-845.514) [-845.936] (-844.147) (-844.949) * (-847.925) (-846.815) [-846.504] (-846.563) -- 0:00:23
638500 -- (-847.171) (-845.272) [-845.586] (-846.977) * [-848.162] (-847.838) (-846.597) (-845.763) -- 0:00:23
639000 -- (-845.684) [-845.669] (-844.063) (-846.277) * (-850.629) [-846.380] (-844.713) (-847.646) -- 0:00:23
639500 -- (-845.257) (-844.983) (-845.972) [-847.593] * [-846.586] (-846.565) (-846.426) (-847.480) -- 0:00:23
640000 -- [-845.556] (-845.267) (-845.119) (-846.589) * (-850.190) (-846.070) [-845.520] (-847.429) -- 0:00:23
Average standard deviation of split frequencies: 0.008224
640500 -- (-845.709) (-845.842) (-847.322) [-845.098] * [-844.718] (-851.219) (-845.493) (-857.297) -- 0:00:23
641000 -- [-845.743] (-845.646) (-848.084) (-845.481) * (-845.291) (-845.182) (-846.497) [-851.187] -- 0:00:22
641500 -- (-844.849) (-849.358) (-848.314) [-848.688] * (-846.656) [-844.578] (-846.152) (-845.887) -- 0:00:22
642000 -- (-845.647) [-849.506] (-844.954) (-845.083) * (-851.179) [-848.756] (-848.865) (-844.044) -- 0:00:22
642500 -- (-844.404) (-847.392) [-847.099] (-845.193) * (-846.616) (-847.214) (-844.746) [-846.483] -- 0:00:22
643000 -- (-844.735) (-846.326) (-846.385) [-846.202] * (-845.639) [-845.436] (-847.935) (-845.564) -- 0:00:22
643500 -- (-844.201) (-846.113) [-844.467] (-846.091) * (-845.989) (-848.835) (-848.754) [-845.167] -- 0:00:22
644000 -- (-846.180) (-848.274) (-844.805) [-845.161] * (-849.840) (-849.479) (-846.686) [-845.568] -- 0:00:22
644500 -- (-849.903) [-845.035] (-844.309) (-847.691) * (-848.050) [-849.282] (-849.443) (-847.049) -- 0:00:22
645000 -- (-850.680) [-848.232] (-845.154) (-845.350) * (-846.231) (-847.929) [-845.786] (-846.086) -- 0:00:22
Average standard deviation of split frequencies: 0.008199
645500 -- (-848.134) (-844.703) (-845.017) [-847.565] * (-845.938) [-847.767] (-847.279) (-850.099) -- 0:00:22
646000 -- (-845.224) (-845.339) [-844.893] (-845.562) * (-845.843) (-848.317) [-846.157] (-847.819) -- 0:00:22
646500 -- [-844.782] (-847.578) (-847.284) (-844.141) * (-846.111) (-847.321) [-849.559] (-849.478) -- 0:00:22
647000 -- [-845.333] (-846.896) (-849.425) (-846.705) * [-847.146] (-849.099) (-848.134) (-848.097) -- 0:00:22
647500 -- (-847.273) [-847.638] (-849.092) (-844.290) * [-846.766] (-845.904) (-848.102) (-845.274) -- 0:00:22
648000 -- (-844.552) (-850.257) (-847.042) [-845.530] * (-845.963) (-845.730) [-845.667] (-846.577) -- 0:00:22
648500 -- (-844.680) [-847.144] (-846.220) (-852.454) * (-846.370) (-849.617) (-850.685) [-844.474] -- 0:00:22
649000 -- (-844.464) [-845.102] (-850.281) (-845.603) * (-844.315) (-850.230) (-850.568) [-844.256] -- 0:00:22
649500 -- (-845.864) [-844.395] (-845.104) (-845.095) * (-846.646) [-845.945] (-845.664) (-845.228) -- 0:00:22
650000 -- (-844.487) (-846.536) [-844.829] (-846.539) * (-847.634) (-849.459) [-847.108] (-845.346) -- 0:00:22
Average standard deviation of split frequencies: 0.008268
650500 -- (-851.502) (-844.310) (-848.698) [-845.516] * (-845.358) (-845.215) [-845.339] (-852.449) -- 0:00:22
651000 -- [-845.838] (-845.933) (-850.349) (-847.142) * (-846.502) [-847.627] (-847.456) (-845.807) -- 0:00:21
651500 -- (-847.854) (-846.453) [-846.905] (-852.274) * (-844.563) (-848.305) [-844.383] (-845.813) -- 0:00:22
652000 -- (-847.575) (-845.913) (-845.207) [-846.056] * (-845.155) (-846.720) [-847.351] (-845.773) -- 0:00:22
652500 -- (-850.871) (-844.428) [-848.692] (-845.134) * [-845.878] (-847.681) (-848.119) (-847.286) -- 0:00:22
653000 -- (-845.314) (-845.640) [-845.430] (-844.861) * (-845.166) (-845.519) (-847.187) [-845.170] -- 0:00:22
653500 -- (-847.229) [-844.237] (-846.259) (-845.496) * (-846.272) (-845.067) [-845.482] (-844.372) -- 0:00:22
654000 -- (-845.623) (-846.178) [-850.607] (-847.116) * (-845.662) (-846.224) [-846.216] (-844.414) -- 0:00:22
654500 -- (-844.378) (-844.515) (-849.737) [-848.400] * [-845.509] (-846.010) (-844.934) (-845.252) -- 0:00:22
655000 -- [-846.550] (-848.097) (-845.424) (-846.296) * [-845.464] (-845.518) (-846.290) (-846.197) -- 0:00:22
Average standard deviation of split frequencies: 0.008496
655500 -- [-847.905] (-850.601) (-845.890) (-848.234) * (-848.156) [-845.354] (-847.926) (-846.242) -- 0:00:22
656000 -- (-847.649) [-846.762] (-849.594) (-851.190) * (-847.361) (-845.331) [-848.663] (-844.569) -- 0:00:22
656500 -- (-845.327) (-846.220) [-845.870] (-845.707) * (-846.624) (-845.084) (-846.393) [-845.311] -- 0:00:21
657000 -- (-844.878) (-847.356) (-851.562) [-844.883] * (-847.826) (-846.733) (-844.372) [-846.030] -- 0:00:21
657500 -- (-846.442) (-845.787) [-846.483] (-848.944) * (-846.488) [-846.383] (-845.729) (-849.150) -- 0:00:21
658000 -- (-851.227) [-844.622] (-847.082) (-854.650) * (-846.623) (-845.490) [-845.623] (-845.467) -- 0:00:21
658500 -- (-845.875) (-846.290) [-846.070] (-846.219) * (-846.961) [-846.291] (-848.467) (-854.480) -- 0:00:21
659000 -- (-849.482) (-847.560) (-848.181) [-846.418] * (-846.182) [-848.332] (-846.056) (-844.539) -- 0:00:21
659500 -- (-850.714) (-845.394) (-845.736) [-847.231] * (-846.720) (-845.842) (-844.819) [-844.008] -- 0:00:21
660000 -- (-846.073) (-844.819) [-845.376] (-846.885) * [-846.335] (-846.424) (-845.585) (-849.131) -- 0:00:21
Average standard deviation of split frequencies: 0.008394
660500 -- [-845.305] (-846.251) (-844.752) (-844.432) * (-845.439) (-845.713) [-845.879] (-846.031) -- 0:00:21
661000 -- (-844.926) (-846.841) (-846.911) [-844.657] * (-844.999) [-848.850] (-844.719) (-845.296) -- 0:00:21
661500 -- [-843.920] (-848.607) (-848.949) (-844.332) * (-844.472) (-851.743) [-845.221] (-845.940) -- 0:00:21
662000 -- (-843.921) [-847.307] (-848.618) (-845.051) * (-845.167) [-846.030] (-845.354) (-845.025) -- 0:00:21
662500 -- (-845.789) [-845.777] (-844.955) (-846.686) * [-844.412] (-847.191) (-844.921) (-844.971) -- 0:00:21
663000 -- (-846.909) [-847.466] (-850.031) (-846.886) * (-844.179) (-846.901) (-844.958) [-846.736] -- 0:00:21
663500 -- (-845.611) [-846.843] (-847.381) (-845.937) * (-846.789) [-848.067] (-847.981) (-847.701) -- 0:00:21
664000 -- [-844.618] (-849.682) (-845.955) (-851.954) * [-846.116] (-845.889) (-844.972) (-846.278) -- 0:00:21
664500 -- [-846.177] (-847.975) (-845.365) (-845.069) * (-846.671) (-846.230) [-845.331] (-846.492) -- 0:00:21
665000 -- [-845.917] (-846.676) (-849.502) (-844.037) * (-844.729) (-844.984) [-847.930] (-846.012) -- 0:00:21
Average standard deviation of split frequencies: 0.008036
665500 -- (-846.514) [-848.100] (-846.610) (-844.192) * (-851.420) (-844.967) [-848.279] (-846.413) -- 0:00:21
666000 -- [-846.740] (-848.938) (-850.080) (-848.376) * (-844.937) (-844.199) (-845.591) [-844.711] -- 0:00:21
666500 -- (-846.884) (-847.533) [-848.063] (-844.492) * (-847.505) [-845.132] (-847.289) (-846.119) -- 0:00:21
667000 -- [-844.064] (-845.861) (-845.893) (-847.458) * (-847.907) [-846.858] (-844.833) (-846.177) -- 0:00:20
667500 -- (-846.157) [-844.465] (-847.088) (-844.770) * (-845.800) (-846.019) (-847.705) [-845.868] -- 0:00:21
668000 -- [-845.204] (-845.055) (-846.276) (-848.091) * (-845.857) (-850.140) [-844.260] (-846.169) -- 0:00:21
668500 -- (-844.901) [-845.681] (-845.979) (-847.440) * (-846.000) (-847.415) [-845.570] (-847.736) -- 0:00:21
669000 -- (-847.314) [-844.927] (-845.864) (-845.728) * [-844.948] (-850.726) (-848.598) (-846.262) -- 0:00:21
669500 -- (-846.669) (-844.908) (-847.136) [-846.191] * (-846.856) (-848.889) [-846.517] (-844.837) -- 0:00:21
670000 -- (-846.591) [-846.159] (-844.866) (-848.735) * [-844.931] (-848.734) (-848.329) (-846.451) -- 0:00:21
Average standard deviation of split frequencies: 0.007608
670500 -- (-851.321) [-846.420] (-846.528) (-849.106) * (-844.556) [-847.942] (-847.985) (-846.677) -- 0:00:21
671000 -- (-847.877) (-847.262) (-844.722) [-848.143] * (-845.584) [-844.213] (-845.977) (-848.324) -- 0:00:21
671500 -- (-845.600) (-850.534) [-845.791] (-848.702) * [-845.377] (-846.585) (-846.416) (-847.489) -- 0:00:21
672000 -- [-845.395] (-849.256) (-846.267) (-845.162) * (-846.797) (-844.883) (-847.541) [-847.357] -- 0:00:20
672500 -- (-845.781) [-849.241] (-844.501) (-844.623) * [-847.736] (-846.226) (-846.033) (-848.231) -- 0:00:20
673000 -- (-846.033) (-848.940) [-844.872] (-844.625) * (-845.038) [-845.106] (-847.084) (-849.624) -- 0:00:20
673500 -- (-849.492) (-853.745) [-845.856] (-848.396) * [-845.549] (-845.841) (-848.823) (-846.452) -- 0:00:20
674000 -- (-848.872) [-847.894] (-844.894) (-844.264) * (-847.004) (-845.564) [-846.732] (-848.613) -- 0:00:20
674500 -- (-846.200) [-845.175] (-845.128) (-847.936) * (-851.966) (-845.173) [-848.008] (-846.191) -- 0:00:20
675000 -- (-845.252) (-845.235) (-849.788) [-846.654] * (-854.340) [-844.954] (-845.321) (-845.467) -- 0:00:20
Average standard deviation of split frequencies: 0.007235
675500 -- (-846.585) [-845.036] (-845.935) (-848.963) * (-847.899) [-846.694] (-845.473) (-845.248) -- 0:00:20
676000 -- [-847.363] (-846.110) (-847.134) (-849.212) * (-845.321) (-849.174) (-846.388) [-847.335] -- 0:00:20
676500 -- (-845.007) (-846.420) (-845.917) [-848.793] * [-846.549] (-848.892) (-849.227) (-846.852) -- 0:00:20
677000 -- [-845.026] (-847.123) (-846.965) (-848.399) * (-845.034) (-849.118) (-848.603) [-848.273] -- 0:00:20
677500 -- [-845.630] (-846.843) (-846.965) (-845.916) * (-846.924) (-846.917) (-846.845) [-846.307] -- 0:00:20
678000 -- [-844.636] (-847.257) (-846.666) (-844.951) * [-845.131] (-846.290) (-846.496) (-845.253) -- 0:00:20
678500 -- (-845.101) (-848.798) (-848.153) [-844.749] * (-845.025) [-847.394] (-847.222) (-844.825) -- 0:00:20
679000 -- (-848.887) (-849.833) (-846.151) [-845.042] * (-846.512) [-845.612] (-846.572) (-845.173) -- 0:00:20
679500 -- (-845.617) (-845.394) [-845.949] (-844.581) * (-844.649) [-846.939] (-847.857) (-846.649) -- 0:00:20
680000 -- (-846.233) (-845.747) [-850.158] (-845.809) * [-847.240] (-845.375) (-844.712) (-847.950) -- 0:00:20
Average standard deviation of split frequencies: 0.006752
680500 -- [-845.497] (-845.453) (-847.903) (-845.128) * (-846.960) (-847.212) (-849.485) [-845.282] -- 0:00:20
681000 -- (-846.342) (-847.232) (-845.212) [-848.528] * (-847.959) (-851.343) [-845.600] (-846.038) -- 0:00:20
681500 -- (-848.891) (-846.436) [-844.571] (-845.119) * [-844.320] (-845.931) (-844.739) (-851.344) -- 0:00:20
682000 -- (-850.985) [-845.487] (-845.667) (-845.686) * (-848.945) [-846.283] (-846.371) (-848.448) -- 0:00:20
682500 -- (-850.866) (-845.802) [-847.501] (-845.992) * (-847.175) (-849.375) [-846.049] (-849.493) -- 0:00:20
683000 -- (-848.535) (-846.665) (-847.100) [-845.970] * (-846.108) (-846.431) [-844.648] (-845.552) -- 0:00:19
683500 -- (-848.467) (-845.174) [-846.525] (-845.154) * (-847.758) (-845.982) [-847.602] (-845.085) -- 0:00:19
684000 -- (-849.787) (-845.782) (-850.318) [-844.954] * (-845.146) [-845.699] (-847.414) (-844.664) -- 0:00:19
684500 -- (-848.624) (-845.608) (-846.716) [-846.753] * [-847.577] (-848.861) (-846.266) (-845.775) -- 0:00:20
685000 -- (-847.093) [-844.963] (-845.134) (-846.892) * (-849.055) [-848.943] (-847.466) (-845.174) -- 0:00:20
Average standard deviation of split frequencies: 0.006700
685500 -- [-846.312] (-846.237) (-846.452) (-845.298) * (-849.447) [-845.872] (-847.703) (-845.160) -- 0:00:20
686000 -- (-845.348) [-846.948] (-846.781) (-847.557) * (-850.714) (-844.647) (-850.551) [-846.979] -- 0:00:20
686500 -- (-845.424) (-847.271) [-846.789] (-847.012) * (-845.551) (-847.698) [-846.824] (-846.753) -- 0:00:20
687000 -- (-848.239) [-844.974] (-847.636) (-846.013) * (-845.911) [-845.162] (-847.462) (-846.819) -- 0:00:20
687500 -- (-845.328) [-845.040] (-844.644) (-848.466) * (-849.668) (-849.001) [-845.862] (-845.127) -- 0:00:20
688000 -- [-844.343] (-846.929) (-845.794) (-847.336) * (-846.103) (-850.676) [-847.715] (-845.285) -- 0:00:19
688500 -- (-847.109) (-853.250) [-845.132] (-847.514) * (-845.943) [-847.279] (-849.013) (-847.252) -- 0:00:19
689000 -- (-849.292) (-848.535) [-845.234] (-846.508) * [-844.675] (-845.803) (-846.556) (-844.896) -- 0:00:19
689500 -- (-850.552) (-850.755) [-845.439] (-846.132) * [-847.689] (-844.852) (-845.754) (-847.702) -- 0:00:19
690000 -- (-845.611) [-850.301] (-844.821) (-847.612) * [-844.446] (-846.266) (-845.952) (-844.277) -- 0:00:19
Average standard deviation of split frequencies: 0.006655
690500 -- [-845.202] (-851.489) (-848.432) (-849.894) * [-845.295] (-846.513) (-849.632) (-844.656) -- 0:00:19
691000 -- [-846.038] (-850.342) (-846.196) (-849.967) * [-845.651] (-846.888) (-848.429) (-846.670) -- 0:00:19
691500 -- [-846.953] (-850.522) (-852.102) (-844.245) * (-844.894) (-846.589) [-848.339] (-847.561) -- 0:00:19
692000 -- (-845.432) (-848.863) [-845.345] (-846.211) * (-848.552) (-848.709) (-845.898) [-846.030] -- 0:00:19
692500 -- (-845.834) [-845.914] (-844.725) (-850.202) * (-847.386) (-846.776) (-848.169) [-848.489] -- 0:00:19
693000 -- (-846.262) [-845.610] (-845.163) (-849.449) * [-845.634] (-847.246) (-844.935) (-849.262) -- 0:00:19
693500 -- (-845.067) (-845.195) (-845.608) [-848.303] * (-846.310) (-845.565) (-844.991) [-845.092] -- 0:00:19
694000 -- (-845.626) (-847.049) (-845.575) [-848.695] * (-845.049) (-845.781) (-845.368) [-846.126] -- 0:00:19
694500 -- (-851.916) [-846.023] (-845.887) (-848.129) * (-847.490) (-845.653) (-846.447) [-846.421] -- 0:00:19
695000 -- (-845.596) (-844.415) [-846.340] (-847.088) * (-845.529) [-845.656] (-844.988) (-849.199) -- 0:00:19
Average standard deviation of split frequencies: 0.006688
695500 -- (-846.634) (-845.254) [-847.658] (-845.433) * [-844.825] (-844.108) (-850.172) (-846.508) -- 0:00:19
696000 -- (-850.793) (-845.399) [-845.267] (-844.237) * (-846.348) (-848.675) (-850.069) [-847.168] -- 0:00:19
696500 -- (-850.910) (-848.815) (-845.847) [-844.232] * (-846.100) [-849.302] (-845.926) (-846.032) -- 0:00:19
697000 -- (-845.575) [-845.293] (-846.836) (-847.675) * (-847.767) (-849.728) [-848.984] (-846.219) -- 0:00:19
697500 -- (-849.171) [-846.639] (-850.145) (-844.561) * (-847.268) [-852.473] (-845.607) (-845.309) -- 0:00:19
698000 -- [-849.787] (-846.067) (-848.278) (-846.836) * (-846.135) (-856.818) (-849.103) [-845.666] -- 0:00:19
698500 -- [-846.393] (-849.128) (-848.766) (-844.856) * (-843.922) (-847.020) (-844.681) [-845.049] -- 0:00:18
699000 -- (-845.572) (-851.439) [-848.210] (-845.630) * [-846.278] (-847.397) (-844.441) (-849.102) -- 0:00:18
699500 -- (-846.328) (-846.952) (-849.895) [-845.014] * [-844.405] (-846.613) (-849.411) (-845.836) -- 0:00:18
700000 -- (-845.439) (-846.999) [-851.412] (-847.088) * [-845.979] (-845.613) (-846.681) (-846.056) -- 0:00:18
Average standard deviation of split frequencies: 0.006812
700500 -- (-845.084) (-849.485) [-847.529] (-847.760) * [-845.755] (-845.838) (-846.897) (-845.121) -- 0:00:19
701000 -- (-844.891) (-845.933) (-849.203) [-847.742] * [-844.024] (-847.507) (-847.862) (-844.532) -- 0:00:19
701500 -- [-845.986] (-844.955) (-845.644) (-845.031) * (-845.876) (-850.270) (-844.627) [-846.161] -- 0:00:19
702000 -- (-847.928) (-846.251) [-844.740] (-845.288) * (-849.317) (-849.901) (-846.108) [-845.820] -- 0:00:19
702500 -- (-847.386) (-851.867) [-844.460] (-844.976) * (-848.912) (-845.160) [-844.446] (-849.959) -- 0:00:19
703000 -- (-846.561) [-847.588] (-844.451) (-844.532) * (-846.923) [-845.477] (-846.205) (-846.185) -- 0:00:19
703500 -- (-844.520) (-846.686) [-845.235] (-847.406) * (-847.639) (-846.528) (-847.475) [-846.004] -- 0:00:18
704000 -- (-844.577) [-844.484] (-845.474) (-846.163) * (-846.351) [-846.796] (-845.859) (-845.370) -- 0:00:18
704500 -- (-844.777) (-847.725) (-845.397) [-846.246] * [-845.307] (-846.558) (-845.996) (-845.635) -- 0:00:18
705000 -- [-845.876] (-845.826) (-845.581) (-845.700) * [-845.649] (-845.192) (-845.379) (-845.535) -- 0:00:18
Average standard deviation of split frequencies: 0.007553
705500 -- (-847.511) (-847.421) [-845.536] (-847.869) * [-847.331] (-846.927) (-845.611) (-849.206) -- 0:00:18
706000 -- (-846.872) (-844.754) [-847.309] (-846.525) * (-849.322) (-845.225) (-847.112) [-845.861] -- 0:00:18
706500 -- (-851.459) (-846.301) (-849.931) [-844.159] * (-846.440) [-844.854] (-844.773) (-846.825) -- 0:00:18
707000 -- (-845.219) (-846.968) (-848.020) [-844.159] * [-851.064] (-847.889) (-848.475) (-845.376) -- 0:00:18
707500 -- (-846.869) (-848.200) (-845.554) [-846.022] * [-847.341] (-848.615) (-851.268) (-845.575) -- 0:00:18
708000 -- [-847.132] (-845.141) (-845.044) (-847.999) * (-844.651) (-846.269) (-848.932) [-847.127] -- 0:00:18
708500 -- [-846.878] (-847.295) (-845.199) (-845.164) * (-844.573) (-848.917) [-846.536] (-846.531) -- 0:00:18
709000 -- (-846.097) (-847.745) (-845.726) [-844.395] * (-844.453) (-847.793) (-849.020) [-847.953] -- 0:00:18
709500 -- (-847.429) (-850.521) (-845.210) [-844.403] * [-846.455] (-845.734) (-844.774) (-846.592) -- 0:00:18
710000 -- (-848.672) (-847.038) [-846.300] (-846.456) * [-846.373] (-845.182) (-849.720) (-844.535) -- 0:00:18
Average standard deviation of split frequencies: 0.006923
710500 -- [-849.826] (-845.192) (-846.839) (-844.804) * (-847.362) [-846.007] (-845.597) (-846.020) -- 0:00:18
711000 -- (-847.548) (-844.597) (-848.124) [-844.465] * [-845.050] (-847.532) (-846.311) (-845.498) -- 0:00:18
711500 -- (-848.730) (-848.982) [-845.697] (-845.706) * (-845.630) [-846.351] (-846.080) (-845.082) -- 0:00:18
712000 -- (-849.974) [-846.494] (-845.189) (-849.546) * (-849.055) [-846.030] (-847.270) (-845.771) -- 0:00:18
712500 -- (-845.441) (-847.867) (-846.568) [-851.857] * (-849.904) (-850.915) (-853.452) [-846.292] -- 0:00:18
713000 -- [-844.808] (-844.783) (-848.685) (-847.355) * (-845.359) (-844.453) (-847.535) [-848.167] -- 0:00:18
713500 -- (-844.878) (-845.576) (-846.755) [-847.815] * (-846.542) (-845.722) [-845.553] (-844.231) -- 0:00:18
714000 -- (-845.308) (-845.405) [-845.338] (-847.158) * (-846.321) [-849.149] (-844.877) (-844.244) -- 0:00:18
714500 -- [-845.841] (-844.226) (-846.151) (-845.953) * (-845.749) (-851.083) [-845.061] (-845.592) -- 0:00:17
715000 -- (-846.043) [-845.189] (-848.950) (-846.589) * (-845.743) (-847.270) (-847.155) [-846.401] -- 0:00:17
Average standard deviation of split frequencies: 0.007448
715500 -- (-846.929) (-845.576) [-845.636] (-845.586) * (-848.904) (-848.722) (-846.498) [-845.678] -- 0:00:17
716000 -- (-845.753) [-846.500] (-845.387) (-848.881) * (-844.870) [-849.982] (-847.949) (-846.007) -- 0:00:17
716500 -- (-847.186) (-847.425) (-845.314) [-847.898] * (-845.823) (-848.521) [-848.372] (-846.165) -- 0:00:17
717000 -- (-846.365) (-844.841) [-845.847] (-847.114) * [-844.280] (-844.414) (-849.695) (-845.196) -- 0:00:18
717500 -- (-846.117) [-844.680] (-848.965) (-846.698) * (-847.656) [-845.825] (-846.272) (-845.863) -- 0:00:18
718000 -- [-846.290] (-844.600) (-848.725) (-850.269) * [-845.508] (-844.943) (-847.387) (-853.725) -- 0:00:18
718500 -- (-848.651) (-846.479) [-848.657] (-847.956) * (-847.872) [-845.259] (-848.505) (-846.142) -- 0:00:18
719000 -- [-847.659] (-846.630) (-847.938) (-844.593) * (-849.475) [-845.236] (-844.872) (-844.394) -- 0:00:17
719500 -- (-845.113) (-844.006) [-848.856] (-844.598) * [-848.104] (-847.285) (-849.144) (-845.864) -- 0:00:17
720000 -- (-844.595) [-845.383] (-846.218) (-845.320) * (-846.401) (-845.431) [-849.637] (-849.315) -- 0:00:17
Average standard deviation of split frequencies: 0.007318
720500 -- (-844.756) [-847.925] (-850.924) (-845.690) * (-846.337) (-845.922) [-847.776] (-849.282) -- 0:00:17
721000 -- [-845.471] (-844.537) (-844.274) (-845.409) * [-847.059] (-845.712) (-845.762) (-847.217) -- 0:00:17
721500 -- (-856.508) (-844.455) [-844.399] (-844.586) * [-846.589] (-845.209) (-845.676) (-851.154) -- 0:00:17
722000 -- (-854.183) (-845.222) (-845.146) [-848.743] * (-847.569) (-846.778) [-845.607] (-844.656) -- 0:00:17
722500 -- [-850.843] (-850.558) (-845.419) (-846.436) * [-846.459] (-844.972) (-849.160) (-844.490) -- 0:00:17
723000 -- (-846.476) [-845.871] (-845.314) (-845.204) * (-846.502) (-847.243) [-846.446] (-848.801) -- 0:00:17
723500 -- (-847.708) (-846.835) [-845.923] (-844.483) * (-847.085) (-845.624) [-847.641] (-849.131) -- 0:00:17
724000 -- [-845.881] (-846.460) (-845.207) (-845.338) * (-846.995) (-844.273) (-848.321) [-846.618] -- 0:00:17
724500 -- [-845.416] (-845.306) (-846.839) (-846.280) * (-845.767) [-844.193] (-846.678) (-844.625) -- 0:00:17
725000 -- [-844.151] (-845.233) (-844.721) (-850.025) * (-844.097) (-848.274) [-847.498] (-844.914) -- 0:00:17
Average standard deviation of split frequencies: 0.007868
725500 -- (-846.145) [-845.255] (-846.140) (-847.876) * (-845.111) [-850.837] (-850.487) (-844.458) -- 0:00:17
726000 -- (-846.027) (-844.799) [-845.071] (-846.766) * [-847.996] (-845.417) (-847.515) (-845.754) -- 0:00:17
726500 -- [-845.287] (-844.471) (-850.266) (-845.153) * [-846.546] (-850.071) (-849.010) (-847.394) -- 0:00:17
727000 -- (-843.989) (-846.489) (-848.854) [-846.468] * [-844.508] (-851.583) (-845.039) (-847.779) -- 0:00:17
727500 -- (-848.344) (-848.033) (-847.950) [-845.897] * [-845.588] (-847.110) (-846.419) (-846.681) -- 0:00:17
728000 -- (-848.844) (-849.344) (-845.157) [-845.534] * [-845.163] (-846.822) (-845.940) (-847.933) -- 0:00:17
728500 -- [-845.793] (-848.203) (-846.485) (-845.208) * (-846.150) [-845.899] (-846.994) (-852.035) -- 0:00:17
729000 -- [-846.211] (-845.718) (-845.532) (-846.949) * (-846.107) (-846.791) (-851.250) [-844.706] -- 0:00:17
729500 -- [-848.368] (-844.765) (-845.901) (-845.299) * [-845.122] (-844.787) (-845.911) (-845.883) -- 0:00:17
730000 -- (-849.572) (-845.744) (-845.716) [-848.031] * (-848.066) [-848.847] (-845.145) (-847.667) -- 0:00:17
Average standard deviation of split frequencies: 0.007818
730500 -- (-848.934) (-847.133) [-845.691] (-844.940) * (-848.753) (-846.083) [-844.293] (-844.327) -- 0:00:16
731000 -- [-845.929] (-851.374) (-846.514) (-847.869) * (-845.718) (-847.825) [-844.413] (-849.292) -- 0:00:16
731500 -- (-848.429) (-847.478) [-845.130] (-845.746) * (-846.393) (-849.177) (-847.793) [-849.736] -- 0:00:16
732000 -- (-846.222) (-846.821) (-845.364) [-844.956] * [-845.794] (-845.436) (-853.128) (-845.393) -- 0:00:16
732500 -- (-846.446) (-847.360) [-845.498] (-845.940) * (-848.198) [-845.116] (-849.638) (-847.878) -- 0:00:16
733000 -- (-846.904) (-851.466) (-847.132) [-850.204] * [-846.572] (-846.521) (-846.641) (-849.740) -- 0:00:16
733500 -- (-847.754) [-845.958] (-844.521) (-849.492) * [-845.929] (-846.080) (-845.722) (-848.107) -- 0:00:17
734000 -- [-844.877] (-845.685) (-846.406) (-849.576) * [-848.531] (-844.998) (-844.809) (-847.358) -- 0:00:17
734500 -- (-845.576) (-847.345) [-846.053] (-848.131) * (-850.346) [-846.805] (-851.535) (-847.763) -- 0:00:16
735000 -- (-845.343) (-845.988) (-846.672) [-845.284] * [-849.445] (-846.166) (-844.292) (-849.833) -- 0:00:16
Average standard deviation of split frequencies: 0.006490
735500 -- (-845.440) (-847.084) [-846.429] (-844.289) * (-845.241) (-847.146) [-845.245] (-847.122) -- 0:00:16
736000 -- (-845.375) [-844.645] (-845.854) (-844.733) * [-845.597] (-846.400) (-844.551) (-850.750) -- 0:00:16
736500 -- (-845.821) [-844.235] (-848.968) (-844.883) * [-845.884] (-850.985) (-844.518) (-844.474) -- 0:00:16
737000 -- [-845.135] (-845.248) (-844.612) (-847.030) * (-846.224) (-848.173) (-846.296) [-848.951] -- 0:00:16
737500 -- (-845.792) [-844.774] (-844.618) (-846.972) * (-845.575) [-846.304] (-846.589) (-847.279) -- 0:00:16
738000 -- [-846.026] (-848.018) (-846.254) (-845.055) * [-845.259] (-846.604) (-845.908) (-850.313) -- 0:00:16
738500 -- (-845.368) (-846.415) [-845.115] (-845.865) * (-845.696) (-845.465) (-847.026) [-846.259] -- 0:00:16
739000 -- (-846.298) [-844.153] (-849.778) (-844.815) * (-848.539) (-844.666) [-846.324] (-849.038) -- 0:00:16
739500 -- [-844.520] (-846.060) (-846.031) (-845.478) * (-847.960) (-846.234) (-846.455) [-846.585] -- 0:00:16
740000 -- (-845.528) [-844.412] (-846.571) (-849.289) * (-851.017) [-846.634] (-847.337) (-846.424) -- 0:00:16
Average standard deviation of split frequencies: 0.006704
740500 -- (-847.748) [-845.858] (-847.431) (-845.992) * [-845.447] (-848.289) (-848.429) (-845.549) -- 0:00:16
741000 -- (-845.342) (-847.016) [-847.733] (-845.488) * [-847.320] (-847.454) (-845.068) (-845.065) -- 0:00:16
741500 -- [-844.577] (-848.083) (-848.549) (-846.205) * [-844.809] (-846.946) (-844.924) (-845.759) -- 0:00:16
742000 -- (-845.293) (-845.327) [-845.498] (-845.164) * (-844.751) (-844.686) (-844.781) [-846.271] -- 0:00:16
742500 -- (-846.005) (-844.392) (-846.536) [-845.317] * (-844.536) (-844.452) (-856.126) [-844.030] -- 0:00:16
743000 -- [-845.205] (-844.895) (-850.114) (-845.557) * (-845.298) (-845.010) (-851.843) [-849.639] -- 0:00:16
743500 -- (-846.952) [-845.155] (-846.713) (-844.418) * (-846.074) (-846.631) (-849.991) [-847.503] -- 0:00:16
744000 -- (-844.871) [-847.843] (-846.020) (-847.312) * [-847.575] (-846.740) (-848.040) (-849.019) -- 0:00:16
744500 -- (-845.940) [-848.933] (-844.760) (-848.259) * [-845.561] (-851.222) (-845.288) (-845.390) -- 0:00:16
745000 -- (-848.223) (-844.787) (-845.365) [-847.713] * (-845.355) (-846.469) (-845.860) [-847.220] -- 0:00:16
Average standard deviation of split frequencies: 0.007385
745500 -- (-844.799) [-845.328] (-845.212) (-846.216) * (-845.216) [-847.805] (-847.279) (-847.527) -- 0:00:16
746000 -- (-849.528) (-847.901) (-845.165) [-845.879] * (-845.198) (-845.326) (-846.793) [-846.207] -- 0:00:16
746500 -- [-844.857] (-850.272) (-850.453) (-844.566) * [-844.848] (-847.449) (-844.777) (-848.864) -- 0:00:15
747000 -- (-845.039) (-845.400) [-848.725] (-846.265) * [-845.920] (-849.784) (-846.408) (-846.465) -- 0:00:15
747500 -- (-846.318) (-847.406) [-844.430] (-846.795) * (-845.379) [-848.924] (-847.265) (-846.849) -- 0:00:15
748000 -- (-845.425) [-848.350] (-844.933) (-848.112) * [-845.223] (-846.895) (-847.308) (-848.930) -- 0:00:15
748500 -- [-846.263] (-846.810) (-850.077) (-846.368) * (-851.842) (-848.302) [-846.134] (-846.967) -- 0:00:15
749000 -- (-846.195) (-846.063) (-846.904) [-846.623] * (-846.655) (-852.576) (-846.461) [-848.285] -- 0:00:15
749500 -- [-844.743] (-846.158) (-844.978) (-847.930) * [-845.227] (-845.120) (-850.401) (-846.961) -- 0:00:15
750000 -- [-847.956] (-846.636) (-846.078) (-845.772) * [-845.490] (-847.978) (-849.598) (-844.852) -- 0:00:16
Average standard deviation of split frequencies: 0.006070
750500 -- (-850.680) (-848.824) (-844.692) [-845.213] * [-844.409] (-847.066) (-845.133) (-844.988) -- 0:00:15
751000 -- [-848.430] (-847.914) (-849.415) (-845.198) * (-844.379) [-844.089] (-847.837) (-844.882) -- 0:00:15
751500 -- [-845.236] (-847.509) (-849.491) (-847.128) * (-844.907) (-845.597) (-851.389) [-844.395] -- 0:00:15
752000 -- (-846.943) (-849.039) (-850.028) [-843.944] * (-846.076) (-845.327) (-846.182) [-846.296] -- 0:00:15
752500 -- (-849.989) (-848.485) (-845.980) [-845.060] * (-853.195) [-844.922] (-846.187) (-847.743) -- 0:00:15
753000 -- (-848.229) (-844.608) [-846.204] (-847.235) * (-852.964) (-847.707) (-846.294) [-845.485] -- 0:00:15
753500 -- (-851.430) [-844.324] (-847.063) (-847.555) * (-847.181) (-846.842) [-844.483] (-845.920) -- 0:00:15
754000 -- [-846.485] (-846.277) (-847.641) (-848.929) * (-849.586) (-847.766) [-846.272] (-845.107) -- 0:00:15
754500 -- (-847.009) [-844.852] (-846.268) (-848.722) * [-845.656] (-847.168) (-848.570) (-848.893) -- 0:00:15
755000 -- (-847.421) (-845.595) [-845.746] (-845.589) * (-846.882) (-844.860) [-845.049] (-846.888) -- 0:00:15
Average standard deviation of split frequencies: 0.005612
755500 -- (-845.445) [-844.524] (-849.863) (-849.158) * [-844.563] (-844.798) (-845.939) (-845.194) -- 0:00:15
756000 -- [-845.282] (-846.150) (-845.365) (-846.440) * [-844.606] (-847.677) (-845.016) (-846.692) -- 0:00:15
756500 -- (-844.435) (-845.152) [-846.549] (-845.539) * (-844.058) (-848.261) (-847.630) [-844.860] -- 0:00:15
757000 -- (-846.032) (-845.432) (-846.792) [-846.981] * [-846.361] (-846.323) (-845.390) (-844.044) -- 0:00:15
757500 -- (-845.834) (-846.489) [-846.903] (-845.294) * (-848.194) (-845.098) (-847.205) [-844.113] -- 0:00:15
758000 -- [-846.250] (-846.120) (-848.643) (-845.433) * (-848.206) (-847.834) (-847.965) [-846.359] -- 0:00:15
758500 -- (-845.659) [-845.729] (-849.807) (-847.074) * [-845.739] (-845.655) (-845.745) (-849.383) -- 0:00:15
759000 -- (-845.559) (-847.661) [-846.999] (-848.229) * (-845.076) (-847.910) (-844.681) [-849.260] -- 0:00:15
759500 -- (-847.718) [-850.152] (-848.933) (-851.012) * (-844.115) (-848.254) [-847.366] (-845.484) -- 0:00:15
760000 -- (-844.761) [-844.460] (-845.159) (-845.971) * (-849.597) (-844.397) [-845.754] (-846.329) -- 0:00:15
Average standard deviation of split frequencies: 0.005536
760500 -- (-846.606) [-844.177] (-844.575) (-848.243) * (-846.498) (-845.985) (-846.366) [-846.501] -- 0:00:15
761000 -- (-846.983) [-844.438] (-849.240) (-848.282) * (-847.914) [-847.010] (-846.174) (-846.972) -- 0:00:15
761500 -- [-846.350] (-846.368) (-847.179) (-849.476) * (-848.621) (-844.958) [-846.598] (-851.296) -- 0:00:15
762000 -- [-846.108] (-847.808) (-847.856) (-850.035) * (-847.316) [-844.170] (-848.401) (-850.637) -- 0:00:14
762500 -- [-847.007] (-844.933) (-851.676) (-847.417) * (-850.997) (-845.547) [-847.492] (-849.062) -- 0:00:14
763000 -- [-847.093] (-845.615) (-850.322) (-849.010) * (-846.194) [-845.543] (-845.396) (-846.658) -- 0:00:14
763500 -- (-847.149) (-845.084) [-845.205] (-847.962) * (-845.343) (-846.732) (-849.520) [-846.272] -- 0:00:14
764000 -- (-847.739) (-846.207) (-846.683) [-846.280] * (-845.228) (-849.628) [-845.189] (-845.538) -- 0:00:14
764500 -- (-847.939) [-846.583] (-846.765) (-847.105) * (-844.695) (-847.475) [-849.465] (-846.818) -- 0:00:14
765000 -- (-849.126) (-849.097) (-846.149) [-844.827] * (-844.289) (-847.221) [-846.183] (-847.467) -- 0:00:14
Average standard deviation of split frequencies: 0.005416
765500 -- (-848.078) (-850.416) [-846.720] (-847.358) * (-845.100) [-847.318] (-845.345) (-846.633) -- 0:00:14
766000 -- (-852.904) (-849.362) (-847.093) [-845.758] * (-848.324) [-847.618] (-845.424) (-849.391) -- 0:00:14
766500 -- (-855.309) (-845.045) (-846.136) [-845.607] * (-850.140) (-847.425) (-844.963) [-844.425] -- 0:00:14
767000 -- (-853.902) (-845.655) [-844.768] (-844.606) * [-845.337] (-846.062) (-846.879) (-845.244) -- 0:00:14
767500 -- (-850.372) (-847.743) [-845.675] (-845.523) * [-844.780] (-847.473) (-844.866) (-845.176) -- 0:00:14
768000 -- (-847.198) [-848.487] (-853.053) (-846.524) * (-846.519) (-847.054) (-845.202) [-845.528] -- 0:00:14
768500 -- (-845.051) (-851.164) [-846.958] (-847.518) * [-846.164] (-847.029) (-848.834) (-845.436) -- 0:00:14
769000 -- [-845.327] (-851.306) (-845.833) (-848.629) * (-847.436) [-844.617] (-848.989) (-847.348) -- 0:00:14
769500 -- (-845.973) (-849.861) [-850.062] (-846.860) * (-846.879) (-845.576) (-847.157) [-846.952] -- 0:00:14
770000 -- (-845.726) (-848.328) [-846.944] (-845.881) * (-846.625) (-846.461) [-845.945] (-849.297) -- 0:00:14
Average standard deviation of split frequencies: 0.005887
770500 -- (-844.639) (-845.811) [-845.211] (-846.284) * (-847.574) [-845.853] (-846.166) (-846.819) -- 0:00:14
771000 -- (-845.097) (-846.872) (-846.622) [-847.236] * (-846.244) (-845.903) [-844.694] (-845.884) -- 0:00:14
771500 -- (-846.570) (-848.750) (-851.624) [-847.178] * (-847.093) (-844.743) (-845.960) [-849.206] -- 0:00:14
772000 -- (-847.099) (-847.540) (-848.390) [-847.224] * (-846.763) [-844.464] (-845.076) (-844.710) -- 0:00:14
772500 -- (-847.092) [-844.930] (-845.455) (-846.536) * [-845.835] (-845.020) (-846.613) (-846.616) -- 0:00:14
773000 -- [-847.089] (-844.445) (-844.923) (-844.822) * [-846.641] (-845.892) (-847.785) (-845.361) -- 0:00:14
773500 -- (-846.390) (-844.313) (-846.357) [-844.422] * (-846.384) [-846.517] (-845.230) (-846.087) -- 0:00:14
774000 -- (-847.089) [-844.519] (-846.891) (-845.245) * (-845.153) (-847.694) (-851.499) [-845.757] -- 0:00:14
774500 -- [-846.455] (-843.876) (-845.504) (-844.756) * (-845.050) (-847.111) (-846.142) [-844.956] -- 0:00:14
775000 -- [-848.654] (-845.381) (-844.968) (-845.350) * [-844.591] (-844.099) (-846.241) (-846.447) -- 0:00:14
Average standard deviation of split frequencies: 0.005733
775500 -- (-845.451) [-844.192] (-852.776) (-845.501) * (-846.473) [-845.984] (-847.336) (-845.720) -- 0:00:14
776000 -- (-845.556) [-845.475] (-845.493) (-846.082) * (-851.480) (-851.075) [-850.914] (-845.157) -- 0:00:14
776500 -- (-845.136) (-848.005) (-846.861) [-845.952] * (-846.026) [-845.556] (-845.502) (-844.881) -- 0:00:14
777000 -- (-844.700) (-844.932) (-851.564) [-845.280] * (-846.593) (-844.607) (-846.920) [-845.150] -- 0:00:14
777500 -- [-846.382] (-845.316) (-848.563) (-846.115) * (-846.846) (-845.881) [-845.434] (-846.241) -- 0:00:14
778000 -- [-845.188] (-847.675) (-845.836) (-845.565) * (-850.623) (-845.647) (-845.537) [-847.276] -- 0:00:13
778500 -- [-845.732] (-849.435) (-847.846) (-850.441) * (-849.979) (-844.465) (-845.219) [-848.419] -- 0:00:13
779000 -- [-846.702] (-846.121) (-847.139) (-846.979) * (-852.306) (-845.979) (-846.190) [-847.747] -- 0:00:13
779500 -- (-846.571) (-845.602) (-847.944) [-847.132] * (-847.573) (-848.485) (-846.159) [-845.024] -- 0:00:13
780000 -- [-847.731] (-845.520) (-850.683) (-846.747) * (-847.413) [-846.482] (-844.621) (-845.323) -- 0:00:13
Average standard deviation of split frequencies: 0.005354
780500 -- (-846.542) (-848.516) (-847.060) [-846.090] * (-849.680) (-848.576) [-845.942] (-847.384) -- 0:00:13
781000 -- (-844.564) (-850.327) (-849.084) [-844.945] * (-845.368) (-845.476) (-845.886) [-845.509] -- 0:00:13
781500 -- [-845.133] (-845.644) (-846.552) (-847.010) * (-848.084) [-847.056] (-846.896) (-846.657) -- 0:00:13
782000 -- (-845.255) (-846.831) (-845.381) [-845.781] * (-845.568) (-848.087) (-846.649) [-845.690] -- 0:00:13
782500 -- (-846.982) [-849.370] (-846.228) (-846.759) * (-845.401) (-847.987) [-849.389] (-845.619) -- 0:00:13
783000 -- (-847.542) (-847.079) [-844.511] (-849.152) * [-844.517] (-847.515) (-848.568) (-844.319) -- 0:00:13
783500 -- (-844.883) [-847.675] (-845.038) (-847.701) * [-845.931] (-846.062) (-849.828) (-845.346) -- 0:00:13
784000 -- (-844.665) (-846.759) (-844.622) [-844.314] * (-848.410) (-850.283) (-850.477) [-847.051] -- 0:00:13
784500 -- (-847.842) [-845.139] (-844.426) (-847.521) * (-846.137) (-847.412) [-846.644] (-845.149) -- 0:00:13
785000 -- (-846.798) (-847.594) [-846.183] (-846.601) * (-845.173) (-845.706) [-847.616] (-849.997) -- 0:00:13
Average standard deviation of split frequencies: 0.005838
785500 -- (-848.834) (-846.374) (-849.016) [-847.761] * (-847.345) [-844.751] (-848.227) (-845.846) -- 0:00:13
786000 -- (-845.757) (-851.492) (-846.120) [-847.024] * (-845.769) (-846.444) (-846.081) [-845.458] -- 0:00:13
786500 -- (-844.618) (-851.943) (-847.083) [-844.742] * (-845.054) (-844.886) (-850.045) [-847.323] -- 0:00:13
787000 -- (-844.136) (-845.322) [-847.501] (-849.101) * [-845.290] (-845.185) (-846.530) (-845.298) -- 0:00:13
787500 -- [-848.093] (-847.282) (-846.138) (-845.008) * [-846.355] (-846.484) (-845.562) (-849.840) -- 0:00:13
788000 -- (-847.151) [-847.650] (-848.484) (-844.200) * (-846.685) [-845.815] (-846.852) (-845.709) -- 0:00:13
788500 -- [-846.208] (-849.062) (-850.678) (-844.208) * [-848.810] (-857.226) (-844.504) (-849.012) -- 0:00:13
789000 -- (-846.032) (-845.974) [-844.898] (-849.664) * (-845.632) (-847.604) (-844.658) [-847.704] -- 0:00:13
789500 -- (-848.205) [-849.561] (-847.166) (-850.327) * [-846.581] (-844.574) (-846.229) (-851.810) -- 0:00:13
790000 -- [-845.965] (-846.348) (-846.345) (-844.740) * (-845.801) [-845.130] (-846.417) (-847.480) -- 0:00:13
Average standard deviation of split frequencies: 0.005922
790500 -- (-846.472) (-845.688) (-847.602) [-846.509] * (-847.105) (-844.010) (-847.011) [-844.417] -- 0:00:13
791000 -- (-850.125) [-847.853] (-847.601) (-847.440) * [-848.100] (-847.377) (-846.399) (-849.195) -- 0:00:13
791500 -- [-847.162] (-845.319) (-848.030) (-845.776) * (-847.695) [-846.388] (-845.456) (-847.930) -- 0:00:13
792000 -- (-848.134) [-846.486] (-846.741) (-844.384) * [-848.851] (-846.252) (-845.482) (-844.845) -- 0:00:13
792500 -- (-850.176) (-845.666) [-844.803] (-845.620) * (-847.654) [-845.334] (-844.909) (-845.790) -- 0:00:13
793000 -- (-847.201) [-845.778] (-844.541) (-848.360) * (-848.849) (-848.263) [-847.805] (-849.803) -- 0:00:13
793500 -- [-847.558] (-847.243) (-846.539) (-847.405) * [-847.927] (-850.435) (-845.704) (-850.977) -- 0:00:13
794000 -- (-848.717) [-850.107] (-844.908) (-845.292) * (-846.280) (-844.303) (-846.873) [-847.506] -- 0:00:12
794500 -- [-847.213] (-845.081) (-846.615) (-845.544) * (-847.201) (-844.800) [-845.813] (-845.657) -- 0:00:12
795000 -- (-851.860) (-845.805) [-846.088] (-846.309) * [-845.893] (-845.656) (-846.372) (-846.533) -- 0:00:12
Average standard deviation of split frequencies: 0.006435
795500 -- [-850.779] (-845.022) (-849.617) (-845.859) * [-844.834] (-845.435) (-848.402) (-850.472) -- 0:00:12
796000 -- (-848.249) (-846.160) (-849.290) [-844.400] * [-844.743] (-847.735) (-847.095) (-845.248) -- 0:00:12
796500 -- (-851.390) (-847.783) (-855.503) [-844.065] * [-847.846] (-848.473) (-845.752) (-847.107) -- 0:00:12
797000 -- (-846.363) [-849.269] (-846.686) (-844.238) * (-844.058) (-847.877) (-844.424) [-845.685] -- 0:00:12
797500 -- (-845.698) (-848.021) [-845.872] (-845.887) * (-846.388) [-844.962] (-844.770) (-845.733) -- 0:00:12
798000 -- (-848.160) [-845.157] (-847.127) (-844.828) * (-844.841) (-848.301) (-844.989) [-845.628] -- 0:00:12
798500 -- [-846.288] (-845.386) (-851.613) (-844.394) * (-845.469) (-847.544) (-847.670) [-846.780] -- 0:00:12
799000 -- (-847.689) (-845.804) (-846.553) [-844.635] * (-846.584) [-846.872] (-846.575) (-848.689) -- 0:00:12
799500 -- (-845.387) [-847.278] (-844.562) (-845.282) * (-845.019) [-844.693] (-845.486) (-846.464) -- 0:00:12
800000 -- (-844.335) [-846.799] (-846.090) (-845.335) * (-845.050) (-846.387) (-845.589) [-850.212] -- 0:00:12
Average standard deviation of split frequencies: 0.006633
800500 -- (-845.056) [-848.332] (-844.035) (-848.919) * [-846.375] (-845.669) (-845.595) (-846.680) -- 0:00:12
801000 -- (-848.251) (-846.287) (-847.738) [-845.587] * (-846.339) (-846.838) (-848.480) [-848.137] -- 0:00:12
801500 -- (-851.402) (-844.693) [-847.441] (-845.587) * (-846.394) [-845.945] (-847.977) (-846.845) -- 0:00:12
802000 -- (-844.854) [-845.860] (-845.878) (-847.033) * [-844.215] (-847.307) (-846.178) (-846.078) -- 0:00:12
802500 -- (-846.629) (-845.714) (-845.859) [-845.292] * (-845.204) [-847.217] (-847.630) (-845.616) -- 0:00:12
803000 -- [-845.704] (-845.944) (-847.274) (-845.998) * (-846.453) (-846.314) (-850.694) [-845.153] -- 0:00:12
803500 -- (-847.103) [-848.962] (-850.204) (-845.048) * (-848.029) [-847.909] (-845.195) (-847.158) -- 0:00:12
804000 -- (-844.939) [-847.040] (-847.635) (-845.705) * (-846.555) [-847.133] (-846.748) (-847.237) -- 0:00:12
804500 -- (-846.542) [-848.350] (-845.322) (-848.060) * (-847.538) (-846.936) [-845.526] (-846.562) -- 0:00:12
805000 -- (-845.919) (-846.880) (-845.104) [-846.729] * [-847.685] (-846.665) (-853.069) (-845.845) -- 0:00:12
Average standard deviation of split frequencies: 0.006745
805500 -- (-845.133) [-845.203] (-845.919) (-846.720) * (-846.959) (-844.475) (-847.261) [-846.318] -- 0:00:12
806000 -- (-852.006) (-848.504) (-851.333) [-844.754] * (-845.496) (-844.981) (-846.381) [-845.050] -- 0:00:12
806500 -- [-849.392] (-847.989) (-849.423) (-844.569) * (-846.063) (-846.960) (-847.171) [-847.897] -- 0:00:12
807000 -- [-844.980] (-846.077) (-845.139) (-844.647) * (-847.244) (-846.747) [-846.536] (-850.487) -- 0:00:12
807500 -- (-847.936) [-848.373] (-845.159) (-846.230) * (-848.419) (-846.797) (-851.565) [-847.900] -- 0:00:12
808000 -- (-850.613) (-845.957) [-844.665] (-846.223) * (-846.800) [-845.908] (-850.731) (-845.599) -- 0:00:12
808500 -- [-848.760] (-845.870) (-849.460) (-845.636) * (-847.799) (-847.394) (-845.219) [-850.668] -- 0:00:12
809000 -- [-844.508] (-845.347) (-845.565) (-847.386) * (-845.962) (-846.110) [-847.561] (-845.280) -- 0:00:12
809500 -- (-844.645) (-848.732) [-844.267] (-845.379) * [-845.989] (-846.181) (-844.632) (-848.751) -- 0:00:12
810000 -- (-845.909) [-845.356] (-846.808) (-847.980) * (-848.069) [-846.174] (-845.717) (-847.504) -- 0:00:11
Average standard deviation of split frequencies: 0.006668
810500 -- (-845.243) (-850.841) (-847.790) [-846.371] * (-846.159) (-845.216) [-848.216] (-847.435) -- 0:00:11
811000 -- (-846.623) [-847.899] (-847.691) (-845.129) * (-847.100) (-847.752) [-848.167] (-846.845) -- 0:00:11
811500 -- (-847.179) (-845.212) [-845.562] (-847.251) * (-846.926) (-845.852) [-845.214] (-845.688) -- 0:00:11
812000 -- [-845.273] (-846.754) (-847.123) (-847.744) * (-846.193) (-847.737) [-845.632] (-845.590) -- 0:00:11
812500 -- [-844.530] (-851.482) (-845.834) (-849.033) * [-846.373] (-846.984) (-845.693) (-844.690) -- 0:00:11
813000 -- (-844.928) [-847.807] (-845.443) (-850.849) * [-844.775] (-847.742) (-845.242) (-844.390) -- 0:00:11
813500 -- (-844.482) (-847.576) (-848.883) [-846.997] * (-844.837) (-849.160) (-847.639) [-845.396] -- 0:00:11
814000 -- (-847.815) (-845.816) (-849.813) [-849.959] * (-846.707) (-850.087) [-845.628] (-844.530) -- 0:00:11
814500 -- (-847.679) [-855.377] (-851.285) (-847.651) * [-847.075] (-846.048) (-846.783) (-847.383) -- 0:00:11
815000 -- [-845.387] (-848.616) (-850.476) (-846.127) * [-844.749] (-846.204) (-847.589) (-846.214) -- 0:00:11
Average standard deviation of split frequencies: 0.006663
815500 -- (-845.238) (-844.505) (-848.412) [-846.999] * (-846.463) [-844.719] (-846.526) (-844.301) -- 0:00:11
816000 -- (-847.008) (-844.505) [-845.893] (-848.352) * (-845.610) (-845.521) (-846.048) [-845.243] -- 0:00:11
816500 -- [-845.326] (-844.427) (-846.249) (-847.315) * (-847.886) [-845.321] (-848.820) (-846.002) -- 0:00:11
817000 -- [-846.509] (-845.709) (-851.980) (-844.876) * (-849.523) (-845.660) (-845.672) [-848.670] -- 0:00:11
817500 -- (-845.498) (-845.444) [-855.453] (-846.127) * (-844.564) (-846.882) (-846.263) [-847.246] -- 0:00:11
818000 -- (-845.534) (-845.035) (-845.625) [-844.183] * [-845.625] (-846.809) (-846.083) (-845.344) -- 0:00:11
818500 -- (-854.158) (-849.179) (-847.220) [-844.063] * (-845.594) [-847.794] (-844.579) (-844.738) -- 0:00:11
819000 -- (-848.190) [-847.761] (-848.128) (-844.447) * [-845.329] (-848.420) (-845.747) (-844.743) -- 0:00:11
819500 -- (-845.291) (-851.215) [-847.024] (-847.426) * (-848.585) (-846.915) (-847.462) [-847.679] -- 0:00:11
820000 -- [-845.331] (-850.061) (-844.134) (-848.784) * (-850.242) (-850.562) [-847.314] (-846.144) -- 0:00:11
Average standard deviation of split frequencies: 0.006242
820500 -- (-844.832) (-849.620) (-844.462) [-846.012] * [-850.378] (-844.534) (-848.983) (-849.130) -- 0:00:11
821000 -- (-846.170) [-844.244] (-849.518) (-844.838) * (-848.586) (-844.680) (-851.341) [-846.724] -- 0:00:11
821500 -- (-846.290) (-846.770) [-847.914] (-848.955) * (-845.651) (-844.339) (-846.749) [-845.172] -- 0:00:11
822000 -- (-845.183) [-845.064] (-847.598) (-847.088) * [-849.148] (-846.510) (-847.958) (-844.553) -- 0:00:11
822500 -- (-849.495) [-846.588] (-853.997) (-844.405) * (-846.957) [-846.472] (-847.122) (-844.570) -- 0:00:11
823000 -- (-847.900) [-846.083] (-850.482) (-847.279) * (-847.476) (-845.232) (-846.939) [-844.690] -- 0:00:11
823500 -- (-847.083) (-846.673) (-844.226) [-844.873] * [-845.593] (-846.697) (-846.844) (-845.514) -- 0:00:11
824000 -- (-844.981) (-848.872) [-845.611] (-845.399) * [-852.160] (-848.936) (-851.661) (-849.873) -- 0:00:11
824500 -- (-847.639) [-845.730] (-848.353) (-848.435) * (-844.733) [-845.784] (-848.939) (-849.456) -- 0:00:11
825000 -- (-846.893) [-847.916] (-847.374) (-853.326) * (-845.183) (-845.426) (-845.901) [-846.402] -- 0:00:11
Average standard deviation of split frequencies: 0.005821
825500 -- (-844.588) (-852.332) (-845.863) [-848.947] * (-844.226) [-845.397] (-846.292) (-847.049) -- 0:00:10
826000 -- (-845.314) (-845.882) (-845.052) [-844.413] * [-844.952] (-845.816) (-844.878) (-846.711) -- 0:00:10
826500 -- [-848.737] (-848.383) (-844.177) (-846.708) * (-844.448) (-844.463) [-847.055] (-852.533) -- 0:00:10
827000 -- (-845.409) (-845.734) (-847.176) [-847.329] * (-844.846) [-848.230] (-846.105) (-844.774) -- 0:00:10
827500 -- (-848.914) (-845.867) (-846.797) [-849.841] * (-845.125) [-846.194] (-846.336) (-845.572) -- 0:00:10
828000 -- (-845.534) (-845.942) [-844.935] (-845.667) * (-847.301) [-845.490] (-847.658) (-845.321) -- 0:00:10
828500 -- (-844.200) [-844.785] (-849.788) (-850.519) * (-847.939) (-847.695) (-850.711) [-845.872] -- 0:00:10
829000 -- [-849.203] (-846.466) (-845.720) (-851.375) * (-845.299) (-847.281) [-848.217] (-846.189) -- 0:00:10
829500 -- [-844.360] (-845.136) (-849.115) (-847.264) * (-845.409) [-846.930] (-845.733) (-846.302) -- 0:00:10
830000 -- (-845.261) (-845.844) (-845.158) [-844.588] * [-844.952] (-847.918) (-848.533) (-846.776) -- 0:00:10
Average standard deviation of split frequencies: 0.006668
830500 -- (-844.245) [-844.963] (-848.964) (-848.184) * (-846.421) [-844.832] (-850.961) (-848.489) -- 0:00:10
831000 -- (-846.836) (-846.657) [-845.592] (-846.831) * (-847.799) (-845.580) [-848.030] (-848.136) -- 0:00:10
831500 -- (-847.441) (-847.207) [-846.248] (-846.152) * (-847.437) (-845.973) [-846.944] (-845.715) -- 0:00:10
832000 -- [-845.133] (-845.237) (-845.730) (-847.340) * [-843.890] (-846.013) (-846.372) (-845.888) -- 0:00:10
832500 -- (-845.598) (-846.421) [-845.660] (-849.821) * (-846.030) (-844.956) [-845.737] (-848.827) -- 0:00:10
833000 -- (-846.033) (-844.377) [-846.602] (-848.278) * (-846.815) (-846.669) [-846.715] (-847.054) -- 0:00:10
833500 -- (-849.859) [-844.299] (-844.870) (-848.704) * [-847.268] (-846.903) (-845.365) (-848.522) -- 0:00:10
834000 -- (-845.184) (-844.911) (-846.766) [-844.926] * (-846.463) (-850.073) [-847.518] (-848.333) -- 0:00:10
834500 -- (-845.181) [-846.525] (-847.897) (-844.713) * (-844.397) (-844.177) [-845.882] (-845.726) -- 0:00:10
835000 -- (-845.189) (-847.269) (-846.928) [-847.645] * (-845.238) (-845.339) [-849.878] (-845.689) -- 0:00:10
Average standard deviation of split frequencies: 0.006802
835500 -- (-844.351) (-848.142) (-845.315) [-845.884] * (-849.322) (-846.984) (-846.791) [-846.098] -- 0:00:10
836000 -- [-845.068] (-848.119) (-846.255) (-845.507) * (-847.660) (-844.807) [-845.458] (-845.995) -- 0:00:10
836500 -- [-846.644] (-849.814) (-845.514) (-848.304) * [-845.340] (-846.925) (-845.999) (-849.749) -- 0:00:10
837000 -- (-849.677) (-848.467) (-845.623) [-846.856] * (-845.981) [-845.845] (-846.743) (-847.694) -- 0:00:10
837500 -- (-845.940) (-849.146) [-845.070] (-845.708) * (-847.268) (-848.820) (-846.190) [-844.680] -- 0:00:10
838000 -- (-851.778) (-845.702) [-847.218] (-844.329) * (-847.933) (-847.844) [-844.436] (-844.581) -- 0:00:10
838500 -- (-844.684) (-845.456) [-844.913] (-845.435) * (-846.106) (-851.035) (-844.756) [-844.711] -- 0:00:10
839000 -- (-845.303) (-847.117) [-844.704] (-845.535) * (-846.253) (-847.825) (-846.294) [-845.627] -- 0:00:10
839500 -- (-847.387) (-845.990) (-846.986) [-844.287] * (-845.651) (-845.016) [-845.082] (-846.455) -- 0:00:10
840000 -- (-846.424) [-846.329] (-847.584) (-848.530) * (-849.831) (-844.831) (-845.614) [-846.247] -- 0:00:10
Average standard deviation of split frequencies: 0.007255
840500 -- (-848.792) [-846.568] (-848.452) (-847.236) * [-846.625] (-844.932) (-845.242) (-845.150) -- 0:00:10
841000 -- (-847.990) (-845.190) (-851.158) [-847.326] * (-844.709) (-844.207) [-847.776] (-845.310) -- 0:00:10
841500 -- (-844.887) [-846.903] (-851.203) (-847.030) * (-844.835) (-846.901) [-846.151] (-844.834) -- 0:00:09
842000 -- [-845.272] (-846.337) (-847.021) (-844.183) * (-847.665) (-846.952) [-846.381] (-846.023) -- 0:00:09
842500 -- [-845.151] (-848.468) (-849.128) (-848.145) * (-844.922) [-844.403] (-847.666) (-853.710) -- 0:00:09
843000 -- [-846.926] (-848.221) (-846.622) (-851.053) * (-847.015) (-844.541) [-846.088] (-851.713) -- 0:00:09
843500 -- [-847.705] (-847.883) (-848.209) (-844.530) * (-845.202) (-845.423) [-846.447] (-853.368) -- 0:00:09
844000 -- (-845.381) (-848.650) [-846.515] (-845.772) * (-845.261) (-847.906) (-847.109) [-847.197] -- 0:00:09
844500 -- (-844.649) (-847.265) (-845.025) [-846.020] * [-844.617] (-844.761) (-844.528) (-846.638) -- 0:00:09
845000 -- (-845.642) (-846.557) (-844.434) [-846.545] * (-844.860) [-847.213] (-845.040) (-847.847) -- 0:00:09
Average standard deviation of split frequencies: 0.007035
845500 -- [-846.146] (-845.032) (-847.373) (-845.362) * (-845.760) [-845.128] (-854.047) (-846.401) -- 0:00:09
846000 -- (-846.363) (-845.413) [-844.605] (-847.145) * [-845.768] (-845.445) (-848.060) (-848.978) -- 0:00:09
846500 -- (-846.054) (-847.760) (-844.431) [-844.653] * (-846.871) (-845.817) [-845.590] (-848.518) -- 0:00:09
847000 -- (-847.732) (-849.052) (-845.845) [-845.244] * [-845.438] (-845.275) (-846.280) (-848.356) -- 0:00:09
847500 -- (-847.001) [-848.151] (-845.626) (-847.258) * [-847.008] (-847.111) (-844.591) (-849.172) -- 0:00:09
848000 -- (-844.818) (-845.583) (-846.581) [-845.235] * (-845.714) (-844.399) [-848.620] (-845.429) -- 0:00:09
848500 -- (-846.940) (-845.178) (-846.216) [-845.960] * (-845.558) (-846.851) (-845.993) [-849.211] -- 0:00:09
849000 -- (-845.731) [-845.483] (-844.886) (-848.940) * (-849.040) (-845.567) (-846.275) [-848.782] -- 0:00:09
849500 -- (-845.731) (-847.833) [-848.468] (-846.198) * [-844.702] (-847.642) (-845.142) (-844.285) -- 0:00:09
850000 -- (-846.141) (-845.840) [-844.232] (-848.684) * (-844.434) (-849.066) [-845.074] (-846.624) -- 0:00:09
Average standard deviation of split frequencies: 0.007019
850500 -- (-845.907) (-847.121) [-845.133] (-847.441) * (-844.287) (-850.682) [-845.664] (-845.285) -- 0:00:09
851000 -- (-846.005) [-845.070] (-846.661) (-845.357) * (-847.516) (-849.962) (-846.677) [-845.859] -- 0:00:09
851500 -- (-848.484) [-848.215] (-846.838) (-846.373) * (-845.935) (-846.281) [-847.808] (-846.296) -- 0:00:09
852000 -- (-847.296) (-845.952) [-845.284] (-845.817) * (-848.329) (-845.926) (-848.784) [-845.347] -- 0:00:09
852500 -- (-844.538) (-846.366) (-846.750) [-845.217] * (-844.987) [-847.049] (-846.534) (-845.868) -- 0:00:09
853000 -- [-849.382] (-846.319) (-847.353) (-845.697) * [-846.827] (-845.671) (-845.967) (-846.444) -- 0:00:09
853500 -- [-848.009] (-850.020) (-847.310) (-844.864) * (-846.872) (-845.672) [-846.563] (-847.580) -- 0:00:09
854000 -- (-848.409) (-848.315) (-847.076) [-845.770] * [-846.211] (-845.034) (-846.114) (-845.395) -- 0:00:09
854500 -- [-845.410] (-846.976) (-847.903) (-846.068) * (-848.905) (-846.106) (-844.991) [-845.147] -- 0:00:09
855000 -- (-848.471) (-846.429) [-845.217] (-846.316) * [-847.315] (-847.172) (-855.273) (-847.073) -- 0:00:09
Average standard deviation of split frequencies: 0.007343
855500 -- [-848.183] (-844.698) (-845.580) (-845.652) * (-848.377) (-847.563) [-845.009] (-846.241) -- 0:00:09
856000 -- (-846.307) [-845.719] (-848.263) (-846.431) * (-844.794) [-845.168] (-846.547) (-847.258) -- 0:00:09
856500 -- (-845.239) (-846.761) (-848.212) [-845.204] * (-850.183) (-846.314) [-849.751] (-849.752) -- 0:00:09
857000 -- (-846.072) (-845.085) [-848.536] (-845.992) * (-845.154) (-847.496) (-850.029) [-849.547] -- 0:00:09
857500 -- (-845.431) (-845.156) [-845.356] (-844.552) * (-846.647) (-847.599) (-848.540) [-846.033] -- 0:00:08
858000 -- (-845.552) [-847.383] (-844.279) (-847.886) * (-846.615) (-845.699) (-845.585) [-846.211] -- 0:00:08
858500 -- (-845.565) (-845.780) (-847.700) [-845.653] * [-844.728] (-844.991) (-845.929) (-846.931) -- 0:00:08
859000 -- (-846.795) (-846.079) (-847.867) [-844.389] * (-844.337) [-844.555] (-846.279) (-846.466) -- 0:00:08
859500 -- [-845.025] (-847.257) (-846.287) (-844.496) * [-845.003] (-846.498) (-844.685) (-847.901) -- 0:00:08
860000 -- (-848.766) (-846.350) (-846.450) [-844.504] * [-845.000] (-845.900) (-848.424) (-848.877) -- 0:00:08
Average standard deviation of split frequencies: 0.006901
860500 -- (-849.358) (-847.816) [-846.088] (-845.190) * (-845.178) (-846.649) [-846.494] (-846.636) -- 0:00:08
861000 -- (-846.327) (-845.002) (-844.726) [-846.372] * [-850.161] (-845.949) (-847.709) (-847.867) -- 0:00:08
861500 -- [-847.238] (-844.867) (-844.337) (-846.056) * (-846.799) [-845.168] (-845.788) (-845.537) -- 0:00:08
862000 -- (-844.938) [-845.604] (-848.519) (-846.164) * (-846.822) (-846.555) (-847.664) [-845.580] -- 0:00:08
862500 -- [-844.838] (-848.835) (-849.613) (-845.415) * (-847.120) (-848.929) [-844.512] (-844.948) -- 0:00:08
863000 -- (-845.915) [-846.351] (-845.599) (-845.990) * (-846.275) (-846.638) (-844.130) [-845.433] -- 0:00:08
863500 -- (-845.617) (-846.802) [-848.435] (-847.521) * (-844.413) (-846.454) [-844.111] (-850.178) -- 0:00:08
864000 -- (-846.386) (-847.874) [-848.147] (-846.144) * [-847.095] (-850.311) (-844.100) (-848.910) -- 0:00:08
864500 -- (-846.307) [-848.081] (-847.642) (-846.824) * (-849.890) (-850.805) [-844.557] (-845.047) -- 0:00:08
865000 -- [-844.354] (-846.823) (-844.909) (-846.243) * (-845.994) (-846.800) [-845.894] (-845.951) -- 0:00:08
Average standard deviation of split frequencies: 0.007040
865500 -- [-846.440] (-845.752) (-845.485) (-844.812) * (-845.496) (-845.655) (-845.112) [-845.153] -- 0:00:08
866000 -- (-848.063) (-846.510) (-849.126) [-848.157] * (-848.146) (-845.812) (-845.159) [-844.674] -- 0:00:08
866500 -- (-846.275) (-848.496) (-847.669) [-845.225] * (-846.887) (-846.142) (-846.570) [-844.718] -- 0:00:08
867000 -- (-845.001) [-845.930] (-847.622) (-850.953) * (-846.573) (-847.741) (-846.905) [-844.553] -- 0:00:08
867500 -- [-844.431] (-848.155) (-845.603) (-844.373) * (-851.900) (-846.313) (-846.212) [-845.763] -- 0:00:08
868000 -- (-844.851) (-849.593) (-845.220) [-845.631] * (-849.026) (-846.653) (-844.711) [-847.089] -- 0:00:08
868500 -- [-845.010] (-844.915) (-846.066) (-844.020) * (-849.308) (-849.618) [-845.698] (-845.729) -- 0:00:08
869000 -- [-847.443] (-845.128) (-847.786) (-845.720) * (-849.085) (-844.378) [-845.524] (-851.686) -- 0:00:08
869500 -- (-849.905) (-846.258) [-847.207] (-844.229) * (-846.602) [-844.511] (-853.251) (-845.436) -- 0:00:08
870000 -- (-854.156) (-847.325) (-845.626) [-844.142] * (-846.013) (-847.840) (-849.419) [-845.165] -- 0:00:08
Average standard deviation of split frequencies: 0.006930
870500 -- (-848.506) (-847.080) (-848.284) [-845.957] * [-845.875] (-845.766) (-849.874) (-849.991) -- 0:00:08
871000 -- (-847.544) (-847.449) [-846.039] (-847.337) * (-845.462) (-850.384) [-845.741] (-851.651) -- 0:00:08
871500 -- [-844.852] (-846.499) (-847.951) (-846.885) * [-847.605] (-845.289) (-848.912) (-850.038) -- 0:00:08
872000 -- [-844.150] (-846.834) (-847.315) (-846.777) * (-844.632) [-846.999] (-847.233) (-845.956) -- 0:00:08
872500 -- (-844.163) [-846.110] (-847.122) (-847.226) * (-853.478) [-845.026] (-844.012) (-846.606) -- 0:00:08
873000 -- (-847.993) (-845.791) [-847.681] (-847.310) * (-845.134) (-850.938) (-844.618) [-846.823] -- 0:00:08
873500 -- (-850.152) (-845.582) (-847.259) [-846.610] * [-845.134] (-850.103) (-847.504) (-846.450) -- 0:00:07
874000 -- [-848.051] (-845.727) (-845.788) (-847.406) * (-844.869) (-849.419) [-849.862] (-846.064) -- 0:00:07
874500 -- [-846.712] (-846.242) (-845.104) (-845.928) * (-846.423) [-844.022] (-848.274) (-847.006) -- 0:00:07
875000 -- [-844.264] (-846.025) (-844.924) (-847.957) * [-845.319] (-846.606) (-845.530) (-854.316) -- 0:00:07
Average standard deviation of split frequencies: 0.007103
875500 -- [-844.255] (-845.053) (-845.042) (-845.819) * (-845.315) (-844.786) (-852.318) [-849.479] -- 0:00:07
876000 -- [-845.381] (-846.601) (-847.698) (-846.690) * (-850.274) [-845.125] (-846.781) (-844.331) -- 0:00:07
876500 -- [-844.480] (-846.911) (-844.915) (-846.329) * (-849.746) (-847.488) (-847.512) [-844.988] -- 0:00:07
877000 -- (-844.484) (-852.632) [-844.922] (-846.016) * (-848.295) [-845.496] (-846.337) (-845.068) -- 0:00:07
877500 -- (-849.957) (-847.457) (-847.596) [-848.202] * (-846.395) (-847.644) [-845.714] (-845.341) -- 0:00:07
878000 -- [-846.571] (-845.978) (-847.650) (-846.910) * (-846.147) [-846.672] (-845.744) (-845.031) -- 0:00:07
878500 -- [-845.108] (-847.410) (-846.452) (-844.510) * (-848.920) [-845.921] (-846.271) (-849.379) -- 0:00:07
879000 -- (-845.901) (-845.823) (-848.066) [-848.654] * (-844.672) (-846.996) (-845.873) [-845.042] -- 0:00:07
879500 -- (-846.537) (-846.049) [-846.608] (-846.054) * [-845.730] (-848.090) (-848.186) (-845.872) -- 0:00:07
880000 -- (-845.739) (-845.727) [-848.029] (-844.821) * (-846.330) [-846.650] (-846.240) (-848.941) -- 0:00:07
Average standard deviation of split frequencies: 0.006673
880500 -- (-846.113) (-849.509) (-848.038) [-844.276] * (-847.031) [-846.661] (-846.287) (-847.141) -- 0:00:07
881000 -- [-847.026] (-846.911) (-845.969) (-846.965) * [-846.622] (-846.595) (-844.828) (-845.642) -- 0:00:07
881500 -- (-847.948) (-845.167) (-848.190) [-846.855] * [-844.756] (-845.594) (-844.828) (-845.787) -- 0:00:07
882000 -- (-846.879) (-844.811) [-845.703] (-847.133) * (-845.669) (-847.123) (-845.430) [-844.214] -- 0:00:07
882500 -- (-844.082) (-845.803) [-845.994] (-844.636) * (-846.571) (-847.935) [-845.689] (-849.323) -- 0:00:07
883000 -- [-848.879] (-844.674) (-846.418) (-847.918) * (-847.488) (-846.169) [-845.714] (-846.156) -- 0:00:07
883500 -- [-845.627] (-845.388) (-844.986) (-852.903) * (-849.862) [-845.261] (-846.154) (-847.313) -- 0:00:07
884000 -- [-845.520] (-847.281) (-846.094) (-851.466) * (-846.884) (-846.837) [-849.453] (-847.031) -- 0:00:07
884500 -- (-845.193) (-846.289) (-846.914) [-851.796] * (-844.619) [-849.917] (-847.219) (-848.138) -- 0:00:07
885000 -- (-847.508) [-846.469] (-847.920) (-847.341) * (-845.935) [-844.629] (-848.406) (-848.223) -- 0:00:07
Average standard deviation of split frequencies: 0.006527
885500 -- [-846.457] (-846.139) (-849.827) (-848.101) * (-844.992) [-846.225] (-849.182) (-848.762) -- 0:00:07
886000 -- (-846.459) [-847.417] (-845.199) (-846.351) * (-845.180) [-847.900] (-844.987) (-845.527) -- 0:00:07
886500 -- [-844.844] (-847.928) (-846.026) (-846.464) * [-848.589] (-845.661) (-845.489) (-844.732) -- 0:00:07
887000 -- (-844.653) (-845.434) [-844.474] (-845.812) * [-847.489] (-845.265) (-845.153) (-848.157) -- 0:00:07
887500 -- (-845.154) (-846.200) [-845.605] (-847.546) * [-846.723] (-844.833) (-845.615) (-847.574) -- 0:00:07
888000 -- [-847.679] (-844.795) (-845.199) (-846.458) * (-846.255) (-845.495) [-844.128] (-849.065) -- 0:00:07
888500 -- (-848.771) [-848.018] (-846.864) (-844.692) * (-846.874) (-845.428) (-845.752) [-845.106] -- 0:00:07
889000 -- (-845.572) (-848.458) [-846.163] (-844.230) * (-847.548) (-846.197) (-846.858) [-845.464] -- 0:00:06
889500 -- (-844.873) (-849.104) (-846.130) [-844.533] * (-846.769) [-847.448] (-846.312) (-845.261) -- 0:00:06
890000 -- (-850.797) (-847.867) (-847.035) [-844.045] * (-846.281) (-845.433) (-848.065) [-845.906] -- 0:00:06
Average standard deviation of split frequencies: 0.006881
890500 -- [-850.311] (-846.386) (-846.302) (-844.727) * (-845.769) (-846.491) [-849.286] (-851.305) -- 0:00:06
891000 -- (-845.195) [-845.737] (-845.334) (-845.341) * (-845.588) (-850.249) [-845.655] (-846.039) -- 0:00:06
891500 -- (-844.308) (-847.733) (-846.734) [-848.105] * [-845.775] (-846.822) (-846.664) (-845.719) -- 0:00:06
892000 -- (-847.368) (-845.114) [-846.137] (-846.127) * (-848.503) (-845.053) [-846.954] (-845.486) -- 0:00:06
892500 -- (-845.632) (-844.265) [-845.685] (-845.320) * (-848.714) (-845.123) (-845.360) [-847.281] -- 0:00:06
893000 -- (-846.843) (-844.764) (-846.258) [-846.219] * (-846.568) (-846.315) [-851.513] (-846.098) -- 0:00:06
893500 -- (-845.994) (-844.539) [-845.287] (-845.336) * [-845.421] (-845.736) (-847.368) (-847.180) -- 0:00:06
894000 -- (-846.607) [-846.847] (-845.227) (-846.782) * [-844.287] (-850.065) (-845.606) (-847.341) -- 0:00:06
894500 -- [-845.458] (-847.564) (-845.618) (-844.828) * (-844.912) [-850.261] (-849.448) (-848.031) -- 0:00:06
895000 -- (-846.523) (-845.399) (-845.635) [-844.801] * (-849.028) (-847.092) (-847.782) [-845.656] -- 0:00:06
Average standard deviation of split frequencies: 0.006945
895500 -- (-845.724) (-850.418) [-845.762] (-844.854) * (-848.598) [-845.341] (-848.036) (-846.522) -- 0:00:06
896000 -- [-846.827] (-849.439) (-847.213) (-848.949) * [-845.255] (-848.115) (-846.180) (-846.821) -- 0:00:06
896500 -- (-848.818) (-846.010) [-849.560] (-846.985) * (-844.826) (-848.735) (-848.871) [-845.195] -- 0:00:06
897000 -- (-846.669) [-844.518] (-849.212) (-846.563) * (-845.220) (-846.165) [-848.639] (-845.195) -- 0:00:06
897500 -- (-849.399) (-847.050) [-846.334] (-845.012) * (-844.611) [-847.402] (-846.029) (-846.595) -- 0:00:06
898000 -- (-845.848) (-846.365) (-847.767) [-844.838] * (-849.969) (-847.150) [-845.965] (-849.202) -- 0:00:06
898500 -- [-843.992] (-845.810) (-846.010) (-845.849) * (-847.472) (-847.680) [-846.659] (-845.116) -- 0:00:06
899000 -- (-844.041) [-845.651] (-849.891) (-845.211) * (-844.189) (-844.843) [-845.454] (-845.142) -- 0:00:06
899500 -- (-844.698) (-844.888) (-848.308) [-846.667] * [-844.594] (-846.208) (-849.450) (-848.292) -- 0:00:06
900000 -- (-845.105) [-847.328] (-845.532) (-849.391) * (-846.872) (-845.137) (-847.211) [-844.458] -- 0:00:06
Average standard deviation of split frequencies: 0.006909
900500 -- (-844.056) (-848.240) [-845.093] (-847.985) * [-846.281] (-845.514) (-845.959) (-845.958) -- 0:00:06
901000 -- (-845.248) (-844.152) [-844.782] (-847.449) * (-846.634) (-847.203) (-856.829) [-845.957] -- 0:00:06
901500 -- [-844.267] (-849.919) (-851.590) (-846.345) * (-848.501) (-848.744) [-848.015] (-846.251) -- 0:00:06
902000 -- (-845.515) (-846.375) [-847.106] (-845.780) * [-848.996] (-849.427) (-850.731) (-848.881) -- 0:00:06
902500 -- (-847.958) (-848.289) [-847.516] (-845.481) * (-846.745) [-845.432] (-847.421) (-845.009) -- 0:00:06
903000 -- [-846.522] (-845.535) (-845.051) (-848.402) * [-848.132] (-848.817) (-845.587) (-847.889) -- 0:00:06
903500 -- (-850.558) (-847.491) [-845.313] (-845.558) * (-846.646) (-847.559) (-847.798) [-843.992] -- 0:00:06
904000 -- (-846.414) (-847.850) (-846.348) [-844.257] * (-847.277) (-848.308) [-845.397] (-846.391) -- 0:00:06
904500 -- (-849.781) (-848.291) (-845.356) [-844.795] * (-846.034) [-844.412] (-845.388) (-847.362) -- 0:00:06
905000 -- (-850.924) [-847.237] (-846.156) (-847.749) * (-844.243) (-845.101) [-848.461] (-845.831) -- 0:00:05
Average standard deviation of split frequencies: 0.007354
905500 -- (-844.890) (-847.003) [-845.772] (-848.568) * (-845.961) (-845.746) (-844.340) [-844.305] -- 0:00:05
906000 -- (-846.446) (-845.772) (-846.268) [-847.103] * (-844.969) [-844.996] (-844.907) (-845.110) -- 0:00:05
906500 -- (-845.285) (-847.846) [-846.664] (-848.332) * (-844.909) [-845.245] (-849.494) (-844.940) -- 0:00:05
907000 -- [-847.941] (-844.823) (-848.270) (-851.902) * [-845.475] (-848.262) (-845.765) (-848.652) -- 0:00:05
907500 -- (-850.362) [-846.596] (-845.139) (-851.104) * (-845.651) (-845.847) (-848.640) [-845.188] -- 0:00:05
908000 -- (-847.116) (-847.880) (-848.344) [-845.546] * (-844.916) (-845.052) [-846.650] (-847.865) -- 0:00:05
908500 -- [-846.251] (-848.193) (-844.900) (-845.300) * (-844.907) (-847.500) [-846.139] (-845.069) -- 0:00:05
909000 -- (-845.738) (-851.648) [-846.320] (-846.239) * (-846.707) [-845.929] (-848.080) (-845.031) -- 0:00:05
909500 -- (-845.234) [-848.416] (-846.077) (-845.667) * [-844.995] (-846.589) (-847.901) (-845.314) -- 0:00:05
910000 -- [-846.252] (-847.439) (-847.172) (-846.303) * (-844.682) [-846.875] (-851.827) (-846.615) -- 0:00:05
Average standard deviation of split frequencies: 0.007316
910500 -- (-849.365) (-851.458) [-844.831] (-852.712) * (-844.514) (-845.985) (-849.624) [-847.122] -- 0:00:05
911000 -- [-849.862] (-848.529) (-845.108) (-847.963) * [-844.448] (-845.334) (-844.849) (-851.777) -- 0:00:05
911500 -- (-844.717) [-845.477] (-844.943) (-847.390) * (-844.149) (-848.204) [-845.933] (-850.156) -- 0:00:05
912000 -- (-847.168) (-845.490) [-849.652] (-846.160) * (-845.094) (-846.745) (-849.218) [-846.181] -- 0:00:05
912500 -- (-845.580) [-849.237] (-845.551) (-846.396) * (-847.022) (-846.024) (-847.899) [-844.675] -- 0:00:05
913000 -- (-845.881) (-846.313) (-845.240) [-844.933] * (-846.651) (-845.668) (-846.223) [-844.276] -- 0:00:05
913500 -- (-849.402) [-844.902] (-846.423) (-844.896) * (-847.323) (-848.464) (-844.615) [-846.445] -- 0:00:05
914000 -- (-844.825) (-849.671) (-851.750) [-845.193] * (-845.920) (-850.626) (-845.514) [-845.384] -- 0:00:05
914500 -- [-845.861] (-846.217) (-847.912) (-847.213) * (-844.650) (-852.560) [-846.117] (-844.944) -- 0:00:05
915000 -- (-844.612) (-844.220) [-845.681] (-846.673) * (-850.152) (-846.160) (-845.937) [-844.512] -- 0:00:05
Average standard deviation of split frequencies: 0.007376
915500 -- (-845.484) (-846.893) [-846.073] (-847.929) * (-844.380) [-846.896] (-845.954) (-849.945) -- 0:00:05
916000 -- (-847.151) (-845.114) (-847.119) [-850.862] * (-844.775) [-847.486] (-849.325) (-847.118) -- 0:00:05
916500 -- [-844.975] (-846.565) (-845.849) (-847.908) * (-845.556) (-847.257) (-846.117) [-845.531] -- 0:00:05
917000 -- (-847.344) [-845.644] (-848.101) (-848.151) * [-847.646] (-847.063) (-846.336) (-845.199) -- 0:00:05
917500 -- (-844.721) [-844.365] (-845.195) (-845.402) * (-845.071) (-845.579) [-845.271] (-845.127) -- 0:00:05
918000 -- (-846.010) (-844.537) [-847.665] (-848.689) * [-846.473] (-847.362) (-845.940) (-845.742) -- 0:00:05
918500 -- (-846.116) (-845.107) [-847.722] (-848.825) * [-844.866] (-846.849) (-847.070) (-850.034) -- 0:00:05
919000 -- (-845.967) [-847.003] (-850.757) (-851.015) * (-845.600) [-845.435] (-845.547) (-844.342) -- 0:00:05
919500 -- [-846.228] (-846.036) (-847.313) (-846.974) * (-845.622) (-844.650) (-853.605) [-846.023] -- 0:00:05
920000 -- [-845.595] (-847.873) (-846.437) (-846.248) * [-846.049] (-845.216) (-849.590) (-844.954) -- 0:00:05
Average standard deviation of split frequencies: 0.007919
920500 -- (-845.500) [-851.347] (-845.727) (-845.465) * (-849.678) (-845.450) (-855.333) [-846.138] -- 0:00:05
921000 -- [-845.790] (-849.396) (-846.112) (-845.975) * (-846.360) (-845.960) [-846.464] (-846.438) -- 0:00:04
921500 -- (-846.753) (-846.303) [-845.775] (-844.979) * (-847.418) (-848.056) (-846.986) [-846.715] -- 0:00:04
922000 -- (-846.211) (-848.196) [-847.975] (-846.941) * [-847.262] (-845.617) (-845.723) (-846.052) -- 0:00:04
922500 -- (-844.908) (-846.128) (-847.048) [-846.472] * [-846.288] (-847.982) (-845.884) (-849.472) -- 0:00:04
923000 -- (-849.859) (-847.573) [-847.371] (-846.097) * (-846.236) [-846.205] (-850.704) (-852.188) -- 0:00:04
923500 -- (-846.335) (-845.499) (-845.946) [-846.424] * (-845.692) (-849.319) (-847.306) [-846.618] -- 0:00:04
924000 -- (-845.735) [-845.211] (-847.302) (-846.636) * (-845.687) (-846.656) [-847.018] (-845.690) -- 0:00:04
924500 -- (-846.346) (-844.988) (-846.933) [-846.006] * (-848.547) [-849.217] (-848.599) (-846.680) -- 0:00:04
925000 -- (-846.430) [-844.159] (-847.921) (-850.576) * [-847.648] (-846.412) (-846.740) (-845.792) -- 0:00:04
Average standard deviation of split frequencies: 0.008009
925500 -- (-845.400) (-844.768) [-844.561] (-844.682) * [-844.488] (-846.651) (-849.974) (-845.750) -- 0:00:04
926000 -- [-847.866] (-848.344) (-844.291) (-845.314) * (-844.756) (-850.842) [-850.533] (-846.680) -- 0:00:04
926500 -- (-847.904) [-844.632] (-844.946) (-845.347) * (-845.681) (-849.513) (-850.497) [-848.670] -- 0:00:04
927000 -- [-847.161] (-848.805) (-847.273) (-848.083) * (-847.752) (-844.226) (-848.898) [-845.085] -- 0:00:04
927500 -- (-847.593) (-851.476) [-846.051] (-852.941) * (-850.427) [-844.926] (-846.236) (-846.288) -- 0:00:04
928000 -- [-844.548] (-846.521) (-845.976) (-846.979) * (-850.618) (-845.247) (-847.793) [-847.790] -- 0:00:04
928500 -- (-844.325) (-847.674) [-845.302] (-845.083) * (-847.001) (-847.187) (-847.478) [-845.411] -- 0:00:04
929000 -- (-845.634) (-850.933) (-846.178) [-848.390] * (-849.711) (-848.316) (-849.478) [-844.809] -- 0:00:04
929500 -- (-845.611) (-849.965) (-846.435) [-847.197] * [-844.385] (-848.888) (-848.239) (-848.913) -- 0:00:04
930000 -- [-847.437] (-849.131) (-849.245) (-846.875) * (-847.899) [-847.713] (-846.111) (-850.425) -- 0:00:04
Average standard deviation of split frequencies: 0.008037
930500 -- (-850.415) (-848.372) (-848.225) [-846.815] * (-846.347) (-845.612) (-846.322) [-845.812] -- 0:00:04
931000 -- (-845.331) (-848.515) [-845.852] (-848.125) * (-846.358) (-844.830) (-849.955) [-844.357] -- 0:00:04
931500 -- (-846.396) (-851.923) [-847.571] (-847.350) * (-848.360) [-844.341] (-848.322) (-847.467) -- 0:00:04
932000 -- [-847.145] (-846.435) (-844.650) (-848.004) * (-845.375) (-846.058) [-845.430] (-845.786) -- 0:00:04
932500 -- (-847.769) (-849.090) (-847.718) [-846.946] * (-845.783) (-848.112) [-846.571] (-847.958) -- 0:00:04
933000 -- (-844.953) (-847.774) [-844.864] (-844.747) * (-844.868) [-846.896] (-845.697) (-848.612) -- 0:00:04
933500 -- (-847.628) (-845.688) (-845.778) [-845.860] * (-845.998) (-845.505) [-845.538] (-847.052) -- 0:00:04
934000 -- [-845.415] (-844.220) (-848.494) (-846.714) * (-845.699) [-846.994] (-844.448) (-845.874) -- 0:00:04
934500 -- [-845.618] (-849.451) (-844.617) (-849.298) * (-848.828) (-845.801) [-844.302] (-844.833) -- 0:00:04
935000 -- (-845.745) [-844.120] (-849.864) (-849.372) * [-849.708] (-844.875) (-847.182) (-849.790) -- 0:00:04
Average standard deviation of split frequencies: 0.007588
935500 -- [-845.695] (-844.341) (-846.656) (-846.096) * (-847.731) [-844.948] (-844.628) (-846.822) -- 0:00:04
936000 -- [-845.932] (-847.083) (-845.142) (-846.389) * [-845.037] (-846.503) (-844.552) (-848.540) -- 0:00:04
936500 -- (-847.158) [-845.897] (-845.533) (-846.652) * (-845.093) (-848.000) [-847.072] (-847.929) -- 0:00:04
937000 -- (-848.779) (-847.380) (-845.863) [-848.932] * (-845.228) [-846.418] (-848.604) (-847.478) -- 0:00:03
937500 -- [-846.760] (-848.661) (-845.619) (-845.375) * (-845.302) (-848.845) (-847.219) [-845.063] -- 0:00:03
938000 -- (-849.554) [-845.231] (-847.077) (-846.874) * (-845.299) [-849.298] (-846.681) (-845.761) -- 0:00:03
938500 -- (-849.410) [-846.508] (-845.203) (-846.189) * [-845.115] (-847.599) (-845.839) (-845.496) -- 0:00:03
939000 -- (-850.560) [-848.150] (-850.344) (-845.914) * [-844.853] (-847.083) (-845.743) (-845.507) -- 0:00:03
939500 -- (-844.870) (-846.794) (-849.046) [-844.176] * [-844.687] (-845.066) (-846.068) (-846.564) -- 0:00:03
940000 -- (-845.631) [-845.542] (-851.180) (-844.308) * (-845.042) (-845.809) (-849.405) [-848.656] -- 0:00:03
Average standard deviation of split frequencies: 0.007383
940500 -- (-850.401) (-845.031) [-844.753] (-846.297) * (-846.795) (-846.968) (-845.732) [-846.665] -- 0:00:03
941000 -- (-846.450) [-844.544] (-846.922) (-845.171) * (-846.472) [-845.685] (-844.506) (-846.466) -- 0:00:03
941500 -- (-846.059) (-846.359) [-848.911] (-846.357) * (-846.759) (-845.673) (-846.805) [-846.070] -- 0:00:03
942000 -- (-847.989) [-846.996] (-845.650) (-849.971) * [-850.899] (-849.686) (-845.514) (-846.262) -- 0:00:03
942500 -- (-847.173) (-850.038) (-845.714) [-846.184] * (-847.721) (-847.285) [-845.300] (-846.229) -- 0:00:03
943000 -- (-844.520) (-850.060) [-848.377] (-846.177) * (-844.989) (-844.928) (-845.458) [-846.016] -- 0:00:03
943500 -- (-844.494) [-847.867] (-849.002) (-844.784) * (-845.805) [-845.488] (-845.977) (-845.492) -- 0:00:03
944000 -- (-846.182) (-851.374) [-849.124] (-845.075) * (-848.022) (-845.468) (-847.401) [-847.506] -- 0:00:03
944500 -- [-844.811] (-857.977) (-844.741) (-845.080) * (-844.732) (-845.864) [-848.748] (-845.418) -- 0:00:03
945000 -- (-846.513) [-855.196] (-844.627) (-844.819) * (-844.982) [-845.680] (-846.966) (-844.334) -- 0:00:03
Average standard deviation of split frequencies: 0.007242
945500 -- (-846.582) (-847.764) [-845.542] (-845.738) * [-844.982] (-844.725) (-846.565) (-846.257) -- 0:00:03
946000 -- (-847.698) (-847.808) (-845.606) [-846.983] * (-845.726) [-846.000] (-848.054) (-847.297) -- 0:00:03
946500 -- [-852.394] (-850.411) (-845.621) (-845.532) * (-845.892) (-845.340) [-844.753] (-846.870) -- 0:00:03
947000 -- (-849.207) [-845.324] (-845.638) (-846.948) * (-845.243) (-844.436) (-845.577) [-847.056] -- 0:00:03
947500 -- (-845.419) (-849.909) (-845.287) [-846.104] * (-846.217) (-846.627) (-847.844) [-844.933] -- 0:00:03
948000 -- [-846.507] (-857.660) (-845.886) (-849.105) * [-847.319] (-846.847) (-846.716) (-845.736) -- 0:00:03
948500 -- [-845.558] (-844.922) (-845.286) (-846.925) * (-848.836) (-848.934) [-845.192] (-847.054) -- 0:00:03
949000 -- (-844.484) (-844.363) (-845.712) [-844.336] * [-847.204] (-844.957) (-847.144) (-847.678) -- 0:00:03
949500 -- (-844.946) [-846.180] (-846.450) (-844.706) * [-844.512] (-845.138) (-851.703) (-851.172) -- 0:00:03
950000 -- (-845.725) (-848.062) (-849.350) [-845.106] * (-845.463) [-846.708] (-850.950) (-845.973) -- 0:00:03
Average standard deviation of split frequencies: 0.007273
950500 -- (-848.344) (-845.849) (-848.760) [-844.098] * (-845.089) (-845.129) [-844.746] (-846.337) -- 0:00:03
951000 -- (-848.108) (-844.254) (-846.589) [-845.314] * (-846.959) (-844.539) [-844.553] (-846.978) -- 0:00:03
951500 -- (-845.699) (-845.190) [-844.675] (-844.848) * (-848.021) (-847.247) [-844.628] (-846.960) -- 0:00:03
952000 -- (-846.030) [-850.110] (-845.106) (-845.202) * (-844.081) (-847.891) (-847.188) [-847.977] -- 0:00:03
952500 -- [-846.212] (-847.894) (-845.650) (-852.150) * (-845.787) [-846.283] (-846.387) (-846.429) -- 0:00:02
953000 -- [-845.281] (-845.467) (-845.878) (-844.799) * (-850.413) [-844.884] (-845.698) (-850.304) -- 0:00:02
953500 -- (-845.647) (-846.838) [-846.758] (-845.392) * [-844.984] (-847.263) (-845.548) (-851.021) -- 0:00:02
954000 -- [-845.719] (-846.702) (-846.462) (-849.731) * (-849.188) [-852.536] (-845.418) (-844.653) -- 0:00:02
954500 -- [-846.653] (-844.755) (-848.184) (-846.542) * [-846.428] (-848.279) (-844.709) (-844.723) -- 0:00:02
955000 -- (-845.789) (-845.206) (-848.542) [-845.249] * (-845.544) (-848.345) [-847.620] (-846.475) -- 0:00:02
Average standard deviation of split frequencies: 0.007166
955500 -- [-844.519] (-845.028) (-846.263) (-844.351) * (-846.132) [-845.589] (-846.428) (-844.292) -- 0:00:02
956000 -- [-846.010] (-846.701) (-849.062) (-845.051) * (-846.868) (-846.834) (-847.184) [-845.468] -- 0:00:02
956500 -- (-846.521) (-846.751) (-847.208) [-846.385] * (-850.512) (-849.587) (-845.242) [-845.835] -- 0:00:02
957000 -- (-848.411) (-847.088) (-846.812) [-846.023] * [-844.449] (-847.128) (-852.436) (-844.689) -- 0:00:02
957500 -- (-845.896) [-845.981] (-847.703) (-847.785) * (-846.504) (-847.137) [-846.344] (-846.524) -- 0:00:02
958000 -- [-844.988] (-847.475) (-848.124) (-846.671) * (-845.896) [-850.782] (-846.314) (-846.927) -- 0:00:02
958500 -- [-845.857] (-846.936) (-850.683) (-845.265) * (-847.955) [-845.867] (-846.189) (-846.567) -- 0:00:02
959000 -- (-844.663) (-845.730) [-846.822] (-844.607) * (-847.365) [-845.867] (-848.304) (-846.206) -- 0:00:02
959500 -- (-846.206) (-845.271) [-848.691] (-849.379) * [-845.530] (-849.964) (-846.581) (-845.149) -- 0:00:02
960000 -- (-845.617) (-848.388) [-845.864] (-847.301) * [-845.105] (-845.928) (-845.742) (-844.795) -- 0:00:02
Average standard deviation of split frequencies: 0.007132
960500 -- (-846.190) [-846.746] (-846.268) (-845.588) * [-845.572] (-845.270) (-845.691) (-845.519) -- 0:00:02
961000 -- (-846.727) (-850.098) (-849.257) [-844.896] * (-847.721) [-845.449] (-846.283) (-845.652) -- 0:00:02
961500 -- (-845.274) [-845.248] (-847.806) (-848.233) * (-849.864) [-845.261] (-850.467) (-849.005) -- 0:00:02
962000 -- (-845.269) (-848.637) [-846.960] (-845.450) * (-846.774) (-849.863) [-847.640] (-847.282) -- 0:00:02
962500 -- [-847.055] (-850.178) (-847.686) (-847.738) * (-846.832) (-847.474) [-847.333] (-846.005) -- 0:00:02
963000 -- (-849.556) [-845.494] (-847.132) (-848.188) * (-845.047) [-851.288] (-846.817) (-844.794) -- 0:00:02
963500 -- (-847.927) [-847.588] (-847.352) (-849.524) * (-848.216) (-846.834) [-847.687] (-846.279) -- 0:00:02
964000 -- [-845.089] (-846.043) (-845.057) (-848.563) * (-846.079) (-846.285) (-853.371) [-846.340] -- 0:00:02
964500 -- (-847.003) (-846.598) [-845.567] (-848.665) * (-848.891) (-845.703) [-846.330] (-846.348) -- 0:00:02
965000 -- [-846.536] (-848.729) (-845.411) (-846.545) * (-850.741) (-847.227) (-848.603) [-845.360] -- 0:00:02
Average standard deviation of split frequencies: 0.007255
965500 -- (-844.990) [-847.009] (-847.161) (-844.689) * (-844.361) [-846.880] (-846.448) (-847.355) -- 0:00:02
966000 -- (-847.409) (-844.877) [-846.264] (-845.665) * [-845.210] (-845.243) (-849.682) (-847.199) -- 0:00:02
966500 -- (-850.802) (-845.716) (-846.185) [-844.392] * (-849.004) [-852.371] (-846.007) (-848.602) -- 0:00:02
967000 -- (-844.824) [-846.788] (-849.480) (-845.257) * (-845.440) (-847.559) (-846.880) [-845.612] -- 0:00:02
967500 -- (-845.062) (-845.042) [-845.486] (-847.436) * (-845.871) (-847.345) (-844.999) [-847.068] -- 0:00:02
968000 -- (-844.558) (-846.906) [-847.695] (-849.238) * (-848.346) (-848.529) (-846.501) [-847.306] -- 0:00:02
968500 -- (-846.368) [-846.941] (-847.274) (-846.885) * (-846.625) [-844.069] (-845.356) (-847.838) -- 0:00:01
969000 -- (-846.166) (-849.126) [-845.759] (-849.219) * (-845.438) [-844.870] (-845.766) (-845.918) -- 0:00:01
969500 -- (-844.591) (-846.518) (-844.790) [-844.162] * (-848.010) [-845.778] (-845.803) (-845.739) -- 0:00:01
970000 -- (-845.652) (-846.089) [-844.579] (-850.180) * [-846.069] (-847.228) (-844.182) (-845.932) -- 0:00:01
Average standard deviation of split frequencies: 0.007090
970500 -- (-847.913) (-846.006) [-845.774] (-847.421) * (-846.610) (-844.430) [-844.040] (-845.687) -- 0:00:01
971000 -- (-848.050) [-844.930] (-846.786) (-844.572) * (-846.221) (-846.236) [-849.243] (-845.916) -- 0:00:01
971500 -- (-847.724) (-844.521) [-846.879] (-846.222) * (-846.346) (-848.895) (-850.542) [-845.313] -- 0:00:01
972000 -- (-846.189) (-844.237) [-846.876] (-844.118) * (-848.967) [-851.548] (-847.498) (-845.686) -- 0:00:01
972500 -- (-847.381) (-844.778) [-845.756] (-846.343) * (-846.131) (-844.546) (-846.749) [-845.070] -- 0:00:01
973000 -- (-847.590) [-846.310] (-847.269) (-844.812) * (-847.897) [-844.755] (-846.235) (-844.536) -- 0:00:01
973500 -- [-845.362] (-847.083) (-845.717) (-848.221) * (-846.860) [-845.548] (-845.464) (-849.262) -- 0:00:01
974000 -- (-844.796) (-849.165) [-845.053] (-845.228) * (-851.419) (-846.034) (-845.507) [-846.049] -- 0:00:01
974500 -- (-845.595) [-844.933] (-848.631) (-844.865) * [-848.447] (-846.489) (-846.711) (-845.737) -- 0:00:01
975000 -- [-846.146] (-846.822) (-850.526) (-847.127) * (-846.178) (-847.973) (-845.555) [-844.760] -- 0:00:01
Average standard deviation of split frequencies: 0.007470
975500 -- (-845.783) (-847.361) (-845.151) [-848.564] * [-846.613] (-848.160) (-845.095) (-845.869) -- 0:00:01
976000 -- (-846.768) [-845.530] (-848.586) (-848.487) * (-846.130) [-845.269] (-851.570) (-846.862) -- 0:00:01
976500 -- (-844.838) (-843.983) (-845.760) [-847.133] * (-846.190) (-852.700) (-846.657) [-845.156] -- 0:00:01
977000 -- (-847.404) (-845.685) [-847.220] (-844.213) * (-852.009) (-849.702) (-845.714) [-845.964] -- 0:00:01
977500 -- [-846.790] (-845.323) (-846.525) (-844.089) * (-849.122) [-851.263] (-845.485) (-844.856) -- 0:00:01
978000 -- (-844.223) (-846.221) (-846.400) [-845.725] * [-845.964] (-845.093) (-847.407) (-846.582) -- 0:00:01
978500 -- (-847.733) [-844.568] (-844.798) (-846.785) * (-845.389) (-845.048) (-847.272) [-844.890] -- 0:00:01
979000 -- (-848.184) [-845.929] (-849.700) (-845.872) * (-846.114) [-844.467] (-844.233) (-848.747) -- 0:00:01
979500 -- (-845.203) (-849.941) (-847.634) [-844.283] * (-845.484) (-845.226) (-846.002) [-845.396] -- 0:00:01
980000 -- (-848.276) (-844.910) [-848.350] (-846.063) * [-846.979] (-847.111) (-846.943) (-846.111) -- 0:00:01
Average standard deviation of split frequencies: 0.007531
980500 -- (-848.847) (-845.191) [-845.725] (-849.154) * (-847.379) [-846.029] (-846.576) (-845.929) -- 0:00:01
981000 -- (-848.130) [-847.550] (-845.695) (-849.141) * (-846.249) [-846.625] (-849.567) (-846.307) -- 0:00:01
981500 -- [-846.343] (-848.585) (-848.715) (-853.991) * (-845.878) (-846.704) [-846.265] (-845.593) -- 0:00:01
982000 -- (-849.325) [-849.493] (-848.239) (-846.411) * (-845.699) (-847.491) (-845.214) [-845.605] -- 0:00:01
982500 -- (-846.827) (-846.436) [-846.864] (-847.425) * (-846.369) (-847.952) [-848.624] (-850.037) -- 0:00:01
983000 -- [-847.043] (-847.104) (-849.325) (-848.681) * (-845.740) [-848.107] (-844.668) (-846.415) -- 0:00:01
983500 -- (-846.959) (-846.834) (-846.965) [-847.405] * [-846.610] (-847.520) (-845.959) (-846.209) -- 0:00:01
984000 -- (-847.783) (-846.623) [-846.751] (-845.712) * (-846.371) (-846.876) (-847.211) [-847.947] -- 0:00:01
984500 -- (-845.361) (-845.265) [-845.341] (-847.403) * (-845.604) (-847.345) (-845.989) [-851.492] -- 0:00:00
985000 -- (-845.266) [-846.457] (-847.039) (-846.822) * (-851.759) (-846.101) (-844.650) [-846.380] -- 0:00:00
Average standard deviation of split frequencies: 0.008247
985500 -- (-846.343) [-847.240] (-849.408) (-849.588) * (-848.826) (-845.563) (-847.065) [-846.401] -- 0:00:00
986000 -- (-845.820) (-848.602) [-845.776] (-846.137) * (-846.218) (-847.491) (-844.601) [-846.861] -- 0:00:00
986500 -- (-844.535) (-846.727) [-849.031] (-852.800) * [-845.145] (-845.739) (-847.527) (-844.720) -- 0:00:00
987000 -- (-846.653) (-846.400) [-849.865] (-847.420) * (-845.237) (-846.247) [-846.819] (-847.505) -- 0:00:00
987500 -- (-846.459) (-844.754) [-848.862] (-846.929) * (-844.824) (-846.426) [-846.080] (-845.514) -- 0:00:00
988000 -- (-848.952) [-844.430] (-846.338) (-849.324) * (-849.529) (-847.012) (-847.483) [-845.038] -- 0:00:00
988500 -- (-846.090) (-845.566) [-846.070] (-844.545) * (-849.037) (-848.592) (-848.043) [-850.970] -- 0:00:00
989000 -- (-845.753) [-845.999] (-847.244) (-845.747) * (-844.952) (-848.336) [-846.587] (-847.654) -- 0:00:00
989500 -- [-849.771] (-846.934) (-846.346) (-849.103) * (-846.889) [-844.658] (-844.481) (-846.653) -- 0:00:00
990000 -- (-845.604) (-845.616) [-843.991] (-845.769) * (-845.287) [-844.747] (-850.493) (-847.645) -- 0:00:00
Average standard deviation of split frequencies: 0.008268
990500 -- (-849.532) [-846.224] (-849.213) (-845.260) * (-845.878) [-846.593] (-851.714) (-848.838) -- 0:00:00
991000 -- (-849.436) [-845.103] (-847.325) (-848.642) * (-846.830) (-844.011) (-846.833) [-845.813] -- 0:00:00
991500 -- [-846.735] (-846.156) (-846.073) (-846.796) * [-846.967] (-846.175) (-845.857) (-848.516) -- 0:00:00
992000 -- (-846.234) (-846.624) [-847.982] (-850.085) * (-845.950) (-849.184) [-846.669] (-851.147) -- 0:00:00
992500 -- (-846.483) (-845.404) [-846.498] (-845.835) * [-844.905] (-850.886) (-846.119) (-846.819) -- 0:00:00
993000 -- [-845.193] (-845.355) (-844.446) (-845.218) * (-846.038) (-851.368) [-846.189] (-846.176) -- 0:00:00
993500 -- (-847.435) (-848.358) [-844.614] (-846.470) * (-845.484) (-850.653) (-846.930) [-845.709] -- 0:00:00
994000 -- (-844.516) [-848.883] (-848.780) (-845.642) * (-847.232) (-847.083) [-846.883] (-846.608) -- 0:00:00
994500 -- (-844.531) (-847.945) [-849.879] (-847.351) * (-852.324) (-846.865) (-845.088) [-847.670] -- 0:00:00
995000 -- (-845.694) (-846.443) [-848.575] (-845.527) * (-844.874) (-845.539) (-845.179) [-844.729] -- 0:00:00
Average standard deviation of split frequencies: 0.008431
995500 -- [-845.240] (-850.447) (-844.687) (-847.361) * (-845.799) [-845.246] (-845.836) (-845.833) -- 0:00:00
996000 -- (-845.330) (-848.081) [-845.246] (-847.743) * (-847.967) (-845.644) (-844.985) [-848.012] -- 0:00:00
996500 -- (-846.363) [-844.674] (-845.387) (-844.719) * (-844.950) (-850.610) [-845.978] (-850.455) -- 0:00:00
997000 -- (-847.020) (-845.527) (-844.437) [-844.119] * (-845.928) (-846.687) [-845.007] (-848.095) -- 0:00:00
997500 -- (-845.114) (-847.016) [-847.146] (-844.247) * (-846.686) (-846.148) [-845.484] (-846.702) -- 0:00:00
998000 -- [-846.825] (-845.398) (-846.888) (-845.553) * (-847.649) (-846.331) (-844.785) [-846.314] -- 0:00:00
998500 -- (-849.619) [-847.230] (-844.832) (-847.395) * (-847.011) [-843.936] (-847.249) (-847.248) -- 0:00:00
999000 -- (-846.864) (-844.831) [-844.624] (-848.463) * [-844.556] (-848.615) (-846.007) (-851.360) -- 0:00:00
999500 -- [-846.479] (-846.628) (-848.333) (-847.393) * (-848.087) (-851.120) (-845.394) [-847.315] -- 0:00:00
1000000 -- (-846.538) (-845.188) (-846.116) [-847.484] * (-847.136) (-850.848) (-848.081) [-849.001] -- 0:00:00
Average standard deviation of split frequencies: 0.008450
Analysis completed in 1 mins 3 seconds
Analysis used 61.31 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -843.83
Likelihood of best state for "cold" chain of run 2 was -843.83
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
29.2 % ( 30 %) Dirichlet(Pi{all})
30.9 % ( 28 %) Slider(Pi{all})
79.3 % ( 51 %) Multiplier(Alpha{1,2})
77.8 % ( 47 %) Multiplier(Alpha{3})
21.2 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 15 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.2 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 64 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.5 % ( 24 %) Dirichlet(Pi{all})
30.5 % ( 33 %) Slider(Pi{all})
78.1 % ( 46 %) Multiplier(Alpha{1,2})
78.1 % ( 51 %) Multiplier(Alpha{3})
22.2 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 19 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167076 0.82 0.67
3 | 166356 166577 0.84
4 | 166780 166588 166623
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166441 0.83 0.67
3 | 166786 166197 0.84
4 | 166750 167023 166803
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -845.59
| 1 2 2 |
| 2 1 |
| 1 2 1 111 1 |
| 2 11 1 2 1 1 2 12 1 2 1 |
|1 * 2 2 2 12 2 121 22 1 2 21 1 |
|2 11 2 2 2 1111 2 1 1 21 1 22 2 2|
| 11 * *1 21 1 2 * 2 |
| 2 2 1 1 2 2 2 221 21 1|
| 2 1 2 2 1 2 2 2 1 2 |
| 2 1 2 1 2 * |
| 1 1 1 1 1 21 |
| 2 2 |
| 22 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -847.35
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -845.52 -849.49
2 -845.56 -848.38
--------------------------------------
TOTAL -845.54 -849.08
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900121 0.089120 0.359665 1.475860 0.869149 1473.58 1487.29 1.000
r(A<->C){all} 0.167782 0.020520 0.000033 0.456448 0.130462 149.23 184.53 1.000
r(A<->G){all} 0.178181 0.021186 0.000036 0.470541 0.141499 230.20 285.00 1.000
r(A<->T){all} 0.175981 0.019392 0.000030 0.455720 0.143948 302.12 330.15 1.000
r(C<->G){all} 0.166109 0.020683 0.000012 0.463239 0.125918 270.92 356.16 1.000
r(C<->T){all} 0.158917 0.018986 0.000027 0.433663 0.122279 145.17 256.39 1.000
r(G<->T){all} 0.153030 0.016560 0.000030 0.412610 0.118047 364.27 380.13 1.003
pi(A){all} 0.225509 0.000264 0.193683 0.256828 0.225400 1286.56 1315.06 1.000
pi(C){all} 0.299195 0.000341 0.263526 0.335646 0.298778 1281.16 1289.03 1.000
pi(G){all} 0.295996 0.000336 0.258719 0.330793 0.296094 1377.90 1396.63 1.000
pi(T){all} 0.179301 0.000232 0.149964 0.207750 0.179081 1343.71 1343.90 1.000
alpha{1,2} 0.418100 0.236144 0.000297 1.404564 0.237022 1287.71 1356.36 1.000
alpha{3} 0.449958 0.243625 0.000176 1.423558 0.285643 1070.14 1269.28 1.000
pinvar{all} 0.997468 0.000010 0.991795 1.000000 0.998452 1367.63 1434.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- ..*.*.
9 -- .****.
10 -- ..****
11 -- .***.*
12 -- .*..*.
13 -- .*.*..
14 -- .*.***
15 -- ....**
16 -- ..*..*
17 -- ..**..
18 -- .**...
19 -- ...**.
20 -- .*...*
21 -- .**.**
22 -- .**.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 475 0.158228 0.002355 0.156562 0.159893 2
8 449 0.149567 0.007066 0.144570 0.154564 2
9 448 0.149234 0.013191 0.139907 0.158561 2
10 447 0.148901 0.019315 0.135243 0.162558 2
11 446 0.148568 0.012248 0.139907 0.157229 2
12 441 0.146902 0.004240 0.143904 0.149900 2
13 437 0.145570 0.002355 0.143904 0.147235 2
14 435 0.144903 0.004240 0.141905 0.147901 2
15 422 0.140573 0.005653 0.136576 0.144570 2
16 419 0.139574 0.010835 0.131912 0.147235 2
17 409 0.136243 0.008951 0.129913 0.142572 2
18 407 0.135576 0.011777 0.127249 0.143904 2
19 405 0.134910 0.014604 0.124584 0.145237 2
20 405 0.134910 0.000471 0.134577 0.135243 2
21 403 0.134244 0.002355 0.132578 0.135909 2
22 271 0.090273 0.015546 0.079280 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100975 0.010236 0.000009 0.299881 0.071258 1.000 2
length{all}[2] 0.100427 0.009917 0.000049 0.293302 0.070263 1.000 2
length{all}[3] 0.099109 0.009325 0.000075 0.293769 0.070306 1.000 2
length{all}[4] 0.103014 0.010416 0.000062 0.311706 0.071526 1.000 2
length{all}[5] 0.097450 0.009644 0.000026 0.285654 0.067774 1.000 2
length{all}[6] 0.099083 0.010281 0.000034 0.303141 0.066523 1.002 2
length{all}[7] 0.094490 0.008262 0.000486 0.284419 0.065220 1.006 2
length{all}[8] 0.104397 0.011748 0.000002 0.346242 0.071159 0.998 2
length{all}[9] 0.104456 0.010030 0.000097 0.298667 0.077862 1.000 2
length{all}[10] 0.098776 0.009050 0.000303 0.288781 0.071574 0.998 2
length{all}[11] 0.099760 0.009183 0.000126 0.288701 0.071908 0.999 2
length{all}[12] 0.097076 0.009104 0.000368 0.269020 0.069738 0.999 2
length{all}[13] 0.099746 0.008508 0.000124 0.271531 0.071336 0.998 2
length{all}[14] 0.094344 0.008449 0.000170 0.276608 0.066657 1.002 2
length{all}[15] 0.100530 0.011518 0.000213 0.308955 0.064028 0.998 2
length{all}[16] 0.094504 0.008514 0.000006 0.282539 0.062004 0.998 2
length{all}[17] 0.104959 0.009584 0.000533 0.301582 0.081520 1.001 2
length{all}[18] 0.091859 0.008141 0.000044 0.271861 0.066632 1.002 2
length{all}[19] 0.098579 0.009397 0.000015 0.294655 0.065716 0.998 2
length{all}[20] 0.111589 0.013318 0.000237 0.325576 0.081516 0.999 2
length{all}[21] 0.103564 0.010825 0.000129 0.306444 0.070912 0.999 2
length{all}[22] 0.091669 0.008725 0.000095 0.258794 0.065077 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008450
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 618
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 206 / 206 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 206 / 206 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072324 0.045866 0.025983 0.050870 0.074717 0.070908 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -882.409519
Iterating by ming2
Initial: fx= 882.409519
x= 0.07232 0.04587 0.02598 0.05087 0.07472 0.07091 0.30000 1.30000
1 h-m-p 0.0000 0.0001 495.9757 ++ 850.949839 m 0.0001 13 | 1/8
2 h-m-p 0.0014 0.0144 41.4501 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 454.3829 ++ 830.679858 m 0.0001 44 | 2/8
4 h-m-p 0.0012 0.0362 32.8121 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 407.5607 ++ 826.576996 m 0.0000 75 | 3/8
6 h-m-p 0.0003 0.0519 26.4040 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 352.9284 ++ 814.195971 m 0.0001 105 | 4/8
8 h-m-p 0.0014 0.0677 20.3003 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 289.1672 ++ 813.609665 m 0.0000 136 | 5/8
10 h-m-p 0.0002 0.0987 14.1701 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 204.4802 ++ 813.113639 m 0.0000 166 | 6/8
12 h-m-p 0.0822 8.0000 0.0000 +C 813.113639 0 0.3977 178 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 813.113639 m 8.0000 221 | 6/8
15 h-m-p 0.0004 0.2132 6.9955 ----------C 813.113639 0 0.0000 244 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 813.113639 m 8.0000 258 | 6/8
17 h-m-p 0.0160 8.0000 0.3766 -----------C 813.113639 0 0.0000 282 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 --C 813.113639 0 0.0003 297 | 6/8
19 h-m-p 0.0160 8.0000 0.0000 -----C 813.113639 0 0.0000 315
Out..
lnL = -813.113639
316 lfun, 316 eigenQcodon, 1896 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079126 0.060457 0.049630 0.037718 0.078336 0.039453 0.299853 0.552779 0.299792
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.866484
np = 9
lnL0 = -880.362387
Iterating by ming2
Initial: fx= 880.362387
x= 0.07913 0.06046 0.04963 0.03772 0.07834 0.03945 0.29985 0.55278 0.29979
1 h-m-p 0.0000 0.0002 459.6387 +++ 836.976623 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 210.7265 ++ 835.217865 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0000 204979.6911 ++ 827.022388 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 4156169.9553 ++ 820.480008 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 14900.7852 ++ 813.270662 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 11670.4794 ++ 813.113580 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 813.113580 m 8.0000 87 | 6/9
8 h-m-p 0.0048 2.3885 0.4094 ----------Y 813.113580 0 0.0000 112 | 6/9
9 h-m-p 0.0011 0.5676 0.1328 +++++ 813.113568 m 0.5676 130 | 7/9
10 h-m-p 0.2477 7.4656 0.0882 ------------C 813.113568 0 0.0000 157 | 7/9
11 h-m-p 0.0160 8.0000 0.0002 +++++ 813.113568 m 8.0000 174 | 7/9
12 h-m-p 0.0039 0.9781 0.4727 --------C 813.113568 0 0.0000 196 | 7/9
13 h-m-p 0.0160 8.0000 0.0004 -------------.. | 7/9
14 h-m-p 0.0160 8.0000 0.0002 +++++ 813.113567 m 8.0000 238 | 7/9
15 h-m-p 0.0058 2.3834 0.2849 ---------C 813.113567 0 0.0000 261 | 7/9
16 h-m-p 0.0160 8.0000 0.0263 +++++ 813.113499 m 8.0000 278 | 7/9
17 h-m-p 0.4910 2.4550 0.3553 ----------------.. | 7/9
18 h-m-p 0.0160 8.0000 0.0005 +++++ 813.113497 m 8.0000 323 | 7/9
19 h-m-p 0.0211 4.6191 0.1920 -------------.. | 7/9
20 h-m-p 0.0160 8.0000 0.0005 +++++ 813.113495 m 8.0000 365 | 7/9
21 h-m-p 0.0218 4.6814 0.1903 -------------.. | 7/9
22 h-m-p 0.0160 8.0000 0.0005 +++++ 813.113493 m 8.0000 407 | 7/9
23 h-m-p 0.0225 4.7507 0.1883 -----------Y 813.113493 0 0.0000 432 | 7/9
24 h-m-p 0.0160 8.0000 0.0005 +++++ 813.113492 m 8.0000 449 | 7/9
25 h-m-p 0.0124 1.0649 0.3007 -------------.. | 7/9
26 h-m-p 0.0160 8.0000 0.0005 +++++ 813.113489 m 8.0000 491 | 7/9
27 h-m-p 0.0236 4.8661 0.1852 -----------C 813.113489 0 0.0000 516 | 7/9
28 h-m-p 0.0160 8.0000 0.0003 +++++ 813.113489 m 8.0000 533 | 7/9
29 h-m-p 0.0069 1.1078 0.2911 -----------Y 813.113489 0 0.0000 558 | 7/9
30 h-m-p 0.0160 8.0000 0.0000 +++++ 813.113489 m 8.0000 575 | 7/9
31 h-m-p 0.0113 5.6278 0.2416 ----------Y 813.113489 0 0.0000 599 | 7/9
32 h-m-p 0.0160 8.0000 0.0006 +++++ 813.113486 m 8.0000 616 | 7/9
33 h-m-p 0.0184 5.7286 0.2481 -------------.. | 7/9
34 h-m-p 0.0160 8.0000 0.0006 +++++ 813.113484 m 8.0000 658 | 7/9
35 h-m-p 0.0255 5.0279 0.1809 -------------.. | 7/9
36 h-m-p 0.0160 8.0000 0.0006 +++++ 813.113481 m 8.0000 700 | 7/9
37 h-m-p 0.0264 5.1112 0.1788 -------------.. | 7/9
38 h-m-p 0.0160 8.0000 0.0006 +++++ 813.113478 m 8.0000 742 | 7/9
39 h-m-p 0.0275 5.2001 0.1766 --------------.. | 7/9
40 h-m-p 0.0160 8.0000 0.0006 +++++ 813.113475 m 8.0000 785 | 7/9
41 h-m-p 0.0286 5.2931 0.1743 ------------Y 813.113475 0 0.0000 811 | 7/9
42 h-m-p 0.0160 8.0000 0.0012 +++++ 813.113470 m 8.0000 828 | 7/9
43 h-m-p 0.0369 6.2967 0.2516 --------------.. | 7/9
44 h-m-p 0.0160 8.0000 0.0007 +++++ 813.113467 m 8.0000 871 | 7/9
45 h-m-p 0.0316 5.5096 0.1692 -----------C 813.113467 0 0.0000 896 | 7/9
46 h-m-p 0.0160 8.0000 0.0099 +++++ 813.113397 m 8.0000 913 | 7/9
47 h-m-p 0.4209 5.2177 0.1876 ---------------.. | 7/9
48 h-m-p 0.0160 8.0000 0.0012 +++++ 813.113386 m 8.0000 957 | 7/9
49 h-m-p 0.0734 7.8822 0.1286 --------------.. | 7/9
50 h-m-p 0.0160 8.0000 0.0013 +++++ 813.113372 m 8.0000 1000 | 7/9
51 h-m-p 0.0821 8.0000 0.1242 ------------N 813.113372 0 0.0000 1026 | 7/9
52 h-m-p 0.0002 0.0801 0.0277 +++++ 813.113369 m 0.0801 1043 | 8/9
53 h-m-p 0.0160 8.0000 0.0001 +++++ 813.113369 m 8.0000 1060 | 8/9
54 h-m-p 0.0160 8.0000 0.8070 -------------.. | 8/9
55 h-m-p 0.0160 8.0000 0.0003 +++++ 813.113368 m 8.0000 1100 | 8/9
56 h-m-p 0.0160 8.0000 0.8242 -----------N 813.113368 0 0.0000 1124 | 8/9
57 h-m-p 0.0160 8.0000 0.0000 +++++ 813.113368 m 8.0000 1140 | 8/9
58 h-m-p 0.0160 8.0000 0.8555 ------------Y 813.113368 0 0.0000 1165 | 8/9
59 h-m-p 0.0160 8.0000 0.0001 ------C 813.113368 0 0.0000 1184 | 8/9
60 h-m-p 0.0160 8.0000 0.0000 +++++ 813.113368 m 8.0000 1200 | 8/9
61 h-m-p 0.0160 8.0000 1.2786 -----------Y 813.113368 0 0.0000 1224 | 8/9
62 h-m-p 0.0160 8.0000 0.0000 +++++ 813.113368 m 8.0000 1239 | 8/9
63 h-m-p 0.0160 8.0000 0.0006 +++++ 813.113366 m 8.0000 1255 | 8/9
64 h-m-p 0.0160 8.0000 0.8127 -------------.. | 8/9
65 h-m-p 0.0160 8.0000 0.0003 +++++ 813.113366 m 8.0000 1295 | 8/9
66 h-m-p 0.0160 8.0000 0.8101 ------------Y 813.113366 0 0.0000 1320 | 8/9
67 h-m-p 0.0160 8.0000 0.0000 +++++ 813.113366 m 8.0000 1336 | 8/9
68 h-m-p 0.0160 8.0000 0.7735 ----------C 813.113366 0 0.0000 1359 | 8/9
69 h-m-p 0.0160 8.0000 0.0001 -------C 813.113366 0 0.0000 1379 | 8/9
70 h-m-p 0.0160 8.0000 0.0000 +++++ 813.113366 m 8.0000 1395 | 8/9
71 h-m-p 0.0002 0.0851 2.2426 +++++ 813.113299 m 0.0851 1411 | 9/9
72 h-m-p 0.0160 8.0000 0.0000 C 813.113299 0 0.0160 1423 | 9/9
73 h-m-p 0.0160 8.0000 0.0000 C 813.113299 0 0.0160 1435
Out..
lnL = -813.113299
1436 lfun, 4308 eigenQcodon, 17232 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099722 0.042092 0.077247 0.091632 0.036299 0.033157 0.000100 1.101677 0.349683 0.361988 1.340170
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.157172
np = 11
lnL0 = -886.485993
Iterating by ming2
Initial: fx= 886.485993
x= 0.09972 0.04209 0.07725 0.09163 0.03630 0.03316 0.00011 1.10168 0.34968 0.36199 1.34017
1 h-m-p 0.0000 0.0000 451.1697 ++ 885.875452 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 307.3988 +++ 847.831568 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 472.0775 ++ 845.103371 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0002 157.7826 ++ 840.430054 m 0.0002 59 | 4/11
5 h-m-p 0.0000 0.0002 439.1701 ++ 820.648360 m 0.0002 73 | 5/11
6 h-m-p 0.0001 0.0005 202.0553 ++ 814.790784 m 0.0005 87 | 6/11
7 h-m-p 0.0000 0.0000 4075.9361 ++ 814.586675 m 0.0000 101 | 7/11
8 h-m-p 0.0020 0.7780 1.4199 ------------.. | 7/11
9 h-m-p 0.0000 0.0000 200.1346 ++ 813.113576 m 0.0000 139 | 8/11
10 h-m-p 0.0685 8.0000 0.0000 ++++ 813.113576 m 8.0000 155 | 8/11
11 h-m-p 0.0179 8.0000 0.0052 +++++ 813.113575 m 8.0000 175 | 8/11
12 h-m-p 0.0160 8.0000 4.1162 -----------N 813.113575 0 0.0000 203 | 8/11
13 h-m-p 0.0160 8.0000 0.0003 +++++ 813.113575 m 8.0000 220 | 8/11
14 h-m-p 0.0160 8.0000 1.3851 -------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 813.113575 m 8.0000 265 | 8/11
16 h-m-p 0.0051 2.5717 0.2606 +++++ 813.113524 m 2.5717 285 | 9/11
17 h-m-p 0.3312 8.0000 1.7444 --------------Y 813.113524 0 0.0000 316 | 9/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 813.113523 m 8.0000 333 | 9/11
19 h-m-p 0.0151 7.5351 14.1762 -------------.. | 9/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 813.113523 m 8.0000 377 | 9/11
21 h-m-p 0.0160 8.0000 0.2290 +++++ 813.113375 m 8.0000 396 | 9/11
22 h-m-p 0.3207 8.0000 5.7118 ++Y 813.113299 0 5.1309 414 | 9/11
23 h-m-p 1.6000 8.0000 0.0000 N 813.113299 0 1.6000 428 | 9/11
24 h-m-p 0.0160 8.0000 0.0000 C 813.113299 0 0.0160 444
Out..
lnL = -813.113299
445 lfun, 1780 eigenQcodon, 8010 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -813.169590 S = -813.114440 -0.021335
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:07
did 20 / 55 patterns 0:07
did 30 / 55 patterns 0:07
did 40 / 55 patterns 0:07
did 50 / 55 patterns 0:07
did 55 / 55 patterns 0:07
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042856 0.026149 0.097279 0.017703 0.069529 0.010471 0.000100 0.200455 1.417452
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 30.597150
np = 9
lnL0 = -861.656850
Iterating by ming2
Initial: fx= 861.656850
x= 0.04286 0.02615 0.09728 0.01770 0.06953 0.01047 0.00011 0.20045 1.41745
1 h-m-p 0.0000 0.0000 428.5531 ++ 861.443514 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0136 22.1919 ++++CYCCC 861.233757 4 0.0062 37 | 1/9
3 h-m-p 0.0012 0.0061 9.1691 -----------.. | 1/9
4 h-m-p 0.0000 0.0000 429.2263 ++ 853.010699 m 0.0000 70 | 2/9
5 h-m-p 0.0001 0.0007 95.2810 ++ 846.949731 m 0.0007 82 | 3/9
6 h-m-p 0.0000 0.0001 537.3666 ++ 837.823849 m 0.0001 94 | 4/9
7 h-m-p 0.0001 0.0006 40.3319 ++ 836.895308 m 0.0006 106 | 5/9
8 h-m-p 0.0001 0.0004 127.8230 ++ 828.382643 m 0.0004 118 | 6/9
9 h-m-p 0.0015 0.0192 12.4434 ++ 819.119889 m 0.0192 130 | 7/9
10 h-m-p 0.0008 0.0169 58.9116 ++
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
+ 813.113299 m 0.0169 143
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.184724e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144760e-160 2000 rounds
| 8/9
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
Y 813.113299 0 1.6000 155
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.184724e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27544) = 1.144683e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27519) = 1.144839e-160 2000 rounds
| 8/9
12 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
Y 813.113299 0 0.0160 168
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
Out..
lnL = -813.113299
169 lfun, 1859 eigenQcodon, 10140 P(t)
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27532) = 1.144761e-160 2000 rounds
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108034 0.031778 0.016519 0.095068 0.079359 0.068214 0.000100 0.900000 0.868057 1.045258 1.299445
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.681537
np = 11
lnL0 = -888.488511
Iterating by ming2
Initial: fx= 888.488511
x= 0.10803 0.03178 0.01652 0.09507 0.07936 0.06821 0.00011 0.90000 0.86806 1.04526 1.29944
1 h-m-p 0.0000 0.0000 434.5800 ++ 888.123062 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0015 123.8371 ++++ 867.898653 m 0.0015 32 | 2/11
3 h-m-p 0.0001 0.0003 243.3262 ++ 854.010122 m 0.0003 46 | 3/11
4 h-m-p 0.0002 0.0011 332.1817 ++ 825.471134 m 0.0011 60 | 4/11
5 h-m-p 0.0000 0.0000 38391.4229 ++ 819.842281 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0002 1705.0612 ++ 814.722734 m 0.0002 88 | 6/11
7 h-m-p 0.0000 0.0000 392607.9826 ++ 813.113537 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 813.113536 m 8.0000 116 | 7/11
9 h-m-p 0.0094 0.1144 0.1737 ++ 813.113533 m 0.1144 134 | 8/11
10 h-m-p 0.0466 7.5201 0.2009 -----------Y 813.113533 0 0.0000 163 | 8/11
11 h-m-p 0.0160 8.0000 0.0012 +++++ 813.113528 m 8.0000 183 | 8/11
12 h-m-p 0.0489 5.7035 0.1916 -----------Y 813.113528 0 0.0000 211 | 8/11
13 h-m-p 0.0160 8.0000 0.0005 +++++ 813.113527 m 8.0000 231 | 8/11
14 h-m-p 0.0235 6.2544 0.1800 -----------Y 813.113527 0 0.0000 259 | 8/11
15 h-m-p 0.0160 8.0000 0.0002 --------Y 813.113527 0 0.0000 284 | 8/11
16 h-m-p 0.0160 8.0000 0.0001 --------Y 813.113527 0 0.0000 309
Out..
lnL = -813.113527
310 lfun, 3720 eigenQcodon, 20460 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -813.142226 S = -813.111177 -0.013694
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:14
did 20 / 55 patterns 0:15
did 30 / 55 patterns 0:15
did 40 / 55 patterns 0:15
did 50 / 55 patterns 0:15
did 55 / 55 patterns 0:15
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=206
NC_011896_1_WP_010907733_1_467_MLBR_RS02225 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
NC_002677_1_NP_301409_1_281_ML0455 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN
**************************************************
NC_011896_1_WP_010907733_1_467_MLBR_RS02225 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
NC_002677_1_NP_301409_1_281_ML0455 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535 STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS
**************************************************
NC_011896_1_WP_010907733_1_467_MLBR_RS02225 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
NC_002677_1_NP_301409_1_281_ML0455 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535 ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
**************************************************
NC_011896_1_WP_010907733_1_467_MLBR_RS02225 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
NC_002677_1_NP_301409_1_281_ML0455 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535 LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD
**************************************************
NC_011896_1_WP_010907733_1_467_MLBR_RS02225 DAERSL
NC_002677_1_NP_301409_1_281_ML0455 DAERSL
NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740 DAERSL
NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430 DAERSL
NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440 DAERSL
NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535 DAERSL
******
>NC_011896_1_WP_010907733_1_467_MLBR_RS02225 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC GATGCAGAGCGAAGCTTA >NC_002677_1_NP_301409_1_281_ML0455 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC GATGCAGAGCGAAGCTTA >NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC GATGCAGAGCGAAGCTTA >NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC GATGCAGAGCGAAGCTTA >NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC GATGCAGAGCGAAGCTTA >NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535 GTGAGTGAGCAGGAAAGACCCGACACACGTGCCGATCACACAGACGGCAC CATCTTGGACATGGGCGTCGGCGAGCGCGACCACTTGCAACGGCTGTGGA CACCGTACCGGATGACCTATCTGGCTGAAGCGCCAGTCAATCACGACAAC TCCACCCCGGCGCAGCCGTTCACCGACATTCCACAATTGTCCGATGAAGA CGGCTTGGTGGTAGCCCGCGGTGAACTCGTCTACGCCGTGCTCAACCTCT ACCCGTACAACCCCGGGCACCTAATGGTGGTGCCCTACCGGCAAGTTTCC GAGCTTGAAGACCTAACCGACGCAGAGAGCGCGGAGTTGATGACCTTCAC TCAGAAGGCGATTCGCGTCATCAAGAACGTGTCTCGGCCACATGGCTTTA ACGTGGGCCTAAACTTGGGGACATCGGCGGGAGGATCGCTGGCCGAGCAC CTGCATGTGCATGTCGTGCCACGGTGGGGTGGCGACGCGAACTTCATCAC CATCATCGGCGGCTCCAAAGTGATCCCGCAGTTGCTCCGGGATACTCGAC AGCTGCTTGCGACGGAGTGGACGAAACAGTTTATGAGCCGCAGTGGCGAC GATGCAGAGCGAAGCTTA
>NC_011896_1_WP_010907733_1_467_MLBR_RS02225 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD DAERSL >NC_002677_1_NP_301409_1_281_ML0455 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD DAERSL >NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD DAERSL >NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD DAERSL >NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD DAERSL >NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535 VSEQERPDTRADHTDGTILDMGVGERDHLQRLWTPYRMTYLAEAPVNHDN STPAQPFTDIPQLSDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRQVS ELEDLTDAESAELMTFTQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH LHVHVVPRWGGDANFITIIGGSKVIPQLLRDTRQLLATEWTKQFMSRSGD DAERSL
#NEXUS
[ID: 1869557754]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907733_1_467_MLBR_RS02225
NC_002677_1_NP_301409_1_281_ML0455
NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740
NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430
NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440
NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907733_1_467_MLBR_RS02225,
2 NC_002677_1_NP_301409_1_281_ML0455,
3 NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740,
4 NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430,
5 NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440,
6 NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07125761,2:0.07026334,3:0.07030568,4:0.07152581,5:0.06777441,6:0.06652277);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07125761,2:0.07026334,3:0.07030568,4:0.07152581,5:0.06777441,6:0.06652277);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -845.52 -849.49
2 -845.56 -848.38
--------------------------------------
TOTAL -845.54 -849.08
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0455/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900121 0.089120 0.359665 1.475860 0.869149 1473.58 1487.29 1.000
r(A<->C){all} 0.167782 0.020520 0.000033 0.456448 0.130462 149.23 184.53 1.000
r(A<->G){all} 0.178181 0.021186 0.000036 0.470541 0.141499 230.20 285.00 1.000
r(A<->T){all} 0.175981 0.019392 0.000030 0.455720 0.143948 302.12 330.15 1.000
r(C<->G){all} 0.166109 0.020683 0.000012 0.463239 0.125918 270.92 356.16 1.000
r(C<->T){all} 0.158917 0.018986 0.000027 0.433663 0.122279 145.17 256.39 1.000
r(G<->T){all} 0.153030 0.016560 0.000030 0.412610 0.118047 364.27 380.13 1.003
pi(A){all} 0.225509 0.000264 0.193683 0.256828 0.225400 1286.56 1315.06 1.000
pi(C){all} 0.299195 0.000341 0.263526 0.335646 0.298778 1281.16 1289.03 1.000
pi(G){all} 0.295996 0.000336 0.258719 0.330793 0.296094 1377.90 1396.63 1.000
pi(T){all} 0.179301 0.000232 0.149964 0.207750 0.179081 1343.71 1343.90 1.000
alpha{1,2} 0.418100 0.236144 0.000297 1.404564 0.237022 1287.71 1356.36 1.000
alpha{3} 0.449958 0.243625 0.000176 1.423558 0.285643 1070.14 1269.28 1.000
pinvar{all} 0.997468 0.000010 0.991795 1.000000 0.998452 1367.63 1434.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0455/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 206
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 4 4 4 4 4 4 | TAC 5 5 5 5 5 5 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 7 7 7 7 7 7 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 4 4 4 4 4 4 | CCC 3 3 3 3 3 3 | CAC 5 5 5 5 5 5 | CGC 4 4 4 4 4 4
CTA 3 3 3 3 3 3 | CCA 4 4 4 4 4 4 | Gln CAA 3 3 3 3 3 3 | CGA 2 2 2 2 2 2
CTG 5 5 5 5 5 5 | CCG 5 5 5 5 5 5 | CAG 6 6 6 6 6 6 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 6 6 6 6 6 6 | ACC 7 7 7 7 7 7 | AAC 7 7 7 7 7 7 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 4 4 4 4 4 4 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 5 5 5 5 5 5 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 4 4 4 4 4 4 | Gly GGT 2 2 2 2 2 2
GTC 5 5 5 5 5 5 | GCC 4 4 4 4 4 4 | GAC 11 11 11 11 11 11 | GGC 10 10 10 10 10 10
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 5 5 5 5 5 5 | GGA 2 2 2 2 2 2
GTG 10 10 10 10 10 10 | GCG 7 7 7 7 7 7 | GAG 8 8 8 8 8 8 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907733_1_467_MLBR_RS02225
position 1: T:0.14078 C:0.27184 A:0.22330 G:0.36408
position 2: T:0.27670 C:0.23301 A:0.30583 G:0.18447
position 3: T:0.12136 C:0.39320 A:0.14563 G:0.33981
Average T:0.17961 C:0.29935 A:0.22492 G:0.29612
#2: NC_002677_1_NP_301409_1_281_ML0455
position 1: T:0.14078 C:0.27184 A:0.22330 G:0.36408
position 2: T:0.27670 C:0.23301 A:0.30583 G:0.18447
position 3: T:0.12136 C:0.39320 A:0.14563 G:0.33981
Average T:0.17961 C:0.29935 A:0.22492 G:0.29612
#3: NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740
position 1: T:0.14078 C:0.27184 A:0.22330 G:0.36408
position 2: T:0.27670 C:0.23301 A:0.30583 G:0.18447
position 3: T:0.12136 C:0.39320 A:0.14563 G:0.33981
Average T:0.17961 C:0.29935 A:0.22492 G:0.29612
#4: NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430
position 1: T:0.14078 C:0.27184 A:0.22330 G:0.36408
position 2: T:0.27670 C:0.23301 A:0.30583 G:0.18447
position 3: T:0.12136 C:0.39320 A:0.14563 G:0.33981
Average T:0.17961 C:0.29935 A:0.22492 G:0.29612
#5: NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440
position 1: T:0.14078 C:0.27184 A:0.22330 G:0.36408
position 2: T:0.27670 C:0.23301 A:0.30583 G:0.18447
position 3: T:0.12136 C:0.39320 A:0.14563 G:0.33981
Average T:0.17961 C:0.29935 A:0.22492 G:0.29612
#6: NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535
position 1: T:0.14078 C:0.27184 A:0.22330 G:0.36408
position 2: T:0.27670 C:0.23301 A:0.30583 G:0.18447
position 3: T:0.12136 C:0.39320 A:0.14563 G:0.33981
Average T:0.17961 C:0.29935 A:0.22492 G:0.29612
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 24 | TAC 30 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 42 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 6
CTC 24 | CCC 18 | CAC 30 | CGC 24
CTA 18 | CCA 24 | Gln Q CAA 18 | CGA 12
CTG 30 | CCG 30 | CAG 36 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 12
ATC 36 | ACC 42 | AAC 42 | AGC 18
ATA 0 | ACA 24 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 30 | ACG 12 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 24 | Gly G GGT 12
GTC 30 | GCC 24 | GAC 66 | GGC 60
GTA 6 | GCA 12 | Glu E GAA 30 | GGA 12
GTG 60 | GCG 42 | GAG 48 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14078 C:0.27184 A:0.22330 G:0.36408
position 2: T:0.27670 C:0.23301 A:0.30583 G:0.18447
position 3: T:0.12136 C:0.39320 A:0.14563 G:0.33981
Average T:0.17961 C:0.29935 A:0.22492 G:0.29612
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -813.113639 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299853 1.299445
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907733_1_467_MLBR_RS02225: 0.000004, NC_002677_1_NP_301409_1_281_ML0455: 0.000004, NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740: 0.000004, NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430: 0.000004, NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440: 0.000004, NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29985
omega (dN/dS) = 1.29944
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 500.5 117.5 1.2994 0.0000 0.0000 0.0 0.0
7..2 0.000 500.5 117.5 1.2994 0.0000 0.0000 0.0 0.0
7..3 0.000 500.5 117.5 1.2994 0.0000 0.0000 0.0 0.0
7..4 0.000 500.5 117.5 1.2994 0.0000 0.0000 0.0 0.0
7..5 0.000 500.5 117.5 1.2994 0.0000 0.0000 0.0 0.0
7..6 0.000 500.5 117.5 1.2994 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -813.113299 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907733_1_467_MLBR_RS02225: 0.000004, NC_002677_1_NP_301409_1_281_ML0455: 0.000004, NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740: 0.000004, NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430: 0.000004, NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440: 0.000004, NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -813.113299 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907733_1_467_MLBR_RS02225: 0.000004, NC_002677_1_NP_301409_1_281_ML0455: 0.000004, NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740: 0.000004, NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430: 0.000004, NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440: 0.000004, NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907733_1_467_MLBR_RS02225)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -813.113299 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 2.275315
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907733_1_467_MLBR_RS02225: 0.000004, NC_002677_1_NP_301409_1_281_ML0455: 0.000004, NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740: 0.000004, NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430: 0.000004, NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440: 0.000004, NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 2.27532
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 507.5 110.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -813.113527 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.841683 0.005000 1.458291 1.833249
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907733_1_467_MLBR_RS02225: 0.000004, NC_002677_1_NP_301409_1_281_ML0455: 0.000004, NZ_LVXE01000035_1_WP_010907733_1_1581_A3216_RS09740: 0.000004, NZ_LYPH01000039_1_WP_010907733_1_1554_A8144_RS07430: 0.000004, NZ_CP029543_1_WP_010907733_1_476_DIJ64_RS02440: 0.000004, NZ_AP014567_1_WP_010907733_1_495_JK2ML_RS02535: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.84168 p = 0.00500 q = 1.45829
(p1 = 0.15832) w = 1.83325
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08417 0.08417 0.08417 0.08417 0.08417 0.08417 0.08417 0.08417 0.08417 0.08417 0.15832
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.83325
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 507.5 110.5 0.2902 0.0000 0.0000 0.0 0.0
7..2 0.000 507.5 110.5 0.2902 0.0000 0.0000 0.0 0.0
7..3 0.000 507.5 110.5 0.2902 0.0000 0.0000 0.0 0.0
7..4 0.000 507.5 110.5 0.2902 0.0000 0.0000 0.0 0.0
7..5 0.000 507.5 110.5 0.2902 0.0000 0.0000 0.0 0.0
7..6 0.000 507.5 110.5 0.2902 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907733_1_467_MLBR_RS02225)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907733_1_467_MLBR_RS02225)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:15
Model 1: NearlyNeutral -813.113299 Model 2: PositiveSelection -813.113299 Model 0: one-ratio -813.113639 Model 7: beta -813.113299 Model 8: beta&w>1 -813.113527 Model 0 vs 1 6.800000001021544E-4 Model 2 vs 1 0.0 Model 8 vs 7 4.5599999998557905E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
