>C1
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C2
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C3
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C4
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C5
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C6
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWDGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=301
C1 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C2 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C3 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C4 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C5 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C6 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
**************************************************
C1 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C2 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C3 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C4 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C5 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C6 EGLWDGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
****:*********************************************
C1 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C2 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C3 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C4 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C5 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C6 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
**************************************************
C1 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C2 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C3 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C4 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C5 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C6 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
**************************************************
C1 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C2 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C3 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C4 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C5 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C6 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
**************************************************
C1 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C2 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C3 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C4 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C5 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C6 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
**************************************************
C1 T
C2 T
C3 T
C4 T
C5 T
C6 T
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9030]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9030]--->[9030]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.502 Mb, Max= 30.858 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C2 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C3 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C4 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C5 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
C6 LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
**************************************************
C1 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C2 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C3 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C4 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C5 EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
C6 EGLWDGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
****:*********************************************
C1 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C2 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C3 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C4 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C5 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
C6 PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
**************************************************
C1 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C2 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C3 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C4 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C5 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
C6 TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
**************************************************
C1 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C2 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C3 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C4 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C5 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
C6 ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
**************************************************
C1 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C2 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C3 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C4 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C5 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
C6 SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
**************************************************
C1 T
C2 T
C3 T
C4 T
C5 T
C6 T
*
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.67 C1 C6 99.67
TOP 5 0 99.67 C6 C1 99.67
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.67 C2 C6 99.67
TOP 5 1 99.67 C6 C2 99.67
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.67 C3 C6 99.67
TOP 5 2 99.67 C6 C3 99.67
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.67 C4 C6 99.67
TOP 5 3 99.67 C6 C4 99.67
BOT 4 5 99.67 C5 C6 99.67
TOP 5 4 99.67 C6 C5 99.67
AVG 0 C1 * 99.93
AVG 1 C2 * 99.93
AVG 2 C3 * 99.93
AVG 3 C4 * 99.93
AVG 4 C5 * 99.93
AVG 5 C6 * 99.67
TOT TOT * 99.89
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
C2 TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
C3 TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
C4 TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
C5 TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
C6 TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
**************************************************
C1 GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
C2 GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
C3 GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
C4 GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
C5 GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
C6 GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
**************************************************
C1 ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
C2 ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
C3 ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
C4 ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
C5 ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
C6 ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
**************************************************
C1 GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
C2 GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
C3 GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
C4 GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
C5 GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
C6 GAAGGCTTGTGGGACGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
************** ***********************************
C1 TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
C2 TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
C3 TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
C4 TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
C5 TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
C6 TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
**************************************************
C1 ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
C2 ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
C3 ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
C4 ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
C5 ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
C6 ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
**************************************************
C1 CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
C2 CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
C3 CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
C4 CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
C5 CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
C6 CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
**************************************************
C1 GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
C2 GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
C3 GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
C4 GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
C5 GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
C6 GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
**************************************************
C1 TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
C2 TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
C3 TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
C4 TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
C5 TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
C6 TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
**************************************************
C1 ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
C2 ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
C3 ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
C4 ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
C5 ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
C6 ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
**************************************************
C1 TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
C2 TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
C3 TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
C4 TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
C5 TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
C6 TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
**************************************************
C1 ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
C2 ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
C3 ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
C4 ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
C5 ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
C6 ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
**************************************************
C1 GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
C2 GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
C3 GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
C4 GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
C5 GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
C6 GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
**************************************************
C1 GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
C2 GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
C3 GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
C4 GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
C5 GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
C6 GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
**************************************************
C1 ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
C2 ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
C3 ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
C4 ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
C5 ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
C6 ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
**************************************************
C1 AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
C2 AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
C3 AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
C4 AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
C5 AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
C6 AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
**************************************************
C1 GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
C2 GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
C3 GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
C4 GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
C5 GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
C6 GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
**************************************************
C1 CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
C2 CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
C3 CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
C4 CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
C5 CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
C6 CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
**************************************************
C1 ACT
C2 ACT
C3 ACT
C4 ACT
C5 ACT
C6 ACT
***
>C1
TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
ACT
>C2
TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
ACT
>C3
TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
ACT
>C4
TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
ACT
>C5
TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
GAAGGCTTGTGGGAGGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
ACT
>C6
TTGGAGACGTTCCGGTTAGGATTGGCCGCGGCCACTGCTGCCAGCATTTG
GGCGATGTTGAATCAGCCGGGCGACGCTATTAGTCTCGGCTCCGTGGTGG
ACGGTTACACCAGATTCACGCGATATGTAGCCATCGGCGACAGTCAGACC
GAAGGCTTGTGGGACGGTGATGACACGGTCGGGCTCCTAGGATTTGCTGA
TCGCCTCGCAGCACTGGTCGATGCGGTGTATCCCGGTTTGGTATACGCTA
ACCTCGCGATCCGCGGCAAGTTGCTGGCCGATGTACTCACGGAGCAGGTA
CCGCAGGTACTGGCAATGCGGCCGGATCTGATCACTGTGTGCGCCGGGAT
GAACGATGTTATCCAGCCGGGACGATCGTTCGCCCGTGCGCTTGCCGATC
TTGAATCCATGTATGCTGCGCTGGCCGAATCGGGGGCGACGATAGTGACG
ACAACCTTCCCCAACGTCGTGCAGTTCCTCCCGCTCGGACGACTTGTGGC
TAGACGGCTGTTGCGCATTAACAATGCGATTACCGCCGCCGCCGACCGCT
ACGAGTTTAAGCTCGTCGACCTGTATAATGCCGCTTCGATGCGAGATTCG
GCCACTTGGGACATCGACCGCGTACATGCGTCCACCAAGGGACATATTCT
GTTTGCTGCCGCAGTTGCCGAAGCTCTCAATTTGCCTAACAGTAGCCATG
ATTGGGCCGAAGCGAGCGGTAATCATGCGCAGGTGCCATTTGGAGTCCGT
AGCTATGAGCAGCTGCGCTGGATGCGGGAAATTTTTATGCCGTGGGTGTG
GCGATGGCTGCGTGGCAAATCTTCAGCCGATGGGCGAGTACCTAAACGCC
CGCGGTTAGAACCTGTTAGCGCGTCACACGTAGAACACCACGACGCGCCA
ACT
>C1
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C2
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C3
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C4
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C5
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWEGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
>C6
LETFRLGLAAATAASIWAMLNQPGDAISLGSVVDGYTRFTRYVAIGDSQT
EGLWDGDDTVGLLGFADRLAALVDAVYPGLVYANLAIRGKLLADVLTEQV
PQVLAMRPDLITVCAGMNDVIQPGRSFARALADLESMYAALAESGATIVT
TTFPNVVQFLPLGRLVARRLLRINNAITAAADRYEFKLVDLYNAASMRDS
ATWDIDRVHASTKGHILFAAAVAEALNLPNSSHDWAEASGNHAQVPFGVR
SYEQLRWMREIFMPWVWRWLRGKSSADGRVPKRPRLEPVSASHVEHHDAP
T
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 903 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579801362
Setting output file names to "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1343292707
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1810277310
Seed = 1908748352
Swapseed = 1579801362
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 5 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2024.360033 -- -24.965149
Chain 2 -- -2024.358600 -- -24.965149
Chain 3 -- -2024.359777 -- -24.965149
Chain 4 -- -2024.360150 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2024.360150 -- -24.965149
Chain 2 -- -2024.360150 -- -24.965149
Chain 3 -- -2024.358600 -- -24.965149
Chain 4 -- -2024.358600 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2024.360] (-2024.359) (-2024.360) (-2024.360) * [-2024.360] (-2024.360) (-2024.359) (-2024.359)
500 -- (-1262.310) (-1261.097) [-1266.151] (-1261.581) * [-1258.607] (-1266.203) (-1259.342) (-1259.525) -- 0:00:00
1000 -- (-1256.192) (-1261.183) (-1260.877) [-1260.789] * (-1251.676) (-1263.185) [-1256.417] (-1260.936) -- 0:00:00
1500 -- (-1257.256) (-1257.172) (-1254.393) [-1257.034] * (-1258.170) (-1265.446) [-1259.793] (-1256.506) -- 0:00:00
2000 -- [-1256.404] (-1257.041) (-1262.836) (-1256.534) * [-1253.344] (-1256.284) (-1256.049) (-1266.943) -- 0:00:00
2500 -- (-1254.725) (-1261.860) (-1263.986) [-1259.911] * (-1259.921) (-1258.072) (-1259.870) [-1258.928] -- 0:00:00
3000 -- [-1259.737] (-1257.314) (-1259.216) (-1262.196) * [-1258.017] (-1265.592) (-1256.857) (-1263.501) -- 0:00:00
3500 -- [-1250.940] (-1260.434) (-1251.566) (-1260.349) * (-1257.253) (-1255.215) (-1255.042) [-1254.228] -- 0:00:00
4000 -- (-1255.716) [-1258.980] (-1263.798) (-1262.906) * [-1254.811] (-1259.565) (-1258.452) (-1253.566) -- 0:00:00
4500 -- [-1252.560] (-1256.127) (-1254.497) (-1261.170) * [-1258.840] (-1261.672) (-1257.890) (-1263.361) -- 0:00:00
5000 -- (-1258.513) (-1254.037) (-1254.986) [-1258.525] * (-1260.242) (-1254.856) [-1255.801] (-1270.445) -- 0:00:00
Average standard deviation of split frequencies: 0.072020
5500 -- (-1261.070) (-1258.046) (-1253.309) [-1261.453] * (-1257.373) [-1256.174] (-1258.590) (-1259.452) -- 0:03:00
6000 -- (-1251.922) (-1257.156) (-1253.131) [-1257.849] * (-1268.787) (-1256.482) [-1259.123] (-1269.153) -- 0:02:45
6500 -- (-1251.215) (-1262.406) [-1253.897] (-1266.226) * [-1259.036] (-1254.887) (-1257.318) (-1258.623) -- 0:02:32
7000 -- (-1260.565) (-1263.881) (-1254.784) [-1254.280] * [-1258.891] (-1252.400) (-1253.146) (-1264.286) -- 0:02:21
7500 -- (-1265.445) (-1262.456) (-1258.537) [-1259.157] * [-1257.752] (-1257.387) (-1254.570) (-1267.591) -- 0:02:12
8000 -- (-1255.857) (-1253.810) [-1261.249] (-1264.051) * [-1257.370] (-1272.842) (-1254.001) (-1261.303) -- 0:02:04
8500 -- (-1254.951) (-1253.453) (-1255.609) [-1257.473] * [-1253.094] (-1251.790) (-1252.318) (-1258.458) -- 0:01:56
9000 -- (-1258.426) (-1253.663) [-1253.404] (-1270.069) * (-1258.140) (-1255.833) [-1252.030] (-1266.522) -- 0:01:50
9500 -- (-1265.423) [-1251.468] (-1264.643) (-1260.921) * [-1256.896] (-1258.315) (-1255.070) (-1258.326) -- 0:01:44
10000 -- (-1256.366) [-1251.848] (-1257.419) (-1264.164) * (-1259.771) [-1257.657] (-1254.170) (-1259.353) -- 0:01:39
Average standard deviation of split frequencies: 0.069448
10500 -- [-1256.699] (-1253.453) (-1254.622) (-1256.703) * (-1259.755) (-1257.820) [-1257.070] (-1259.444) -- 0:01:34
11000 -- (-1255.683) (-1251.399) [-1258.862] (-1257.350) * [-1251.337] (-1267.154) (-1255.021) (-1259.886) -- 0:01:29
11500 -- (-1259.343) (-1251.919) [-1256.457] (-1258.486) * (-1262.815) [-1257.958] (-1254.117) (-1263.466) -- 0:01:25
12000 -- (-1261.866) [-1251.860] (-1254.026) (-1260.271) * (-1259.188) [-1256.030] (-1251.714) (-1263.201) -- 0:01:22
12500 -- (-1253.540) [-1255.685] (-1270.403) (-1260.397) * [-1260.071] (-1253.370) (-1254.801) (-1254.802) -- 0:01:19
13000 -- (-1254.391) (-1260.244) (-1257.392) [-1259.735] * (-1259.189) [-1251.787] (-1255.628) (-1259.973) -- 0:01:15
13500 -- (-1261.116) (-1256.791) (-1258.599) [-1257.247] * (-1258.421) [-1250.643] (-1253.372) (-1263.411) -- 0:01:13
14000 -- (-1257.250) (-1254.670) (-1247.838) [-1259.683] * [-1252.840] (-1253.426) (-1251.644) (-1261.445) -- 0:01:10
14500 -- [-1254.684] (-1254.934) (-1255.448) (-1257.095) * (-1254.825) (-1250.998) (-1252.855) [-1255.507] -- 0:01:07
15000 -- (-1260.697) (-1256.476) (-1252.301) [-1262.402] * (-1257.073) (-1252.076) [-1251.053] (-1252.354) -- 0:01:05
Average standard deviation of split frequencies: 0.051172
15500 -- (-1260.796) [-1253.320] (-1258.510) (-1258.365) * (-1257.799) [-1253.556] (-1252.141) (-1253.258) -- 0:01:03
16000 -- (-1269.570) [-1253.428] (-1261.758) (-1261.193) * (-1254.341) [-1250.059] (-1254.584) (-1256.287) -- 0:01:01
16500 -- (-1257.417) (-1253.894) [-1255.629] (-1255.804) * [-1259.024] (-1256.547) (-1253.899) (-1256.512) -- 0:00:59
17000 -- (-1259.184) (-1253.522) [-1255.693] (-1257.976) * [-1261.356] (-1252.450) (-1253.568) (-1255.556) -- 0:00:57
17500 -- [-1255.581] (-1253.599) (-1260.054) (-1256.082) * [-1258.514] (-1251.043) (-1251.815) (-1256.730) -- 0:00:56
18000 -- (-1256.728) (-1256.115) (-1262.630) [-1253.018] * [-1260.258] (-1254.433) (-1252.247) (-1257.445) -- 0:00:54
18500 -- (-1258.373) (-1259.093) (-1260.618) [-1264.016] * (-1260.898) [-1253.801] (-1252.545) (-1253.805) -- 0:00:53
19000 -- (-1265.120) (-1259.804) [-1256.872] (-1259.352) * (-1257.571) (-1258.574) (-1252.208) [-1252.801] -- 0:00:51
19500 -- (-1264.510) (-1258.472) (-1263.018) [-1254.196] * [-1258.033] (-1253.238) (-1253.550) (-1253.023) -- 0:00:50
20000 -- (-1260.763) [-1254.080] (-1254.637) (-1257.121) * [-1255.841] (-1252.785) (-1254.614) (-1252.349) -- 0:00:49
Average standard deviation of split frequencies: 0.051622
20500 -- (-1258.685) (-1252.715) (-1258.587) [-1255.456] * [-1256.874] (-1255.345) (-1256.964) (-1254.552) -- 0:01:35
21000 -- (-1255.930) (-1252.585) (-1255.726) [-1258.121] * [-1260.372] (-1257.820) (-1254.884) (-1253.251) -- 0:01:33
21500 -- (-1256.923) (-1253.544) [-1252.207] (-1258.209) * (-1263.025) [-1250.085] (-1254.749) (-1251.787) -- 0:01:31
22000 -- [-1255.930] (-1253.218) (-1258.098) (-1254.514) * [-1251.965] (-1252.799) (-1252.170) (-1252.456) -- 0:01:28
22500 -- [-1254.237] (-1249.189) (-1259.126) (-1259.220) * (-1252.811) [-1249.388] (-1254.312) (-1252.183) -- 0:01:26
23000 -- [-1253.094] (-1251.952) (-1256.283) (-1251.189) * (-1253.651) (-1249.931) [-1256.974] (-1252.436) -- 0:01:24
23500 -- (-1257.694) (-1250.538) (-1256.798) [-1257.401] * (-1257.544) (-1256.252) (-1255.394) [-1253.696] -- 0:01:23
24000 -- (-1256.320) (-1252.120) (-1260.063) [-1251.056] * (-1256.378) [-1249.697] (-1252.989) (-1252.086) -- 0:01:21
24500 -- [-1256.420] (-1251.094) (-1256.663) (-1257.667) * [-1254.386] (-1249.410) (-1254.042) (-1253.043) -- 0:01:19
25000 -- [-1256.228] (-1252.020) (-1263.879) (-1259.592) * [-1254.178] (-1252.039) (-1252.273) (-1252.010) -- 0:01:18
Average standard deviation of split frequencies: 0.050272
25500 -- (-1262.364) (-1252.844) (-1257.814) [-1251.254] * [-1252.975] (-1253.064) (-1252.503) (-1252.240) -- 0:01:16
26000 -- (-1259.306) (-1252.738) (-1267.150) [-1256.970] * [-1253.561] (-1252.289) (-1253.455) (-1253.992) -- 0:01:14
26500 -- (-1252.053) (-1252.284) (-1257.550) [-1257.127] * [-1250.991] (-1251.793) (-1253.645) (-1253.344) -- 0:01:13
27000 -- (-1256.358) (-1253.269) [-1252.263] (-1258.739) * (-1252.975) (-1251.591) [-1252.057] (-1253.447) -- 0:01:12
27500 -- (-1255.961) (-1252.381) (-1254.690) [-1254.475] * (-1252.075) (-1255.115) (-1253.527) [-1252.004] -- 0:01:10
28000 -- [-1253.402] (-1252.445) (-1254.169) (-1259.556) * (-1250.840) [-1251.035] (-1252.592) (-1253.504) -- 0:01:09
28500 -- (-1255.998) (-1255.494) (-1253.650) [-1256.955] * (-1250.764) [-1250.846] (-1253.842) (-1253.099) -- 0:01:08
29000 -- [-1262.809] (-1254.580) (-1262.300) (-1260.595) * (-1253.989) (-1251.396) [-1253.437] (-1252.572) -- 0:01:06
29500 -- (-1258.613) (-1252.011) [-1257.552] (-1256.136) * (-1252.018) [-1253.895] (-1254.575) (-1251.007) -- 0:01:05
30000 -- (-1256.099) [-1252.327] (-1253.258) (-1258.583) * (-1251.222) (-1253.907) [-1253.848] (-1253.648) -- 0:01:04
Average standard deviation of split frequencies: 0.048911
30500 -- [-1252.434] (-1251.822) (-1253.491) (-1260.219) * (-1256.209) (-1254.434) (-1251.277) [-1252.912] -- 0:01:03
31000 -- (-1258.121) (-1251.021) (-1255.646) [-1253.933] * (-1250.553) (-1250.796) (-1254.156) [-1253.389] -- 0:01:02
31500 -- [-1253.107] (-1255.385) (-1266.951) (-1266.454) * (-1251.592) (-1251.233) [-1253.155] (-1252.833) -- 0:01:01
32000 -- (-1255.013) (-1254.522) (-1254.438) [-1253.616] * (-1252.031) [-1249.983] (-1253.489) (-1256.885) -- 0:01:00
32500 -- (-1259.482) (-1252.543) [-1255.115] (-1254.144) * (-1251.583) (-1252.085) [-1251.361] (-1257.222) -- 0:00:59
33000 -- (-1261.821) (-1252.765) [-1253.900] (-1256.169) * (-1251.428) (-1250.944) (-1254.627) [-1253.077] -- 0:00:58
33500 -- (-1253.733) (-1253.910) (-1257.438) [-1254.573] * (-1252.045) (-1255.682) [-1251.491] (-1251.660) -- 0:00:57
34000 -- (-1263.006) [-1253.595] (-1255.241) (-1257.488) * (-1251.302) (-1255.942) [-1251.574] (-1252.287) -- 0:00:56
34500 -- [-1259.076] (-1252.190) (-1257.288) (-1252.060) * (-1251.928) (-1254.613) [-1252.059] (-1256.195) -- 0:00:55
35000 -- [-1261.632] (-1256.252) (-1258.028) (-1267.754) * (-1252.294) (-1252.682) [-1249.424] (-1255.118) -- 0:00:55
Average standard deviation of split frequencies: 0.043649
35500 -- (-1255.410) (-1253.559) [-1255.358] (-1255.035) * (-1253.854) (-1255.072) [-1249.854] (-1251.834) -- 0:01:21
36000 -- [-1254.202] (-1256.503) (-1258.694) (-1253.998) * (-1252.050) (-1251.242) [-1250.602] (-1253.265) -- 0:01:20
36500 -- (-1253.791) (-1257.390) [-1257.504] (-1254.431) * (-1251.805) [-1248.664] (-1250.298) (-1253.263) -- 0:01:19
37000 -- (-1253.166) (-1253.205) (-1257.143) [-1252.896] * (-1250.622) [-1253.740] (-1250.243) (-1253.581) -- 0:01:18
37500 -- (-1252.319) (-1253.337) (-1259.686) [-1254.287] * (-1252.736) (-1251.913) [-1252.006] (-1252.734) -- 0:01:17
38000 -- (-1252.092) [-1253.932] (-1258.000) (-1252.887) * (-1252.516) (-1250.645) [-1252.664] (-1253.882) -- 0:01:15
38500 -- (-1251.589) (-1251.454) (-1265.796) [-1252.991] * (-1254.705) [-1249.941] (-1252.112) (-1254.215) -- 0:01:14
39000 -- (-1253.761) (-1252.751) (-1255.635) [-1253.411] * (-1256.068) [-1251.056] (-1249.560) (-1260.433) -- 0:01:13
39500 -- (-1254.088) (-1251.937) [-1255.957] (-1251.815) * [-1252.193] (-1251.314) (-1251.080) (-1258.165) -- 0:01:12
40000 -- (-1251.750) (-1250.552) (-1263.401) [-1254.327] * (-1251.659) [-1250.211] (-1253.258) (-1253.536) -- 0:01:12
Average standard deviation of split frequencies: 0.035880
40500 -- [-1252.271] (-1250.215) (-1269.139) (-1253.585) * (-1251.386) (-1250.876) [-1252.357] (-1253.856) -- 0:01:11
41000 -- [-1250.068] (-1249.784) (-1255.913) (-1251.948) * (-1252.153) [-1255.606] (-1252.006) (-1255.059) -- 0:01:10
41500 -- (-1249.990) (-1252.506) [-1263.086] (-1252.516) * (-1251.380) (-1256.333) [-1253.462] (-1255.532) -- 0:01:09
42000 -- [-1252.562] (-1253.529) (-1260.168) (-1250.751) * (-1250.470) (-1253.860) (-1252.739) [-1250.978] -- 0:01:08
42500 -- [-1251.950] (-1253.819) (-1255.169) (-1254.073) * (-1252.067) (-1251.146) (-1251.348) [-1252.765] -- 0:01:07
43000 -- (-1251.621) (-1252.598) (-1256.634) [-1249.693] * (-1254.526) (-1253.004) [-1250.838] (-1251.419) -- 0:01:06
43500 -- (-1253.169) (-1251.203) (-1252.827) [-1252.064] * (-1255.158) [-1249.679] (-1254.312) (-1252.458) -- 0:01:05
44000 -- (-1252.949) (-1252.232) (-1255.320) [-1252.894] * (-1255.356) [-1252.739] (-1251.303) (-1258.392) -- 0:01:05
44500 -- (-1251.129) (-1251.961) [-1252.393] (-1251.326) * (-1258.815) [-1250.993] (-1250.353) (-1252.169) -- 0:01:04
45000 -- (-1252.305) (-1250.912) (-1253.692) [-1255.725] * [-1252.853] (-1253.258) (-1252.257) (-1253.466) -- 0:01:03
Average standard deviation of split frequencies: 0.031232
45500 -- (-1250.686) (-1252.853) [-1257.196] (-1253.318) * [-1251.509] (-1253.457) (-1249.428) (-1255.554) -- 0:01:02
46000 -- (-1252.144) (-1256.046) [-1258.425] (-1250.446) * [-1254.836] (-1252.241) (-1254.239) (-1252.124) -- 0:01:02
46500 -- (-1250.643) (-1251.700) [-1251.710] (-1252.871) * [-1251.706] (-1251.958) (-1252.457) (-1253.496) -- 0:01:01
47000 -- (-1251.426) (-1250.620) [-1257.740] (-1253.000) * (-1254.405) (-1254.013) (-1253.608) [-1252.784] -- 0:01:00
47500 -- (-1251.621) (-1251.086) (-1256.160) [-1251.252] * [-1252.725] (-1258.554) (-1253.057) (-1252.708) -- 0:01:00
48000 -- (-1254.793) (-1249.262) [-1266.903] (-1251.924) * [-1253.118] (-1254.197) (-1252.408) (-1253.129) -- 0:00:59
48500 -- (-1255.156) (-1252.709) [-1258.542] (-1252.406) * [-1253.468] (-1252.025) (-1250.579) (-1252.629) -- 0:00:58
49000 -- (-1250.232) (-1252.140) [-1255.661] (-1251.861) * (-1253.892) (-1250.937) [-1252.040] (-1252.367) -- 0:00:58
49500 -- (-1250.501) (-1257.619) (-1255.724) [-1250.749] * (-1251.441) (-1249.803) [-1250.825] (-1251.244) -- 0:00:57
50000 -- (-1249.164) (-1253.111) [-1255.181] (-1250.063) * (-1253.935) (-1248.865) (-1253.042) [-1249.956] -- 0:00:57
Average standard deviation of split frequencies: 0.034558
50500 -- (-1250.263) (-1252.202) (-1257.300) [-1254.490] * (-1254.234) [-1254.077] (-1250.919) (-1252.720) -- 0:01:15
51000 -- (-1252.071) (-1257.031) (-1261.029) [-1254.970] * [-1251.840] (-1251.945) (-1252.087) (-1254.418) -- 0:01:14
51500 -- (-1255.132) (-1252.807) [-1256.431] (-1252.084) * (-1254.052) (-1254.533) (-1250.919) [-1253.707] -- 0:01:13
52000 -- (-1251.698) (-1252.660) [-1253.616] (-1255.011) * (-1252.150) (-1249.897) (-1252.353) [-1254.184] -- 0:01:12
52500 -- (-1252.854) (-1254.349) [-1251.243] (-1254.497) * (-1251.703) [-1254.733] (-1253.706) (-1252.787) -- 0:01:12
53000 -- (-1250.240) (-1252.081) [-1248.992] (-1255.666) * (-1253.682) (-1251.540) [-1253.405] (-1255.591) -- 0:01:11
53500 -- [-1248.935] (-1253.131) (-1251.905) (-1251.845) * (-1252.391) (-1250.812) [-1251.682] (-1253.361) -- 0:01:10
54000 -- [-1253.299] (-1252.517) (-1251.503) (-1250.441) * (-1254.087) (-1253.027) [-1253.094] (-1253.471) -- 0:01:10
54500 -- (-1255.205) [-1251.779] (-1255.335) (-1253.140) * [-1253.289] (-1253.662) (-1254.328) (-1250.429) -- 0:01:09
55000 -- (-1253.266) [-1253.274] (-1250.793) (-1254.115) * (-1253.604) [-1251.058] (-1251.741) (-1255.963) -- 0:01:08
Average standard deviation of split frequencies: 0.036478
55500 -- (-1253.527) (-1253.810) (-1250.016) [-1253.007] * (-1256.764) (-1251.947) [-1253.040] (-1254.846) -- 0:01:08
56000 -- (-1251.402) (-1255.657) [-1255.015] (-1253.253) * [-1251.839] (-1253.938) (-1252.918) (-1252.115) -- 0:01:07
56500 -- [-1252.048] (-1254.936) (-1250.120) (-1251.516) * (-1252.980) (-1253.055) [-1256.697] (-1253.653) -- 0:01:06
57000 -- (-1250.621) (-1256.339) (-1250.999) [-1251.454] * (-1252.589) (-1253.449) [-1251.317] (-1256.601) -- 0:01:06
57500 -- (-1250.411) (-1253.529) (-1251.099) [-1251.573] * [-1251.848] (-1254.659) (-1259.606) (-1254.170) -- 0:01:05
58000 -- (-1251.606) [-1252.153] (-1251.425) (-1253.939) * (-1254.168) (-1252.562) (-1254.008) [-1252.478] -- 0:01:04
58500 -- (-1251.815) [-1253.534] (-1251.115) (-1251.956) * (-1254.157) [-1253.496] (-1255.711) (-1254.530) -- 0:01:04
59000 -- (-1254.988) (-1251.387) (-1251.679) [-1249.755] * (-1253.274) (-1250.021) [-1251.916] (-1254.353) -- 0:01:03
59500 -- [-1254.555] (-1252.046) (-1251.103) (-1251.187) * (-1254.872) (-1253.772) (-1251.553) [-1253.461] -- 0:01:03
60000 -- (-1255.723) (-1254.092) (-1250.960) [-1252.210] * (-1257.559) (-1251.755) [-1251.914] (-1251.760) -- 0:01:02
Average standard deviation of split frequencies: 0.039241
60500 -- (-1252.531) (-1249.988) (-1250.347) [-1253.775] * (-1252.275) (-1251.845) [-1252.009] (-1252.982) -- 0:01:02
61000 -- (-1257.024) [-1254.338] (-1252.659) (-1253.028) * (-1254.744) (-1252.147) [-1252.149] (-1251.944) -- 0:01:01
61500 -- (-1250.800) (-1251.873) (-1251.538) [-1252.869] * (-1252.922) (-1254.761) (-1254.090) [-1251.652] -- 0:01:01
62000 -- (-1251.120) (-1252.364) [-1249.519] (-1253.685) * (-1254.804) [-1253.268] (-1253.310) (-1252.809) -- 0:01:00
62500 -- (-1253.050) [-1251.089] (-1251.771) (-1254.075) * (-1253.888) (-1251.734) [-1253.816] (-1252.842) -- 0:01:00
63000 -- (-1252.471) (-1253.430) (-1251.756) [-1253.866] * (-1251.866) (-1250.934) (-1256.613) [-1251.202] -- 0:00:59
63500 -- (-1249.956) (-1251.931) (-1252.758) [-1251.226] * (-1254.644) (-1252.811) (-1253.077) [-1250.305] -- 0:00:58
64000 -- (-1250.221) [-1252.176] (-1252.167) (-1253.385) * (-1253.346) (-1252.086) (-1252.367) [-1258.211] -- 0:00:58
64500 -- (-1249.839) [-1254.303] (-1251.732) (-1254.532) * (-1251.456) (-1255.351) [-1253.465] (-1252.790) -- 0:00:58
65000 -- (-1252.648) [-1252.182] (-1251.719) (-1252.085) * (-1254.595) (-1255.863) (-1252.118) [-1252.164] -- 0:00:57
Average standard deviation of split frequencies: 0.037336
65500 -- (-1251.212) (-1254.167) (-1253.223) [-1254.007] * (-1252.490) (-1256.593) (-1253.455) [-1250.194] -- 0:01:11
66000 -- [-1252.391] (-1251.479) (-1256.136) (-1252.750) * (-1253.923) [-1252.583] (-1255.225) (-1253.209) -- 0:01:10
66500 -- (-1253.031) [-1252.704] (-1252.049) (-1252.225) * (-1255.108) (-1251.464) (-1253.360) [-1250.720] -- 0:01:10
67000 -- (-1251.367) [-1253.955] (-1252.043) (-1251.583) * (-1255.104) (-1252.115) [-1253.726] (-1251.064) -- 0:01:09
67500 -- (-1253.183) (-1258.061) (-1252.766) [-1250.613] * (-1253.999) [-1259.467] (-1253.906) (-1253.262) -- 0:01:09
68000 -- (-1252.148) [-1253.475] (-1252.010) (-1251.634) * (-1253.642) (-1250.751) [-1253.435] (-1254.154) -- 0:01:08
68500 -- (-1251.854) (-1252.475) [-1250.173] (-1253.185) * [-1253.636] (-1251.240) (-1257.442) (-1252.177) -- 0:01:07
69000 -- (-1253.219) (-1252.633) (-1251.622) [-1254.962] * [-1254.246] (-1251.874) (-1255.002) (-1250.039) -- 0:01:07
69500 -- (-1253.811) (-1252.609) [-1254.082] (-1250.388) * [-1252.159] (-1251.597) (-1258.460) (-1251.546) -- 0:01:06
70000 -- (-1251.835) (-1254.343) (-1251.530) [-1252.504] * [-1256.557] (-1255.727) (-1256.578) (-1253.021) -- 0:01:06
Average standard deviation of split frequencies: 0.038119
70500 -- (-1252.538) (-1257.568) [-1251.612] (-1253.982) * (-1250.646) (-1252.166) [-1251.524] (-1255.193) -- 0:01:05
71000 -- (-1251.380) (-1252.953) (-1249.634) [-1250.357] * [-1251.180] (-1256.666) (-1252.021) (-1251.623) -- 0:01:05
71500 -- (-1251.973) (-1253.601) (-1251.756) [-1251.509] * (-1252.651) [-1250.970] (-1253.345) (-1252.653) -- 0:01:04
72000 -- (-1251.122) (-1255.217) (-1250.304) [-1251.447] * (-1255.602) [-1253.538] (-1254.441) (-1252.955) -- 0:01:04
72500 -- (-1249.336) [-1250.251] (-1252.023) (-1252.528) * (-1252.329) [-1251.043] (-1259.585) (-1252.499) -- 0:01:03
73000 -- [-1250.766] (-1250.995) (-1252.482) (-1251.218) * (-1251.743) [-1251.256] (-1258.545) (-1251.906) -- 0:01:03
73500 -- [-1249.546] (-1250.158) (-1258.590) (-1251.661) * (-1253.636) (-1252.083) [-1255.735] (-1251.931) -- 0:01:03
74000 -- [-1257.107] (-1253.273) (-1254.967) (-1252.181) * (-1250.855) (-1254.941) [-1254.963] (-1255.159) -- 0:01:02
74500 -- (-1253.007) (-1252.347) (-1253.390) [-1252.081] * (-1253.450) (-1252.741) (-1255.901) [-1251.612] -- 0:01:02
75000 -- (-1254.995) (-1251.449) (-1251.867) [-1251.215] * (-1251.831) (-1252.127) (-1257.034) [-1249.862] -- 0:01:01
Average standard deviation of split frequencies: 0.041056
75500 -- (-1259.672) (-1253.787) (-1252.506) [-1252.026] * [-1251.980] (-1254.186) (-1253.846) (-1254.942) -- 0:01:01
76000 -- (-1256.763) (-1253.196) [-1250.837] (-1251.442) * (-1251.215) (-1251.821) (-1253.491) [-1252.414] -- 0:01:00
76500 -- (-1253.123) (-1251.286) [-1251.251] (-1253.578) * (-1252.348) [-1253.278] (-1251.841) (-1252.545) -- 0:01:00
77000 -- [-1252.181] (-1254.246) (-1250.826) (-1253.405) * (-1254.829) (-1255.514) [-1254.454] (-1252.474) -- 0:00:59
77500 -- (-1252.228) [-1251.343] (-1251.708) (-1254.984) * (-1253.470) (-1252.351) [-1254.253] (-1252.966) -- 0:00:59
78000 -- (-1253.248) (-1251.975) (-1251.028) [-1254.212] * [-1254.141] (-1252.969) (-1253.491) (-1251.579) -- 0:00:59
78500 -- [-1249.686] (-1250.861) (-1252.901) (-1253.514) * [-1253.223] (-1254.073) (-1254.723) (-1252.695) -- 0:00:58
79000 -- (-1250.426) [-1252.765] (-1253.059) (-1251.404) * (-1251.453) (-1253.775) (-1252.527) [-1251.523] -- 0:00:58
79500 -- (-1250.455) (-1253.076) [-1253.665] (-1250.187) * (-1253.617) [-1253.292] (-1253.508) (-1252.399) -- 0:00:57
80000 -- (-1252.413) (-1252.703) (-1253.905) [-1250.040] * (-1251.998) (-1253.080) [-1251.996] (-1254.017) -- 0:00:57
Average standard deviation of split frequencies: 0.038681
80500 -- (-1254.231) (-1252.464) [-1253.995] (-1250.495) * (-1253.033) (-1258.075) [-1251.873] (-1251.566) -- 0:01:08
81000 -- (-1254.073) (-1252.474) (-1253.073) [-1254.581] * (-1255.068) (-1250.597) (-1251.862) [-1252.184] -- 0:01:08
81500 -- [-1251.739] (-1251.272) (-1252.381) (-1261.964) * [-1252.765] (-1254.463) (-1254.568) (-1252.088) -- 0:01:07
82000 -- (-1249.654) (-1252.819) (-1251.373) [-1253.022] * (-1249.611) [-1250.173] (-1256.396) (-1253.061) -- 0:01:07
82500 -- [-1252.399] (-1255.379) (-1251.059) (-1252.116) * (-1252.228) (-1252.391) (-1253.368) [-1255.609] -- 0:01:06
83000 -- (-1253.502) (-1252.031) (-1253.292) [-1255.870] * (-1252.407) (-1253.188) (-1252.464) [-1253.050] -- 0:01:06
83500 -- (-1252.294) [-1252.726] (-1251.764) (-1257.746) * [-1251.548] (-1256.707) (-1253.651) (-1250.114) -- 0:01:05
84000 -- [-1249.515] (-1254.132) (-1254.484) (-1251.999) * (-1253.346) (-1253.935) [-1253.687] (-1251.579) -- 0:01:05
84500 -- (-1252.504) (-1251.956) (-1251.846) [-1251.708] * (-1251.080) (-1258.092) (-1254.786) [-1250.322] -- 0:01:05
85000 -- [-1250.517] (-1255.006) (-1251.142) (-1253.039) * [-1251.592] (-1256.493) (-1258.743) (-1253.012) -- 0:01:04
Average standard deviation of split frequencies: 0.036626
85500 -- (-1251.205) [-1255.893] (-1258.586) (-1259.117) * (-1254.850) (-1253.473) (-1250.996) [-1250.507] -- 0:01:04
86000 -- [-1251.118] (-1254.459) (-1251.312) (-1260.581) * (-1256.614) [-1252.118] (-1255.042) (-1250.299) -- 0:01:03
86500 -- [-1250.149] (-1254.010) (-1251.555) (-1253.793) * [-1254.435] (-1252.745) (-1253.301) (-1256.019) -- 0:01:03
87000 -- (-1254.750) (-1251.529) [-1252.747] (-1253.079) * (-1251.697) [-1255.416] (-1253.645) (-1253.614) -- 0:01:02
87500 -- [-1254.544] (-1252.450) (-1252.138) (-1251.994) * (-1252.668) (-1257.802) [-1251.419] (-1253.062) -- 0:01:02
88000 -- [-1251.235] (-1252.776) (-1252.326) (-1252.210) * (-1250.646) [-1250.939] (-1252.132) (-1252.186) -- 0:01:02
88500 -- (-1249.774) [-1253.351] (-1254.203) (-1252.283) * (-1251.695) (-1254.931) [-1252.383] (-1251.445) -- 0:01:01
89000 -- [-1251.765] (-1251.901) (-1254.088) (-1252.699) * (-1251.852) (-1260.646) (-1251.035) [-1249.686] -- 0:01:01
89500 -- [-1252.121] (-1252.053) (-1252.252) (-1252.242) * [-1254.111] (-1254.615) (-1252.853) (-1251.056) -- 0:01:01
90000 -- (-1251.486) (-1252.523) (-1250.889) [-1255.199] * [-1254.833] (-1255.302) (-1252.020) (-1253.943) -- 0:01:00
Average standard deviation of split frequencies: 0.034268
90500 -- [-1250.737] (-1252.194) (-1251.208) (-1252.789) * (-1254.805) (-1252.690) (-1252.332) [-1252.216] -- 0:01:00
91000 -- (-1251.191) (-1251.510) (-1250.204) [-1252.836] * (-1256.245) (-1254.838) [-1251.312] (-1251.251) -- 0:00:59
91500 -- [-1253.227] (-1252.187) (-1254.281) (-1256.289) * (-1254.078) (-1253.360) (-1253.055) [-1250.895] -- 0:00:59
92000 -- (-1253.380) (-1251.046) (-1252.856) [-1255.078] * (-1258.016) [-1252.158] (-1254.929) (-1254.687) -- 0:00:59
92500 -- (-1255.846) [-1252.189] (-1254.172) (-1251.792) * (-1256.927) (-1258.114) (-1252.734) [-1252.029] -- 0:00:58
93000 -- (-1256.686) [-1251.855] (-1251.340) (-1252.977) * (-1251.131) (-1254.938) (-1252.329) [-1252.897] -- 0:00:58
93500 -- (-1253.660) [-1254.405] (-1249.693) (-1253.827) * [-1251.553] (-1253.087) (-1252.452) (-1251.832) -- 0:00:58
94000 -- (-1253.288) (-1255.176) [-1250.774] (-1253.125) * [-1251.663] (-1253.963) (-1251.000) (-1252.882) -- 0:00:57
94500 -- (-1252.150) (-1254.038) [-1251.174] (-1252.629) * (-1252.332) (-1252.199) (-1251.740) [-1250.683] -- 0:00:57
95000 -- (-1253.418) (-1253.999) [-1249.474] (-1252.776) * (-1255.453) (-1254.073) (-1250.925) [-1253.108] -- 0:00:57
Average standard deviation of split frequencies: 0.036828
95500 -- (-1252.346) [-1253.708] (-1252.045) (-1254.041) * (-1255.208) (-1253.238) [-1251.212] (-1253.306) -- 0:01:06
96000 -- (-1256.986) (-1253.895) [-1250.976] (-1254.202) * (-1253.930) [-1251.608] (-1260.572) (-1253.198) -- 0:01:05
96500 -- (-1255.013) (-1256.689) [-1249.330] (-1251.990) * (-1252.619) [-1251.919] (-1256.513) (-1254.444) -- 0:01:05
97000 -- [-1252.722] (-1256.150) (-1253.976) (-1251.504) * (-1252.772) [-1253.037] (-1252.722) (-1254.927) -- 0:01:05
97500 -- (-1251.634) (-1256.143) [-1250.527] (-1252.052) * (-1253.981) (-1251.447) [-1254.420] (-1252.212) -- 0:01:04
98000 -- (-1252.977) (-1251.933) [-1249.601] (-1255.540) * (-1251.753) (-1256.169) [-1256.542] (-1253.838) -- 0:01:04
98500 -- (-1254.458) (-1257.355) (-1249.136) [-1251.580] * [-1252.704] (-1255.838) (-1251.868) (-1253.071) -- 0:01:04
99000 -- [-1255.735] (-1255.425) (-1251.258) (-1253.764) * (-1251.382) (-1251.326) (-1251.974) [-1250.926] -- 0:01:03
99500 -- (-1252.552) (-1253.170) (-1249.369) [-1255.373] * [-1252.621] (-1251.919) (-1253.193) (-1251.230) -- 0:01:03
100000 -- (-1255.719) [-1252.408] (-1250.159) (-1253.679) * (-1252.562) [-1254.363] (-1252.702) (-1254.737) -- 0:01:02
Average standard deviation of split frequencies: 0.033672
100500 -- (-1251.742) [-1251.622] (-1248.704) (-1251.299) * (-1255.328) [-1252.341] (-1254.576) (-1252.890) -- 0:01:02
101000 -- (-1255.217) (-1253.994) [-1250.873] (-1252.398) * (-1251.896) (-1253.359) (-1252.232) [-1252.104] -- 0:01:02
101500 -- (-1254.653) (-1253.376) [-1252.265] (-1251.094) * (-1251.716) [-1253.990] (-1250.055) (-1251.260) -- 0:01:01
102000 -- (-1251.192) [-1251.194] (-1251.701) (-1252.014) * (-1254.060) (-1252.961) (-1257.828) [-1252.026] -- 0:01:01
102500 -- (-1250.990) (-1255.560) [-1249.420] (-1254.025) * [-1250.360] (-1255.562) (-1255.689) (-1254.536) -- 0:01:01
103000 -- (-1250.989) (-1251.711) [-1253.868] (-1251.218) * (-1251.114) [-1251.788] (-1253.903) (-1252.484) -- 0:01:00
103500 -- [-1251.380] (-1251.681) (-1256.282) (-1251.937) * (-1250.914) (-1252.215) (-1254.509) [-1251.417] -- 0:01:00
104000 -- (-1252.738) (-1253.844) [-1252.947] (-1251.707) * (-1255.348) (-1251.896) [-1253.484] (-1254.957) -- 0:01:00
104500 -- [-1255.154] (-1253.504) (-1251.281) (-1251.617) * [-1252.060] (-1252.382) (-1253.444) (-1256.363) -- 0:00:59
105000 -- (-1255.178) (-1253.148) [-1251.519] (-1251.989) * [-1251.599] (-1251.301) (-1251.847) (-1251.131) -- 0:00:59
Average standard deviation of split frequencies: 0.032401
105500 -- (-1251.330) (-1254.945) (-1251.293) [-1252.034] * (-1252.896) (-1251.192) [-1251.324] (-1255.877) -- 0:00:59
106000 -- (-1251.318) (-1255.987) [-1252.041] (-1254.034) * (-1252.201) (-1252.438) [-1254.945] (-1254.474) -- 0:00:59
106500 -- (-1252.208) (-1254.495) (-1252.324) [-1253.794] * (-1252.728) (-1252.436) (-1254.595) [-1251.452] -- 0:00:58
107000 -- (-1252.552) (-1253.836) [-1251.707] (-1254.951) * [-1251.879] (-1251.759) (-1252.682) (-1252.266) -- 0:00:58
107500 -- (-1252.679) (-1252.953) [-1251.816] (-1261.562) * (-1250.052) [-1251.599] (-1252.386) (-1254.404) -- 0:00:58
108000 -- (-1255.989) (-1251.862) [-1251.213] (-1255.504) * (-1254.093) [-1252.847] (-1258.341) (-1253.418) -- 0:00:57
108500 -- [-1253.152] (-1250.387) (-1252.253) (-1253.283) * (-1253.527) (-1254.668) (-1257.128) [-1251.431] -- 0:00:57
109000 -- (-1253.453) (-1251.708) [-1251.404] (-1253.118) * (-1252.940) (-1256.234) (-1253.789) [-1251.562] -- 0:00:57
109500 -- (-1250.854) (-1253.656) [-1255.108] (-1252.699) * [-1253.130] (-1251.799) (-1252.494) (-1251.367) -- 0:00:56
110000 -- (-1252.950) (-1251.075) (-1251.804) [-1251.794] * (-1254.470) (-1254.175) (-1257.892) [-1251.818] -- 0:01:04
Average standard deviation of split frequencies: 0.033672
110500 -- (-1254.141) (-1251.313) [-1250.592] (-1253.287) * (-1253.483) (-1251.920) [-1254.158] (-1251.963) -- 0:01:04
111000 -- [-1252.998] (-1250.893) (-1250.150) (-1252.352) * (-1254.270) (-1253.128) [-1251.779] (-1251.255) -- 0:01:04
111500 -- (-1253.708) (-1251.735) [-1250.756] (-1253.079) * (-1254.263) [-1253.235] (-1252.291) (-1254.075) -- 0:01:03
112000 -- (-1257.071) (-1254.647) (-1250.158) [-1252.013] * (-1252.719) (-1253.602) (-1251.135) [-1250.957] -- 0:01:03
112500 -- (-1257.162) [-1251.194] (-1252.975) (-1253.623) * [-1252.504] (-1251.653) (-1251.546) (-1254.350) -- 0:01:03
113000 -- (-1254.276) [-1250.455] (-1251.498) (-1252.849) * (-1252.166) (-1251.840) (-1253.875) [-1253.181] -- 0:01:02
113500 -- [-1252.144] (-1248.833) (-1250.170) (-1251.418) * (-1250.770) [-1252.598] (-1251.906) (-1252.197) -- 0:01:02
114000 -- (-1253.093) (-1249.821) [-1250.004] (-1252.717) * (-1252.072) [-1253.470] (-1252.747) (-1257.305) -- 0:01:02
114500 -- (-1255.089) (-1251.881) [-1250.249] (-1254.855) * (-1255.284) (-1254.027) [-1251.655] (-1254.553) -- 0:01:01
115000 -- (-1256.353) [-1250.834] (-1255.378) (-1253.584) * (-1254.432) (-1255.249) [-1250.230] (-1250.601) -- 0:01:01
Average standard deviation of split frequencies: 0.030575
115500 -- (-1253.833) (-1253.270) [-1251.316] (-1254.994) * (-1251.242) [-1250.562] (-1252.585) (-1255.352) -- 0:01:01
116000 -- (-1252.222) (-1253.113) (-1252.995) [-1252.149] * (-1252.797) [-1253.747] (-1250.689) (-1251.710) -- 0:01:00
116500 -- [-1252.318] (-1251.984) (-1251.088) (-1253.753) * [-1255.335] (-1250.403) (-1252.694) (-1253.080) -- 0:01:00
117000 -- (-1250.459) (-1252.314) [-1250.664] (-1252.071) * (-1253.831) (-1251.322) (-1255.326) [-1252.452] -- 0:01:00
117500 -- (-1259.888) (-1252.872) [-1252.485] (-1254.950) * [-1251.931] (-1253.381) (-1251.775) (-1251.884) -- 0:01:00
118000 -- (-1261.384) (-1254.035) [-1253.903] (-1249.470) * (-1250.825) [-1253.630] (-1251.802) (-1253.633) -- 0:00:59
118500 -- (-1250.777) (-1255.657) [-1251.913] (-1250.637) * [-1250.742] (-1252.227) (-1252.018) (-1251.422) -- 0:00:59
119000 -- (-1252.337) (-1252.232) [-1251.939] (-1252.056) * (-1248.261) (-1253.212) [-1251.982] (-1254.394) -- 0:00:59
119500 -- (-1250.858) (-1257.629) [-1250.798] (-1251.726) * [-1251.836] (-1253.400) (-1253.495) (-1253.493) -- 0:00:58
120000 -- [-1251.365] (-1253.955) (-1252.715) (-1251.467) * (-1249.717) (-1253.526) [-1253.969] (-1251.211) -- 0:00:58
Average standard deviation of split frequencies: 0.030509
120500 -- [-1251.024] (-1252.743) (-1257.110) (-1250.583) * [-1251.998] (-1255.677) (-1255.474) (-1250.119) -- 0:00:58
121000 -- (-1254.404) (-1252.899) (-1252.735) [-1251.327] * (-1252.152) (-1253.161) [-1251.440] (-1250.919) -- 0:00:58
121500 -- (-1253.282) (-1255.490) [-1250.875] (-1252.523) * (-1253.644) (-1252.930) [-1255.784] (-1252.289) -- 0:00:57
122000 -- (-1254.944) (-1251.438) [-1252.755] (-1252.454) * (-1253.111) [-1252.343] (-1253.920) (-1254.893) -- 0:00:57
122500 -- (-1252.299) (-1253.226) (-1252.162) [-1252.660] * (-1250.993) (-1254.886) (-1252.803) [-1252.081] -- 0:00:57
123000 -- (-1252.639) [-1250.919] (-1250.979) (-1255.919) * (-1252.213) (-1252.768) (-1251.498) [-1249.718] -- 0:00:57
123500 -- (-1253.722) (-1254.395) [-1252.826] (-1252.170) * (-1252.562) (-1254.290) [-1252.908] (-1250.041) -- 0:00:56
124000 -- (-1253.657) (-1251.276) (-1252.388) [-1250.637] * (-1253.132) (-1253.057) (-1252.839) [-1251.056] -- 0:00:56
124500 -- (-1254.162) [-1251.090] (-1251.811) (-1249.928) * [-1253.539] (-1251.229) (-1251.149) (-1255.105) -- 0:00:56
125000 -- (-1253.302) (-1256.298) (-1251.950) [-1250.007] * (-1252.083) (-1251.666) [-1255.389] (-1251.448) -- 0:01:03
Average standard deviation of split frequencies: 0.028505
125500 -- (-1252.309) (-1254.881) [-1251.350] (-1250.731) * (-1253.000) (-1254.629) [-1252.893] (-1250.561) -- 0:01:02
126000 -- (-1255.021) (-1256.382) (-1253.271) [-1252.463] * (-1253.499) (-1253.167) [-1252.221] (-1257.771) -- 0:01:02
126500 -- [-1255.762] (-1251.649) (-1255.379) (-1249.786) * (-1252.515) [-1252.695] (-1251.891) (-1255.328) -- 0:01:02
127000 -- [-1253.406] (-1253.531) (-1255.327) (-1250.389) * (-1249.974) [-1252.079] (-1252.392) (-1251.742) -- 0:01:01
127500 -- (-1252.675) (-1252.651) (-1254.470) [-1250.591] * [-1252.253] (-1257.499) (-1255.022) (-1251.141) -- 0:01:01
128000 -- (-1251.792) (-1258.637) (-1252.422) [-1256.885] * (-1251.652) [-1254.851] (-1251.804) (-1253.387) -- 0:01:01
128500 -- [-1252.148] (-1255.181) (-1252.675) (-1252.759) * (-1251.435) (-1253.804) [-1252.575] (-1253.894) -- 0:01:01
129000 -- (-1252.387) (-1254.727) [-1256.075] (-1258.651) * (-1255.090) (-1252.595) (-1252.592) [-1253.206] -- 0:01:00
129500 -- [-1252.911] (-1255.360) (-1254.638) (-1256.463) * (-1251.893) (-1251.826) [-1250.718] (-1253.053) -- 0:01:00
130000 -- (-1254.655) (-1254.662) [-1254.120] (-1250.515) * (-1251.815) (-1253.106) [-1251.845] (-1254.916) -- 0:01:00
Average standard deviation of split frequencies: 0.027599
130500 -- (-1253.595) (-1253.169) [-1254.433] (-1251.587) * (-1253.472) (-1252.299) [-1253.279] (-1253.631) -- 0:00:59
131000 -- (-1252.697) (-1253.767) (-1251.310) [-1253.805] * [-1250.631] (-1251.352) (-1253.355) (-1252.957) -- 0:00:59
131500 -- (-1255.406) [-1251.444] (-1256.151) (-1249.807) * (-1254.341) (-1250.540) [-1252.945] (-1253.526) -- 0:00:59
132000 -- (-1252.324) (-1251.585) (-1250.269) [-1250.958] * (-1254.264) [-1251.222] (-1255.538) (-1254.710) -- 0:00:59
132500 -- (-1255.375) (-1252.227) [-1251.624] (-1253.904) * (-1252.858) (-1252.189) [-1251.917] (-1253.908) -- 0:00:58
133000 -- (-1254.894) [-1256.907] (-1252.022) (-1251.873) * (-1250.635) (-1255.262) (-1259.631) [-1252.911] -- 0:00:58
133500 -- (-1257.001) [-1253.261] (-1254.440) (-1255.870) * [-1253.002] (-1251.828) (-1260.813) (-1253.787) -- 0:00:58
134000 -- (-1254.815) (-1254.578) [-1251.461] (-1253.412) * (-1250.968) (-1254.530) (-1254.126) [-1254.989] -- 0:00:58
134500 -- (-1253.468) (-1252.659) [-1252.174] (-1250.299) * (-1248.969) (-1250.400) [-1256.555] (-1257.075) -- 0:00:57
135000 -- [-1254.256] (-1252.999) (-1253.099) (-1252.399) * (-1253.999) (-1251.948) [-1250.326] (-1253.097) -- 0:00:57
Average standard deviation of split frequencies: 0.024610
135500 -- (-1256.560) (-1253.679) [-1250.790] (-1254.219) * (-1251.089) (-1252.551) (-1253.083) [-1252.629] -- 0:00:57
136000 -- (-1253.903) (-1252.009) (-1252.676) [-1253.911] * [-1254.853] (-1252.242) (-1251.690) (-1254.826) -- 0:00:57
136500 -- (-1252.544) (-1252.534) (-1253.493) [-1252.445] * [-1254.550] (-1252.853) (-1253.962) (-1257.136) -- 0:00:56
137000 -- (-1252.355) [-1256.408] (-1253.988) (-1253.155) * (-1254.051) [-1252.062] (-1253.486) (-1253.424) -- 0:00:56
137500 -- [-1255.043] (-1254.103) (-1254.350) (-1252.678) * (-1251.710) (-1252.233) (-1254.679) [-1253.809] -- 0:00:56
138000 -- (-1253.385) (-1252.552) [-1252.227] (-1252.935) * [-1250.252] (-1253.281) (-1253.685) (-1253.079) -- 0:00:56
138500 -- (-1255.508) (-1251.786) (-1254.579) [-1251.848] * (-1250.828) (-1254.975) (-1252.857) [-1255.149] -- 0:00:55
139000 -- (-1255.840) [-1252.545] (-1250.728) (-1250.922) * (-1252.357) [-1253.355] (-1250.609) (-1253.537) -- 0:00:55
139500 -- (-1255.464) [-1257.262] (-1253.446) (-1251.646) * (-1251.945) (-1253.440) (-1253.705) [-1255.623] -- 0:00:55
140000 -- (-1254.090) (-1254.787) (-1254.997) [-1251.626] * [-1252.945] (-1250.443) (-1251.196) (-1252.492) -- 0:01:01
Average standard deviation of split frequencies: 0.024576
140500 -- (-1252.074) (-1252.291) (-1254.298) [-1252.762] * (-1252.084) [-1250.806] (-1253.170) (-1253.728) -- 0:01:01
141000 -- [-1253.494] (-1251.990) (-1252.495) (-1252.534) * (-1251.165) (-1250.753) [-1253.007] (-1253.559) -- 0:01:00
141500 -- (-1252.411) (-1254.169) (-1252.977) [-1252.695] * (-1252.789) (-1253.029) (-1251.095) [-1251.372] -- 0:01:00
142000 -- (-1251.901) (-1251.090) [-1250.922] (-1252.258) * [-1254.696] (-1253.354) (-1253.153) (-1252.525) -- 0:01:00
142500 -- (-1253.248) [-1251.447] (-1252.959) (-1252.089) * [-1252.490] (-1252.355) (-1256.038) (-1255.537) -- 0:01:00
143000 -- [-1253.657] (-1249.543) (-1253.515) (-1253.606) * [-1253.058] (-1252.634) (-1252.235) (-1256.778) -- 0:00:59
143500 -- [-1253.179] (-1250.252) (-1255.828) (-1250.047) * (-1253.865) [-1255.568] (-1251.374) (-1254.450) -- 0:00:59
144000 -- (-1253.867) [-1251.589] (-1253.261) (-1252.822) * (-1253.824) (-1253.326) (-1252.373) [-1253.485] -- 0:00:59
144500 -- [-1250.553] (-1252.624) (-1251.485) (-1252.681) * (-1255.786) [-1250.868] (-1251.101) (-1255.187) -- 0:00:59
145000 -- [-1250.289] (-1251.905) (-1252.063) (-1255.702) * [-1256.711] (-1251.724) (-1253.777) (-1253.782) -- 0:00:58
Average standard deviation of split frequencies: 0.021525
145500 -- (-1254.644) (-1252.482) (-1249.860) [-1251.115] * [-1250.423] (-1253.754) (-1250.514) (-1254.832) -- 0:00:58
146000 -- (-1256.195) [-1252.143] (-1251.081) (-1250.835) * (-1253.449) [-1251.990] (-1255.026) (-1256.008) -- 0:00:58
146500 -- (-1253.791) (-1250.850) (-1254.070) [-1249.876] * (-1257.166) (-1250.751) [-1251.798] (-1258.761) -- 0:00:58
147000 -- (-1252.363) (-1252.294) [-1251.736] (-1253.291) * [-1253.458] (-1255.303) (-1251.014) (-1254.451) -- 0:00:58
147500 -- (-1252.325) [-1254.052] (-1251.807) (-1251.415) * [-1250.722] (-1257.504) (-1251.899) (-1254.934) -- 0:00:57
148000 -- (-1252.568) (-1251.364) (-1259.299) [-1253.632] * (-1251.045) [-1257.404] (-1252.454) (-1255.890) -- 0:00:57
148500 -- (-1256.028) (-1251.953) (-1253.031) [-1252.878] * (-1251.372) [-1253.484] (-1252.989) (-1253.643) -- 0:00:57
149000 -- (-1257.629) [-1254.235] (-1251.447) (-1256.647) * [-1256.958] (-1252.783) (-1254.061) (-1253.882) -- 0:00:57
149500 -- (-1254.006) (-1255.566) [-1249.358] (-1255.075) * [-1258.499] (-1252.787) (-1253.811) (-1252.651) -- 0:00:56
150000 -- (-1253.318) (-1251.214) (-1251.753) [-1252.154] * (-1251.417) (-1250.827) [-1252.325] (-1258.860) -- 0:00:56
Average standard deviation of split frequencies: 0.022396
150500 -- (-1252.787) [-1252.449] (-1254.264) (-1252.134) * [-1254.936] (-1251.616) (-1252.664) (-1253.322) -- 0:00:56
151000 -- [-1251.837] (-1254.865) (-1252.917) (-1257.995) * (-1251.886) (-1251.976) [-1250.914] (-1253.187) -- 0:00:56
151500 -- (-1258.484) [-1251.524] (-1252.934) (-1255.029) * (-1252.816) (-1251.781) [-1251.656] (-1251.679) -- 0:00:56
152000 -- [-1254.090] (-1253.170) (-1253.090) (-1251.805) * (-1255.626) [-1254.964] (-1257.680) (-1253.101) -- 0:00:55
152500 -- (-1253.104) [-1254.115] (-1250.393) (-1251.164) * (-1254.910) (-1252.682) [-1251.303] (-1252.859) -- 0:00:55
153000 -- (-1252.975) [-1254.128] (-1250.611) (-1252.879) * (-1255.651) [-1255.381] (-1252.628) (-1251.567) -- 0:00:55
153500 -- (-1252.661) (-1252.824) (-1251.996) [-1254.680] * (-1258.129) [-1252.614] (-1253.697) (-1252.314) -- 0:01:00
154000 -- (-1253.534) [-1253.267] (-1252.081) (-1252.445) * (-1252.354) [-1253.248] (-1255.213) (-1251.064) -- 0:01:00
154500 -- (-1253.525) (-1250.749) (-1252.468) [-1253.353] * (-1251.652) (-1253.288) [-1252.359] (-1251.676) -- 0:01:00
155000 -- (-1254.975) (-1253.916) [-1249.649] (-1252.718) * (-1250.080) (-1251.723) (-1255.893) [-1253.556] -- 0:00:59
Average standard deviation of split frequencies: 0.021630
155500 -- (-1259.055) (-1254.766) [-1250.268] (-1252.680) * (-1251.388) (-1253.434) (-1251.979) [-1252.187] -- 0:00:59
156000 -- [-1255.942] (-1251.683) (-1254.824) (-1254.481) * (-1253.314) [-1253.543] (-1250.844) (-1249.597) -- 0:00:59
156500 -- [-1254.277] (-1253.605) (-1251.378) (-1251.251) * (-1251.204) (-1256.310) [-1254.500] (-1251.454) -- 0:00:59
157000 -- (-1249.954) (-1251.377) (-1255.923) [-1252.860] * [-1250.678] (-1252.412) (-1252.906) (-1252.068) -- 0:00:59
157500 -- [-1250.791] (-1253.715) (-1258.725) (-1251.705) * (-1249.829) [-1254.443] (-1258.907) (-1251.991) -- 0:00:58
158000 -- [-1251.864] (-1253.104) (-1253.076) (-1251.835) * (-1252.665) (-1258.076) [-1255.829] (-1252.671) -- 0:00:58
158500 -- (-1252.869) [-1251.703] (-1255.592) (-1251.740) * (-1255.974) (-1251.276) (-1251.177) [-1254.103] -- 0:00:58
159000 -- (-1252.915) (-1250.858) [-1254.661] (-1252.061) * (-1254.247) [-1254.736] (-1250.048) (-1250.873) -- 0:00:58
159500 -- (-1255.054) [-1252.520] (-1254.092) (-1256.211) * (-1254.153) [-1252.463] (-1252.067) (-1251.382) -- 0:00:57
160000 -- (-1252.237) (-1253.096) [-1251.892] (-1252.872) * (-1250.247) [-1250.799] (-1252.795) (-1253.324) -- 0:00:57
Average standard deviation of split frequencies: 0.019303
160500 -- (-1255.665) [-1252.510] (-1252.566) (-1254.198) * (-1251.513) (-1252.010) (-1252.246) [-1254.990] -- 0:00:57
161000 -- [-1251.301] (-1258.059) (-1253.001) (-1254.303) * [-1251.031] (-1251.721) (-1252.375) (-1253.897) -- 0:00:57
161500 -- (-1251.529) (-1258.510) [-1251.203] (-1256.755) * (-1250.355) (-1251.834) (-1252.221) [-1252.552] -- 0:00:57
162000 -- [-1250.289] (-1256.933) (-1253.025) (-1256.212) * (-1252.107) (-1250.369) [-1251.279] (-1252.985) -- 0:00:56
162500 -- (-1251.485) [-1252.974] (-1256.772) (-1252.038) * [-1251.248] (-1253.090) (-1253.926) (-1253.419) -- 0:00:56
163000 -- (-1251.368) (-1252.574) [-1251.565] (-1253.813) * (-1255.034) [-1252.200] (-1254.513) (-1258.894) -- 0:00:56
163500 -- (-1251.354) (-1251.649) (-1251.599) [-1253.187] * (-1250.856) [-1254.352] (-1253.812) (-1252.554) -- 0:00:56
164000 -- (-1251.176) (-1251.355) [-1251.042] (-1255.211) * (-1255.629) (-1252.995) (-1253.210) [-1253.488] -- 0:00:56
164500 -- (-1252.421) (-1254.760) [-1250.572] (-1252.761) * [-1250.923] (-1252.069) (-1253.020) (-1252.872) -- 0:00:55
165000 -- (-1252.155) (-1259.127) [-1251.620] (-1253.294) * (-1252.054) [-1252.537] (-1253.878) (-1252.329) -- 0:00:55
Average standard deviation of split frequencies: 0.019879
165500 -- (-1252.137) (-1254.570) [-1253.815] (-1253.244) * (-1252.062) (-1252.441) (-1254.301) [-1254.116] -- 0:00:55
166000 -- (-1255.571) (-1253.580) [-1252.260] (-1254.752) * (-1250.690) [-1249.997] (-1255.301) (-1253.190) -- 0:00:55
166500 -- (-1251.967) [-1251.338] (-1253.234) (-1253.347) * (-1254.359) (-1253.451) (-1253.661) [-1251.870] -- 0:00:55
167000 -- (-1250.177) (-1251.170) [-1250.777] (-1253.254) * [-1251.715] (-1253.110) (-1252.964) (-1251.670) -- 0:00:54
167500 -- (-1250.873) (-1251.700) [-1253.403] (-1251.842) * (-1252.372) (-1251.941) [-1252.188] (-1251.678) -- 0:00:54
168000 -- (-1253.137) (-1253.175) [-1252.595] (-1251.501) * [-1250.867] (-1253.988) (-1252.146) (-1257.692) -- 0:00:54
168500 -- (-1256.991) [-1253.183] (-1251.667) (-1251.753) * [-1250.921] (-1254.202) (-1251.769) (-1254.355) -- 0:00:54
169000 -- (-1253.949) (-1252.405) [-1252.989] (-1251.820) * (-1248.803) (-1255.209) (-1251.344) [-1256.795] -- 0:00:59
169500 -- (-1253.286) (-1252.642) (-1249.924) [-1252.764] * [-1249.630] (-1252.190) (-1252.115) (-1252.317) -- 0:00:58
170000 -- (-1253.216) (-1251.657) (-1252.253) [-1252.998] * (-1251.214) [-1250.960] (-1253.895) (-1251.862) -- 0:00:58
Average standard deviation of split frequencies: 0.021944
170500 -- (-1251.685) [-1250.969] (-1252.703) (-1252.976) * [-1249.751] (-1253.585) (-1253.281) (-1253.945) -- 0:00:58
171000 -- (-1252.509) (-1252.933) [-1250.658] (-1252.155) * [-1249.880] (-1256.024) (-1255.853) (-1254.766) -- 0:00:58
171500 -- (-1252.727) (-1254.175) [-1251.700] (-1251.648) * (-1250.838) (-1252.232) (-1251.709) [-1253.318] -- 0:00:57
172000 -- (-1251.200) (-1256.132) [-1254.822] (-1253.676) * (-1255.609) [-1250.872] (-1253.470) (-1254.242) -- 0:00:57
172500 -- [-1251.142] (-1259.955) (-1250.088) (-1251.709) * (-1256.212) (-1252.527) (-1252.212) [-1251.970] -- 0:00:57
173000 -- (-1251.829) (-1256.298) (-1250.929) [-1251.907] * (-1256.809) [-1251.671] (-1249.193) (-1252.942) -- 0:00:57
173500 -- [-1252.477] (-1257.285) (-1254.117) (-1251.243) * [-1254.687] (-1251.409) (-1253.266) (-1253.569) -- 0:00:57
174000 -- (-1253.292) (-1253.728) [-1253.446] (-1253.245) * [-1252.978] (-1252.184) (-1253.458) (-1252.889) -- 0:00:56
174500 -- (-1253.471) (-1251.546) [-1250.340] (-1257.004) * (-1253.130) [-1253.152] (-1253.407) (-1252.069) -- 0:00:56
175000 -- (-1258.969) (-1256.040) [-1252.326] (-1252.222) * (-1252.693) [-1253.303] (-1251.511) (-1251.471) -- 0:00:56
Average standard deviation of split frequencies: 0.017559
175500 -- (-1255.516) (-1253.888) (-1252.357) [-1254.374] * (-1255.208) (-1252.664) (-1251.025) [-1253.029] -- 0:00:56
176000 -- (-1255.241) (-1252.427) [-1256.923] (-1254.022) * (-1253.265) (-1250.688) [-1252.326] (-1252.001) -- 0:00:56
176500 -- [-1249.978] (-1253.567) (-1254.501) (-1256.460) * (-1255.007) (-1252.654) (-1252.322) [-1252.045] -- 0:00:55
177000 -- [-1250.509] (-1253.110) (-1255.584) (-1253.378) * (-1252.042) (-1255.325) [-1251.623] (-1250.942) -- 0:00:55
177500 -- (-1254.089) (-1254.046) (-1252.247) [-1251.366] * (-1252.562) (-1253.961) (-1251.281) [-1250.815] -- 0:00:55
178000 -- [-1253.132] (-1251.527) (-1252.751) (-1252.431) * (-1253.048) [-1254.137] (-1253.038) (-1251.122) -- 0:00:55
178500 -- (-1250.752) [-1250.632] (-1252.034) (-1254.105) * (-1252.883) [-1253.820] (-1253.375) (-1254.785) -- 0:00:55
179000 -- (-1251.913) (-1251.928) (-1250.280) [-1254.296] * (-1252.996) (-1254.086) (-1249.200) [-1251.283] -- 0:00:55
179500 -- (-1255.263) (-1251.519) [-1250.086] (-1251.803) * (-1252.344) (-1253.944) (-1255.389) [-1251.508] -- 0:00:54
180000 -- (-1251.042) [-1254.145] (-1253.788) (-1251.610) * (-1252.614) [-1252.865] (-1251.811) (-1252.446) -- 0:00:54
Average standard deviation of split frequencies: 0.020107
180500 -- (-1252.422) [-1253.154] (-1255.699) (-1251.311) * (-1252.525) (-1253.113) [-1252.601] (-1252.979) -- 0:00:54
181000 -- (-1254.297) (-1253.426) [-1251.872] (-1253.340) * (-1251.987) (-1250.944) [-1251.267] (-1256.143) -- 0:00:54
181500 -- (-1252.733) (-1253.843) [-1255.673] (-1251.233) * (-1251.290) [-1252.453] (-1252.525) (-1255.494) -- 0:00:54
182000 -- (-1253.696) [-1251.930] (-1254.743) (-1255.017) * (-1250.825) (-1253.002) (-1253.070) [-1253.155] -- 0:00:53
182500 -- (-1254.568) (-1252.551) [-1254.856] (-1254.729) * [-1252.003] (-1257.316) (-1252.940) (-1251.011) -- 0:00:53
183000 -- (-1253.827) (-1253.628) [-1250.869] (-1252.802) * (-1251.109) [-1254.456] (-1251.535) (-1251.465) -- 0:00:53
183500 -- (-1251.391) [-1252.477] (-1252.006) (-1253.527) * (-1252.136) (-1254.298) [-1253.673] (-1251.720) -- 0:00:53
184000 -- [-1250.711] (-1251.525) (-1249.523) (-1252.796) * [-1254.310] (-1252.652) (-1255.086) (-1251.804) -- 0:00:57
184500 -- (-1253.054) (-1252.036) (-1252.539) [-1253.903] * (-1256.033) (-1254.401) (-1255.631) [-1253.346] -- 0:00:57
185000 -- (-1251.129) (-1251.788) [-1250.822] (-1252.400) * (-1253.275) [-1254.112] (-1253.413) (-1254.240) -- 0:00:57
Average standard deviation of split frequencies: 0.016755
185500 -- (-1250.618) [-1251.644] (-1249.658) (-1253.221) * [-1254.142] (-1257.724) (-1252.829) (-1256.959) -- 0:00:57
186000 -- (-1251.227) [-1252.699] (-1252.263) (-1252.761) * (-1253.428) [-1256.490] (-1252.685) (-1253.016) -- 0:00:56
186500 -- [-1250.179] (-1252.677) (-1256.046) (-1252.294) * (-1251.462) (-1256.308) [-1253.117] (-1252.925) -- 0:00:56
187000 -- (-1248.959) [-1254.657] (-1251.577) (-1251.243) * [-1253.837] (-1254.310) (-1252.998) (-1252.055) -- 0:00:56
187500 -- [-1252.289] (-1253.046) (-1254.332) (-1251.559) * (-1255.211) (-1253.244) (-1253.305) [-1251.603] -- 0:00:56
188000 -- (-1252.386) [-1251.279] (-1258.470) (-1254.129) * (-1252.828) [-1253.659] (-1249.777) (-1251.202) -- 0:00:56
188500 -- [-1251.500] (-1251.253) (-1253.323) (-1253.498) * [-1254.184] (-1256.439) (-1251.739) (-1252.900) -- 0:00:55
189000 -- (-1251.284) (-1252.113) [-1253.951] (-1257.855) * (-1258.059) (-1255.844) [-1250.814] (-1252.214) -- 0:00:55
189500 -- (-1251.547) (-1256.993) (-1252.274) [-1253.590] * [-1253.338] (-1252.129) (-1251.925) (-1252.032) -- 0:00:55
190000 -- (-1255.004) (-1252.524) [-1250.462] (-1252.431) * (-1252.152) (-1253.727) [-1251.722] (-1252.485) -- 0:00:55
Average standard deviation of split frequencies: 0.015875
190500 -- [-1252.164] (-1254.541) (-1252.487) (-1252.017) * (-1255.591) (-1255.177) [-1250.926] (-1255.263) -- 0:00:55
191000 -- (-1253.968) (-1251.791) (-1253.414) [-1251.604] * (-1252.235) [-1256.253] (-1253.556) (-1252.091) -- 0:00:55
191500 -- (-1253.327) (-1253.203) (-1252.180) [-1253.211] * (-1254.042) (-1254.149) (-1253.361) [-1253.388] -- 0:00:54
192000 -- [-1253.338] (-1255.188) (-1254.982) (-1254.546) * (-1256.345) (-1255.315) [-1250.953] (-1252.085) -- 0:00:54
192500 -- [-1252.157] (-1252.530) (-1255.816) (-1254.260) * (-1253.121) (-1253.155) [-1252.412] (-1252.988) -- 0:00:54
193000 -- (-1251.921) (-1251.381) [-1254.533] (-1252.918) * (-1251.653) (-1254.152) (-1262.764) [-1252.860] -- 0:00:54
193500 -- (-1255.039) [-1252.932] (-1253.405) (-1254.514) * (-1253.499) (-1253.270) (-1255.057) [-1251.432] -- 0:00:54
194000 -- [-1252.395] (-1253.377) (-1254.185) (-1253.213) * (-1253.834) [-1251.841] (-1253.527) (-1253.446) -- 0:00:54
194500 -- (-1256.990) (-1252.839) [-1251.199] (-1254.491) * (-1251.773) (-1253.282) [-1253.797] (-1252.736) -- 0:00:53
195000 -- [-1253.897] (-1252.144) (-1253.053) (-1257.017) * [-1250.203] (-1252.869) (-1254.187) (-1251.632) -- 0:00:53
Average standard deviation of split frequencies: 0.014811
195500 -- (-1251.087) (-1252.992) [-1252.835] (-1256.933) * (-1250.019) [-1254.075] (-1250.329) (-1254.015) -- 0:00:53
196000 -- (-1250.960) (-1251.342) [-1251.735] (-1255.455) * (-1249.266) (-1252.095) [-1257.605] (-1254.631) -- 0:00:53
196500 -- (-1251.788) (-1252.316) [-1254.164] (-1252.192) * [-1255.203] (-1252.379) (-1253.741) (-1252.810) -- 0:00:53
197000 -- (-1252.348) (-1250.681) [-1254.697] (-1254.495) * (-1254.260) (-1252.838) (-1253.764) [-1252.839] -- 0:00:52
197500 -- (-1259.875) (-1253.768) [-1250.537] (-1253.088) * (-1251.954) (-1254.084) (-1252.428) [-1252.596] -- 0:00:52
198000 -- (-1257.944) (-1253.187) [-1251.295] (-1253.070) * (-1252.047) (-1253.767) [-1250.710] (-1251.933) -- 0:00:52
198500 -- [-1257.284] (-1252.038) (-1254.241) (-1253.836) * (-1250.436) (-1256.984) [-1250.672] (-1249.759) -- 0:00:56
199000 -- [-1256.685] (-1251.151) (-1254.195) (-1252.700) * (-1258.749) (-1255.890) (-1250.740) [-1251.134] -- 0:00:56
199500 -- (-1253.026) [-1253.819] (-1253.743) (-1252.068) * [-1250.890] (-1254.766) (-1254.104) (-1249.733) -- 0:00:56
200000 -- (-1254.539) (-1256.541) [-1251.396] (-1253.536) * (-1254.009) [-1255.531] (-1251.592) (-1251.044) -- 0:00:55
Average standard deviation of split frequencies: 0.017186
200500 -- (-1255.691) (-1255.487) (-1257.434) [-1252.886] * [-1252.042] (-1253.802) (-1253.821) (-1251.512) -- 0:00:55
201000 -- (-1252.820) [-1251.469] (-1253.180) (-1250.467) * (-1252.005) (-1253.267) [-1253.903] (-1250.880) -- 0:00:55
201500 -- (-1259.985) (-1253.490) [-1251.124] (-1253.952) * (-1253.069) (-1253.777) (-1251.929) [-1250.327] -- 0:00:55
202000 -- (-1252.200) (-1252.289) [-1250.248] (-1256.345) * [-1252.414] (-1252.860) (-1253.422) (-1250.577) -- 0:00:55
202500 -- (-1253.267) (-1253.609) [-1254.085] (-1252.439) * (-1250.986) (-1255.925) (-1253.581) [-1252.103] -- 0:00:55
203000 -- (-1251.349) (-1254.030) [-1253.720] (-1250.895) * (-1253.066) (-1251.999) (-1251.013) [-1250.362] -- 0:00:54
203500 -- [-1250.849] (-1252.351) (-1251.104) (-1252.151) * (-1256.109) (-1252.248) [-1250.831] (-1252.157) -- 0:00:54
204000 -- (-1250.523) (-1256.316) (-1258.303) [-1251.883] * (-1253.678) (-1255.242) (-1250.541) [-1252.341] -- 0:00:54
204500 -- (-1253.855) (-1253.208) [-1251.662] (-1256.223) * (-1253.125) (-1254.207) [-1249.969] (-1252.111) -- 0:00:54
205000 -- (-1252.509) (-1252.660) (-1252.026) [-1253.989] * [-1250.427] (-1251.750) (-1249.944) (-1251.779) -- 0:00:54
Average standard deviation of split frequencies: 0.016982
205500 -- (-1255.815) (-1253.171) (-1255.708) [-1253.459] * (-1248.956) [-1253.549] (-1249.693) (-1253.061) -- 0:00:54
206000 -- [-1251.207] (-1254.485) (-1257.710) (-1253.097) * (-1251.742) (-1254.544) (-1251.105) [-1252.842] -- 0:00:53
206500 -- [-1252.648] (-1250.375) (-1251.818) (-1254.110) * (-1253.240) (-1252.247) (-1250.569) [-1253.765] -- 0:00:53
207000 -- (-1253.975) (-1252.404) (-1252.684) [-1250.532] * (-1254.835) (-1254.081) (-1253.715) [-1251.501] -- 0:00:53
207500 -- (-1251.712) (-1252.983) [-1250.426] (-1253.796) * (-1252.467) (-1253.376) [-1252.772] (-1252.320) -- 0:00:53
208000 -- (-1254.375) (-1255.113) (-1253.200) [-1249.638] * (-1255.304) (-1255.076) (-1253.960) [-1253.756] -- 0:00:53
208500 -- (-1258.275) [-1254.062] (-1250.590) (-1252.500) * (-1255.915) (-1254.162) (-1253.984) [-1254.845] -- 0:00:53
209000 -- (-1252.389) (-1254.311) (-1253.501) [-1253.425] * (-1250.437) (-1252.370) [-1253.493] (-1253.213) -- 0:00:52
209500 -- (-1252.438) (-1251.338) [-1252.966] (-1251.900) * (-1250.793) [-1253.000] (-1252.809) (-1250.850) -- 0:00:52
210000 -- [-1255.473] (-1253.552) (-1253.624) (-1250.929) * [-1252.833] (-1254.867) (-1253.239) (-1253.746) -- 0:00:52
Average standard deviation of split frequencies: 0.015999
210500 -- (-1257.356) (-1251.931) (-1255.926) [-1251.463] * (-1252.263) (-1258.455) [-1251.585] (-1252.748) -- 0:00:52
211000 -- [-1251.513] (-1250.184) (-1255.883) (-1254.427) * (-1254.797) (-1251.358) [-1251.886] (-1254.534) -- 0:00:52
211500 -- [-1251.221] (-1252.492) (-1250.982) (-1255.098) * (-1251.982) (-1252.907) [-1252.253] (-1252.200) -- 0:00:52
212000 -- (-1250.868) (-1250.605) [-1252.116] (-1253.149) * (-1252.033) (-1255.382) (-1252.124) [-1251.652] -- 0:00:52
212500 -- (-1250.002) (-1252.272) [-1252.772] (-1251.794) * (-1251.472) (-1252.420) (-1256.848) [-1249.360] -- 0:00:51
213000 -- [-1253.081] (-1254.319) (-1254.305) (-1254.410) * (-1255.310) (-1250.667) [-1253.267] (-1251.006) -- 0:00:51
213500 -- (-1253.831) (-1257.040) (-1253.195) [-1255.367] * (-1253.206) (-1250.968) [-1252.217] (-1255.793) -- 0:00:51
214000 -- (-1251.932) (-1250.991) [-1255.057] (-1253.420) * (-1252.199) (-1252.172) [-1250.432] (-1254.678) -- 0:00:55
214500 -- (-1251.935) (-1251.756) (-1256.185) [-1252.013] * (-1253.951) [-1254.483] (-1253.267) (-1250.691) -- 0:00:54
215000 -- (-1253.562) (-1253.202) (-1252.724) [-1252.479] * (-1254.948) (-1252.656) (-1253.844) [-1248.540] -- 0:00:54
Average standard deviation of split frequencies: 0.017023
215500 -- (-1252.016) (-1252.747) (-1251.934) [-1251.572] * (-1252.587) [-1255.009] (-1253.340) (-1252.005) -- 0:00:54
216000 -- (-1251.491) [-1254.449] (-1254.390) (-1252.143) * [-1251.400] (-1252.726) (-1254.153) (-1256.344) -- 0:00:54
216500 -- (-1253.481) [-1253.343] (-1255.228) (-1251.664) * (-1250.035) (-1252.078) [-1252.286] (-1253.615) -- 0:00:54
217000 -- [-1252.283] (-1252.120) (-1254.825) (-1251.666) * [-1252.499] (-1251.535) (-1252.745) (-1250.359) -- 0:00:54
217500 -- [-1252.086] (-1250.951) (-1254.817) (-1251.369) * (-1249.493) (-1251.416) (-1253.170) [-1251.787] -- 0:00:53
218000 -- (-1252.078) (-1253.222) (-1255.026) [-1251.963] * (-1250.107) (-1251.642) (-1258.329) [-1252.153] -- 0:00:53
218500 -- (-1253.146) (-1251.332) (-1252.653) [-1251.960] * (-1252.994) (-1253.473) [-1249.527] (-1253.957) -- 0:00:53
219000 -- (-1254.551) (-1249.812) (-1254.225) [-1254.194] * (-1250.880) [-1251.314] (-1257.388) (-1250.418) -- 0:00:53
219500 -- (-1257.216) (-1252.554) (-1254.088) [-1255.165] * (-1249.870) (-1253.044) [-1253.380] (-1253.648) -- 0:00:53
220000 -- (-1251.503) [-1252.216] (-1251.462) (-1255.298) * (-1252.489) [-1249.318] (-1252.076) (-1255.967) -- 0:00:53
Average standard deviation of split frequencies: 0.017315
220500 -- (-1250.986) (-1252.514) [-1250.192] (-1255.300) * (-1253.185) (-1250.905) (-1251.589) [-1250.849] -- 0:00:53
221000 -- (-1253.839) (-1251.758) (-1251.022) [-1252.268] * (-1250.405) (-1251.492) (-1252.436) [-1249.462] -- 0:00:52
221500 -- (-1253.579) [-1251.230] (-1249.978) (-1252.647) * (-1254.518) (-1250.085) (-1251.611) [-1251.832] -- 0:00:52
222000 -- (-1254.350) (-1254.595) [-1253.663] (-1252.487) * [-1250.882] (-1251.438) (-1256.061) (-1254.346) -- 0:00:52
222500 -- (-1255.253) (-1252.040) [-1254.166] (-1254.148) * (-1253.595) [-1251.968] (-1253.942) (-1251.645) -- 0:00:52
223000 -- (-1255.446) (-1251.827) [-1254.289] (-1254.324) * (-1253.847) [-1252.428] (-1253.550) (-1253.521) -- 0:00:52
223500 -- [-1252.256] (-1252.467) (-1251.821) (-1252.623) * (-1253.700) (-1255.354) [-1253.428] (-1254.052) -- 0:00:52
224000 -- (-1251.186) (-1257.090) [-1252.537] (-1252.365) * (-1250.420) (-1253.655) (-1255.271) [-1251.420] -- 0:00:51
224500 -- (-1250.589) (-1259.630) [-1250.308] (-1251.648) * [-1252.872] (-1255.396) (-1252.638) (-1253.484) -- 0:00:51
225000 -- [-1249.908] (-1253.457) (-1250.227) (-1253.862) * (-1251.474) (-1254.864) (-1253.750) [-1247.725] -- 0:00:51
Average standard deviation of split frequencies: 0.017565
225500 -- (-1253.446) (-1255.319) [-1252.479] (-1256.534) * [-1252.281] (-1251.685) (-1252.694) (-1249.986) -- 0:00:51
226000 -- (-1253.002) [-1252.389] (-1250.638) (-1254.378) * (-1253.629) [-1252.164] (-1254.656) (-1252.409) -- 0:00:51
226500 -- [-1253.163] (-1253.477) (-1251.654) (-1260.048) * [-1253.898] (-1255.498) (-1253.230) (-1251.082) -- 0:00:51
227000 -- (-1251.913) (-1253.451) (-1251.355) [-1254.146] * (-1253.601) (-1252.283) (-1253.986) [-1252.099] -- 0:00:51
227500 -- (-1252.764) [-1253.393] (-1253.232) (-1254.133) * (-1253.050) [-1251.784] (-1255.835) (-1251.844) -- 0:00:50
228000 -- (-1255.363) (-1255.251) (-1255.313) [-1252.447] * (-1252.998) (-1252.464) (-1252.102) [-1251.441] -- 0:00:50
228500 -- [-1251.175] (-1252.042) (-1252.722) (-1252.701) * (-1251.180) (-1252.816) (-1253.201) [-1251.001] -- 0:00:50
229000 -- [-1252.036] (-1250.314) (-1256.810) (-1252.287) * (-1252.246) (-1253.716) [-1254.035] (-1255.781) -- 0:00:53
229500 -- (-1252.142) (-1252.175) [-1253.653] (-1251.285) * (-1253.668) (-1252.973) (-1255.227) [-1251.240] -- 0:00:53
230000 -- (-1251.375) (-1251.856) [-1251.273] (-1253.248) * [-1255.225] (-1252.788) (-1251.648) (-1250.904) -- 0:00:53
Average standard deviation of split frequencies: 0.015214
230500 -- (-1250.932) (-1255.199) [-1251.695] (-1252.590) * [-1253.019] (-1252.346) (-1251.734) (-1251.415) -- 0:00:53
231000 -- (-1252.376) (-1253.065) [-1251.919] (-1250.006) * (-1252.909) (-1254.368) [-1252.189] (-1251.118) -- 0:00:53
231500 -- (-1254.162) (-1253.904) [-1251.583] (-1249.759) * (-1252.048) (-1251.737) [-1251.589] (-1256.170) -- 0:00:53
232000 -- [-1252.411] (-1254.017) (-1252.511) (-1254.862) * (-1253.934) (-1251.595) [-1252.634] (-1254.539) -- 0:00:52
232500 -- (-1253.321) (-1251.976) (-1256.367) [-1252.872] * (-1254.897) [-1252.591] (-1256.131) (-1255.028) -- 0:00:52
233000 -- [-1256.605] (-1256.092) (-1252.775) (-1252.026) * (-1250.945) (-1252.030) [-1251.631] (-1253.860) -- 0:00:52
233500 -- (-1254.688) (-1251.975) [-1252.351] (-1254.485) * [-1250.884] (-1254.193) (-1252.730) (-1252.669) -- 0:00:52
234000 -- (-1252.574) [-1250.146] (-1254.900) (-1255.043) * [-1250.635] (-1253.483) (-1251.131) (-1251.344) -- 0:00:52
234500 -- [-1251.913] (-1252.666) (-1252.782) (-1256.981) * (-1253.094) (-1251.247) (-1252.087) [-1252.579] -- 0:00:52
235000 -- [-1252.631] (-1252.560) (-1256.276) (-1257.311) * (-1257.066) (-1251.785) (-1252.881) [-1251.172] -- 0:00:52
Average standard deviation of split frequencies: 0.014537
235500 -- [-1255.811] (-1252.001) (-1258.260) (-1256.899) * [-1253.539] (-1257.615) (-1253.644) (-1253.765) -- 0:00:51
236000 -- (-1252.525) [-1253.953] (-1255.949) (-1257.475) * [-1255.690] (-1253.009) (-1252.331) (-1253.773) -- 0:00:51
236500 -- (-1251.310) (-1255.154) [-1255.646] (-1254.938) * (-1252.807) (-1255.425) [-1256.042] (-1252.431) -- 0:00:51
237000 -- (-1251.540) (-1253.142) [-1256.079] (-1254.015) * (-1252.098) (-1251.742) (-1252.212) [-1250.113] -- 0:00:51
237500 -- [-1251.963] (-1253.766) (-1253.555) (-1253.190) * (-1254.338) (-1253.642) [-1256.766] (-1251.400) -- 0:00:51
238000 -- [-1250.944] (-1255.321) (-1257.303) (-1254.898) * [-1251.849] (-1254.207) (-1252.305) (-1252.387) -- 0:00:51
238500 -- (-1253.632) (-1258.069) [-1250.640] (-1265.302) * [-1251.425] (-1253.421) (-1250.802) (-1251.989) -- 0:00:51
239000 -- [-1249.612] (-1254.040) (-1249.444) (-1257.688) * (-1252.276) (-1253.873) [-1252.337] (-1251.620) -- 0:00:50
239500 -- [-1249.443] (-1251.371) (-1252.629) (-1264.042) * (-1252.324) (-1253.832) [-1257.968] (-1252.133) -- 0:00:50
240000 -- (-1250.491) [-1252.843] (-1253.851) (-1255.707) * [-1252.052] (-1253.190) (-1251.270) (-1254.833) -- 0:00:50
Average standard deviation of split frequencies: 0.015126
240500 -- [-1252.330] (-1252.724) (-1252.724) (-1252.980) * (-1249.789) (-1253.238) [-1253.618] (-1252.355) -- 0:00:50
241000 -- (-1253.895) (-1254.838) (-1255.090) [-1251.684] * (-1254.181) (-1255.241) (-1251.657) [-1251.257] -- 0:00:50
241500 -- [-1252.259] (-1255.452) (-1251.887) (-1252.187) * (-1250.191) (-1252.568) [-1253.133] (-1251.143) -- 0:00:50
242000 -- (-1251.776) [-1253.059] (-1253.103) (-1254.535) * (-1249.561) (-1253.976) (-1252.339) [-1256.016] -- 0:00:50
242500 -- [-1251.780] (-1252.188) (-1251.984) (-1253.729) * (-1252.795) (-1252.671) [-1253.304] (-1250.271) -- 0:00:49
243000 -- [-1254.769] (-1251.929) (-1252.076) (-1252.278) * [-1252.079] (-1253.019) (-1250.277) (-1251.351) -- 0:00:49
243500 -- (-1253.334) (-1252.080) [-1251.041] (-1253.726) * (-1251.478) [-1252.131] (-1254.857) (-1253.232) -- 0:00:52
244000 -- [-1253.431] (-1251.206) (-1254.358) (-1253.818) * (-1252.717) (-1251.243) (-1256.916) [-1252.264] -- 0:00:52
244500 -- (-1252.160) (-1251.149) (-1253.246) [-1252.339] * (-1251.172) (-1251.377) [-1250.993] (-1254.376) -- 0:00:52
245000 -- (-1254.254) [-1252.525] (-1253.669) (-1252.766) * (-1251.755) (-1251.225) (-1250.409) [-1255.268] -- 0:00:52
Average standard deviation of split frequencies: 0.014798
245500 -- (-1255.140) (-1251.552) (-1252.403) [-1255.485] * [-1252.536] (-1250.957) (-1250.902) (-1256.014) -- 0:00:52
246000 -- (-1252.379) (-1251.188) (-1255.398) [-1252.516] * (-1250.607) (-1251.901) (-1251.460) [-1257.979] -- 0:00:52
246500 -- (-1251.489) [-1253.970] (-1258.487) (-1252.287) * (-1253.891) (-1254.582) [-1250.757] (-1254.869) -- 0:00:51
247000 -- [-1249.982] (-1256.419) (-1255.006) (-1255.656) * (-1252.841) [-1257.572] (-1252.440) (-1254.371) -- 0:00:51
247500 -- (-1252.255) (-1252.240) [-1253.989] (-1257.862) * (-1251.853) (-1254.449) (-1254.232) [-1252.017] -- 0:00:51
248000 -- [-1250.625] (-1254.981) (-1250.649) (-1254.183) * (-1253.101) (-1251.023) (-1251.609) [-1251.324] -- 0:00:51
248500 -- (-1251.913) (-1252.269) [-1251.438] (-1252.858) * (-1252.637) [-1251.513] (-1251.755) (-1253.645) -- 0:00:51
249000 -- (-1254.095) (-1251.007) (-1252.122) [-1254.741] * (-1253.932) [-1250.711] (-1253.196) (-1250.620) -- 0:00:51
249500 -- (-1255.089) (-1251.883) (-1254.381) [-1252.180] * (-1258.470) (-1253.362) (-1253.190) [-1252.171] -- 0:00:51
250000 -- (-1254.216) (-1253.874) (-1254.731) [-1252.005] * (-1255.477) [-1250.212] (-1252.489) (-1251.747) -- 0:00:51
Average standard deviation of split frequencies: 0.015045
250500 -- (-1252.265) (-1255.344) (-1253.960) [-1252.102] * (-1252.781) (-1250.461) (-1250.702) [-1252.653] -- 0:00:50
251000 -- (-1254.343) (-1255.858) [-1252.550] (-1255.226) * (-1252.540) [-1257.329] (-1251.903) (-1250.627) -- 0:00:50
251500 -- (-1252.066) (-1254.126) [-1250.768] (-1255.007) * (-1250.957) (-1257.358) (-1252.958) [-1254.002] -- 0:00:50
252000 -- (-1250.977) (-1254.054) (-1252.926) [-1252.257] * (-1257.207) [-1250.210] (-1251.988) (-1250.662) -- 0:00:50
252500 -- (-1251.893) [-1250.363] (-1252.590) (-1253.502) * (-1253.014) (-1254.966) (-1251.357) [-1251.886] -- 0:00:50
253000 -- (-1251.593) [-1249.302] (-1251.170) (-1256.302) * [-1252.465] (-1252.343) (-1255.656) (-1254.829) -- 0:00:50
253500 -- (-1252.569) [-1250.681] (-1253.757) (-1252.102) * (-1252.577) [-1250.008] (-1251.282) (-1255.187) -- 0:00:50
254000 -- (-1255.341) (-1250.208) [-1251.369] (-1253.205) * (-1252.023) (-1253.596) [-1253.436] (-1254.119) -- 0:00:49
254500 -- [-1256.308] (-1252.121) (-1251.343) (-1251.673) * (-1255.920) (-1252.537) (-1255.534) [-1254.039] -- 0:00:49
255000 -- (-1256.783) (-1251.699) [-1252.530] (-1252.003) * [-1254.481] (-1252.027) (-1252.915) (-1252.878) -- 0:00:49
Average standard deviation of split frequencies: 0.015038
255500 -- (-1252.925) (-1253.392) (-1251.437) [-1252.497] * (-1253.680) (-1253.444) [-1254.102] (-1252.226) -- 0:00:49
256000 -- (-1251.162) [-1251.898] (-1256.045) (-1251.042) * [-1253.591] (-1255.576) (-1252.097) (-1253.511) -- 0:00:49
256500 -- [-1252.582] (-1258.206) (-1253.473) (-1253.406) * (-1256.957) [-1251.574] (-1253.495) (-1255.426) -- 0:00:49
257000 -- (-1250.779) [-1252.598] (-1252.466) (-1252.498) * (-1257.331) [-1250.394] (-1255.093) (-1251.754) -- 0:00:49
257500 -- (-1255.651) (-1258.917) (-1253.151) [-1251.934] * (-1258.029) (-1254.864) [-1250.369] (-1252.492) -- 0:00:49
258000 -- [-1255.655] (-1257.783) (-1253.208) (-1254.233) * (-1253.760) (-1258.091) (-1251.158) [-1252.650] -- 0:00:48
258500 -- (-1253.796) [-1249.731] (-1253.549) (-1252.687) * (-1256.035) (-1252.614) (-1252.723) [-1251.070] -- 0:00:51
259000 -- (-1253.230) [-1249.731] (-1253.506) (-1254.081) * (-1255.190) [-1252.319] (-1254.844) (-1253.189) -- 0:00:51
259500 -- (-1252.058) [-1253.578] (-1252.410) (-1251.670) * [-1256.146] (-1252.267) (-1251.960) (-1252.912) -- 0:00:51
260000 -- (-1254.034) (-1255.254) (-1254.885) [-1253.658] * (-1260.900) (-1252.175) [-1253.230] (-1254.315) -- 0:00:51
Average standard deviation of split frequencies: 0.015372
260500 -- (-1251.923) [-1255.926] (-1255.536) (-1252.244) * (-1252.674) (-1253.263) (-1253.144) [-1256.909] -- 0:00:51
261000 -- (-1253.194) (-1249.420) [-1252.690] (-1256.747) * (-1250.948) [-1252.786] (-1252.960) (-1253.746) -- 0:00:50
261500 -- (-1252.906) (-1251.113) (-1253.131) [-1251.748] * [-1251.434] (-1253.577) (-1253.257) (-1255.610) -- 0:00:50
262000 -- (-1255.635) (-1255.898) [-1250.756] (-1253.946) * (-1251.680) (-1253.135) [-1253.645] (-1254.219) -- 0:00:50
262500 -- (-1252.603) (-1255.972) [-1252.679] (-1255.252) * (-1252.801) [-1253.513] (-1251.803) (-1253.051) -- 0:00:50
263000 -- (-1252.550) (-1253.549) (-1253.596) [-1253.096] * (-1252.567) [-1253.484] (-1254.689) (-1254.517) -- 0:00:50
263500 -- [-1252.794] (-1259.182) (-1254.120) (-1251.649) * (-1252.330) (-1253.550) [-1257.704] (-1252.752) -- 0:00:50
264000 -- (-1252.777) [-1252.143] (-1253.963) (-1254.820) * [-1252.944] (-1253.584) (-1252.391) (-1251.737) -- 0:00:50
264500 -- (-1252.299) [-1252.743] (-1253.543) (-1253.090) * (-1253.289) (-1255.643) [-1251.618] (-1251.872) -- 0:00:50
265000 -- (-1254.230) (-1252.477) [-1252.433] (-1252.375) * [-1251.969] (-1253.527) (-1252.564) (-1251.916) -- 0:00:49
Average standard deviation of split frequencies: 0.015654
265500 -- (-1252.615) (-1252.268) [-1251.191] (-1252.727) * (-1250.198) (-1253.653) (-1252.871) [-1253.779] -- 0:00:49
266000 -- (-1252.807) [-1253.604] (-1252.833) (-1251.935) * (-1252.024) (-1252.820) [-1254.425] (-1254.734) -- 0:00:49
266500 -- [-1252.502] (-1251.535) (-1253.499) (-1253.030) * [-1252.232] (-1253.148) (-1251.305) (-1252.448) -- 0:00:49
267000 -- (-1256.532) [-1255.221] (-1254.653) (-1253.179) * (-1252.653) [-1251.858] (-1251.659) (-1252.996) -- 0:00:49
267500 -- (-1250.664) (-1254.976) (-1250.451) [-1251.004] * (-1254.541) (-1252.460) (-1252.107) [-1253.351] -- 0:00:49
268000 -- [-1252.212] (-1257.089) (-1249.969) (-1251.367) * (-1252.869) (-1254.709) [-1250.482] (-1253.579) -- 0:00:49
268500 -- (-1254.866) (-1257.552) (-1252.078) [-1251.993] * [-1253.882] (-1252.540) (-1251.906) (-1253.120) -- 0:00:49
269000 -- [-1257.490] (-1254.415) (-1250.585) (-1254.939) * (-1256.998) (-1251.979) [-1252.286] (-1261.429) -- 0:00:48
269500 -- [-1252.358] (-1254.503) (-1251.573) (-1254.276) * (-1254.484) (-1255.079) (-1251.836) [-1251.261] -- 0:00:48
270000 -- [-1252.719] (-1255.604) (-1251.907) (-1255.984) * (-1254.649) (-1252.562) (-1252.641) [-1257.905] -- 0:00:48
Average standard deviation of split frequencies: 0.015191
270500 -- (-1251.459) (-1254.851) [-1251.047] (-1255.190) * (-1255.411) [-1251.603] (-1252.855) (-1254.501) -- 0:00:48
271000 -- (-1253.124) (-1254.689) (-1252.833) [-1252.844] * (-1251.548) (-1251.480) (-1252.190) [-1251.748] -- 0:00:48
271500 -- (-1252.589) (-1253.426) [-1254.757] (-1251.177) * (-1252.160) (-1251.784) [-1251.825] (-1251.609) -- 0:00:48
272000 -- (-1254.398) (-1255.860) (-1253.786) [-1253.857] * (-1255.369) [-1251.969] (-1252.777) (-1252.217) -- 0:00:48
272500 -- (-1254.634) (-1252.579) [-1253.384] (-1252.312) * (-1259.531) (-1251.376) (-1257.790) [-1250.970] -- 0:00:48
273000 -- (-1253.135) [-1254.604] (-1256.658) (-1256.489) * (-1251.354) (-1251.747) (-1254.112) [-1253.330] -- 0:00:47
273500 -- (-1251.762) (-1252.869) (-1256.728) [-1252.142] * (-1256.669) (-1250.933) [-1253.420] (-1251.437) -- 0:00:50
274000 -- (-1251.638) (-1254.573) (-1253.786) [-1252.933] * [-1250.991] (-1251.808) (-1253.665) (-1255.028) -- 0:00:50
274500 -- (-1252.115) (-1252.458) [-1251.060] (-1252.547) * (-1251.062) (-1253.090) [-1250.851] (-1253.496) -- 0:00:50
275000 -- (-1252.552) [-1253.714] (-1253.601) (-1256.659) * (-1253.689) [-1250.595] (-1253.181) (-1251.390) -- 0:00:50
Average standard deviation of split frequencies: 0.014803
275500 -- (-1254.035) [-1253.393] (-1251.000) (-1251.349) * [-1250.779] (-1251.795) (-1253.198) (-1255.688) -- 0:00:49
276000 -- (-1254.925) (-1253.829) [-1253.258] (-1252.197) * [-1251.222] (-1256.573) (-1254.303) (-1250.664) -- 0:00:49
276500 -- (-1254.337) (-1252.349) [-1253.128] (-1256.275) * [-1253.328] (-1249.968) (-1254.627) (-1253.272) -- 0:00:49
277000 -- (-1260.775) (-1250.995) (-1253.019) [-1252.484] * (-1252.158) [-1253.326] (-1252.436) (-1252.989) -- 0:00:49
277500 -- (-1253.468) (-1256.047) (-1255.884) [-1251.113] * (-1256.528) [-1253.788] (-1253.647) (-1258.199) -- 0:00:49
278000 -- (-1252.557) (-1250.887) [-1254.975] (-1251.351) * (-1260.621) (-1254.721) (-1252.850) [-1252.056] -- 0:00:49
278500 -- (-1251.948) [-1253.242] (-1255.126) (-1251.496) * [-1254.529] (-1252.344) (-1250.081) (-1252.753) -- 0:00:49
279000 -- (-1251.650) [-1250.862] (-1251.932) (-1250.299) * (-1251.989) [-1255.396] (-1250.303) (-1252.737) -- 0:00:49
279500 -- [-1250.554] (-1252.324) (-1255.092) (-1257.962) * (-1255.220) (-1253.174) (-1250.303) [-1253.447] -- 0:00:48
280000 -- (-1255.115) [-1252.288] (-1252.387) (-1254.447) * (-1252.022) (-1257.612) (-1250.671) [-1255.021] -- 0:00:48
Average standard deviation of split frequencies: 0.014836
280500 -- (-1251.610) [-1251.830] (-1258.298) (-1253.460) * (-1252.384) (-1254.074) [-1250.721] (-1249.781) -- 0:00:48
281000 -- [-1252.894] (-1251.716) (-1255.863) (-1255.794) * (-1252.939) [-1254.119] (-1252.514) (-1254.285) -- 0:00:48
281500 -- (-1252.247) (-1250.844) [-1251.595] (-1254.565) * (-1253.677) [-1254.637] (-1252.132) (-1253.112) -- 0:00:48
282000 -- [-1256.596] (-1256.502) (-1255.501) (-1251.263) * (-1251.509) (-1256.873) (-1251.638) [-1252.357] -- 0:00:48
282500 -- (-1252.343) (-1254.768) (-1253.998) [-1253.631] * (-1251.221) (-1254.513) (-1252.608) [-1250.137] -- 0:00:48
283000 -- [-1255.035] (-1254.243) (-1253.182) (-1251.680) * (-1251.287) [-1249.849] (-1252.342) (-1252.157) -- 0:00:48
283500 -- [-1251.510] (-1253.252) (-1251.391) (-1252.561) * (-1254.844) [-1251.983] (-1253.513) (-1252.535) -- 0:00:48
284000 -- (-1253.154) (-1253.265) (-1252.882) [-1253.785] * [-1251.652] (-1252.793) (-1252.267) (-1251.114) -- 0:00:47
284500 -- (-1257.042) [-1252.215] (-1254.581) (-1252.549) * (-1252.502) (-1253.671) (-1251.328) [-1251.384] -- 0:00:47
285000 -- (-1255.760) [-1252.267] (-1251.980) (-1254.012) * (-1254.590) (-1256.199) [-1253.712] (-1258.986) -- 0:00:47
Average standard deviation of split frequencies: 0.013552
285500 -- (-1254.592) (-1253.366) (-1252.681) [-1252.422] * (-1252.800) [-1253.751] (-1252.736) (-1250.752) -- 0:00:47
286000 -- (-1253.261) (-1254.798) (-1251.396) [-1252.581] * (-1255.369) [-1251.180] (-1253.035) (-1251.195) -- 0:00:47
286500 -- (-1254.063) [-1251.196] (-1252.274) (-1250.675) * [-1258.563] (-1252.333) (-1251.628) (-1254.958) -- 0:00:47
287000 -- (-1252.757) (-1255.391) (-1256.609) [-1251.902] * (-1251.129) (-1249.617) (-1255.866) [-1250.457] -- 0:00:47
287500 -- (-1252.000) (-1255.751) (-1256.188) [-1251.632] * (-1252.270) (-1249.942) (-1253.624) [-1249.649] -- 0:00:47
288000 -- (-1254.788) (-1251.358) [-1252.648] (-1252.765) * (-1255.939) [-1252.076] (-1255.793) (-1252.041) -- 0:00:49
288500 -- (-1251.299) [-1252.830] (-1252.317) (-1252.389) * (-1253.101) [-1251.153] (-1251.854) (-1251.910) -- 0:00:49
289000 -- (-1252.824) (-1253.189) [-1253.717] (-1253.145) * (-1253.717) [-1251.172] (-1251.642) (-1253.216) -- 0:00:49
289500 -- (-1251.638) (-1253.128) (-1252.718) [-1252.900] * (-1255.714) [-1250.701] (-1251.035) (-1251.166) -- 0:00:49
290000 -- (-1253.625) (-1253.265) (-1251.613) [-1251.899] * [-1253.554] (-1250.384) (-1253.107) (-1253.495) -- 0:00:48
Average standard deviation of split frequencies: 0.014326
290500 -- (-1250.695) (-1253.865) (-1254.611) [-1252.396] * (-1253.983) [-1250.993] (-1251.269) (-1250.668) -- 0:00:48
291000 -- (-1252.619) [-1254.026] (-1253.223) (-1253.528) * [-1253.307] (-1254.391) (-1253.452) (-1255.110) -- 0:00:48
291500 -- [-1252.903] (-1253.217) (-1251.056) (-1253.585) * [-1255.984] (-1253.641) (-1253.394) (-1254.306) -- 0:00:48
292000 -- (-1254.177) (-1253.470) (-1250.429) [-1252.150] * (-1255.011) (-1253.618) [-1254.038] (-1253.679) -- 0:00:48
292500 -- (-1251.733) (-1256.869) (-1252.990) [-1251.598] * (-1255.517) (-1253.486) [-1251.657] (-1254.327) -- 0:00:48
293000 -- (-1251.928) (-1258.730) [-1251.912] (-1252.541) * (-1254.424) [-1252.646] (-1252.654) (-1252.573) -- 0:00:48
293500 -- (-1252.270) (-1253.865) (-1253.097) [-1252.040] * [-1251.261] (-1251.058) (-1253.061) (-1252.621) -- 0:00:48
294000 -- (-1252.294) [-1251.160] (-1255.007) (-1252.311) * [-1253.266] (-1252.041) (-1255.996) (-1254.195) -- 0:00:48
294500 -- [-1253.298] (-1252.872) (-1251.322) (-1254.306) * [-1253.076] (-1253.822) (-1257.274) (-1253.019) -- 0:00:47
295000 -- [-1257.022] (-1253.510) (-1251.213) (-1257.116) * (-1256.250) (-1251.621) [-1254.836] (-1254.520) -- 0:00:47
Average standard deviation of split frequencies: 0.014245
295500 -- (-1254.984) [-1252.364] (-1253.084) (-1260.018) * [-1254.073] (-1251.072) (-1253.303) (-1252.837) -- 0:00:47
296000 -- (-1255.346) [-1251.903] (-1250.999) (-1257.049) * (-1252.807) [-1251.104] (-1252.143) (-1253.203) -- 0:00:47
296500 -- (-1253.443) [-1252.961] (-1253.430) (-1253.320) * (-1252.069) (-1252.390) [-1250.390] (-1250.756) -- 0:00:47
297000 -- [-1252.633] (-1253.807) (-1256.196) (-1252.284) * [-1252.078] (-1252.298) (-1253.192) (-1255.890) -- 0:00:47
297500 -- (-1258.364) (-1249.712) [-1251.421] (-1253.420) * (-1252.966) (-1249.607) (-1252.935) [-1256.523] -- 0:00:47
298000 -- [-1256.038] (-1251.837) (-1252.679) (-1252.020) * (-1252.687) (-1249.187) (-1253.487) [-1255.387] -- 0:00:47
298500 -- (-1251.278) (-1251.268) [-1254.440] (-1251.530) * [-1248.838] (-1252.602) (-1251.752) (-1255.047) -- 0:00:47
299000 -- (-1252.810) [-1252.928] (-1255.794) (-1251.567) * (-1251.902) (-1253.175) (-1252.099) [-1252.673] -- 0:00:46
299500 -- [-1251.298] (-1251.555) (-1254.775) (-1256.037) * (-1252.233) (-1253.324) [-1249.492] (-1253.641) -- 0:00:46
300000 -- (-1254.093) (-1254.086) (-1254.283) [-1252.854] * (-1253.272) (-1253.674) (-1249.563) [-1251.613] -- 0:00:46
Average standard deviation of split frequencies: 0.014372
300500 -- (-1251.262) (-1257.541) [-1250.913] (-1253.353) * (-1250.996) (-1252.383) (-1251.103) [-1252.273] -- 0:00:46
301000 -- (-1250.021) [-1256.246] (-1260.787) (-1254.153) * (-1258.279) [-1250.456] (-1250.609) (-1253.064) -- 0:00:46
301500 -- [-1252.026] (-1252.490) (-1259.239) (-1251.866) * (-1254.396) (-1252.275) [-1252.245] (-1252.607) -- 0:00:46
302000 -- (-1254.211) [-1252.174] (-1253.936) (-1251.414) * (-1251.596) [-1250.509] (-1250.615) (-1255.278) -- 0:00:46
302500 -- [-1251.617] (-1252.993) (-1253.934) (-1251.270) * (-1256.811) [-1254.782] (-1253.101) (-1255.916) -- 0:00:46
303000 -- (-1253.288) (-1252.048) (-1255.363) [-1251.640] * (-1254.586) (-1253.964) [-1252.953] (-1254.208) -- 0:00:48
303500 -- (-1253.383) (-1251.398) [-1251.791] (-1254.669) * (-1253.594) [-1254.759] (-1251.780) (-1257.625) -- 0:00:48
304000 -- (-1252.347) (-1253.475) (-1250.069) [-1254.997] * (-1254.161) [-1251.770] (-1249.641) (-1254.371) -- 0:00:48
304500 -- [-1251.349] (-1254.572) (-1252.872) (-1251.963) * (-1252.267) (-1256.015) (-1249.352) [-1252.624] -- 0:00:47
305000 -- (-1254.319) [-1255.795] (-1253.710) (-1251.697) * (-1252.649) (-1253.372) [-1251.181] (-1252.629) -- 0:00:47
Average standard deviation of split frequencies: 0.014293
305500 -- (-1256.232) (-1255.008) (-1253.871) [-1255.214] * (-1251.404) (-1251.675) [-1249.193] (-1253.108) -- 0:00:47
306000 -- (-1250.871) [-1252.010] (-1252.373) (-1254.052) * (-1255.367) (-1249.893) (-1251.772) [-1253.246] -- 0:00:47
306500 -- (-1252.278) (-1257.227) (-1253.370) [-1253.213] * (-1254.728) (-1252.412) (-1250.138) [-1252.258] -- 0:00:47
307000 -- [-1250.620] (-1252.514) (-1253.683) (-1253.104) * (-1257.155) [-1250.381] (-1252.209) (-1254.991) -- 0:00:47
307500 -- (-1253.005) [-1251.784] (-1251.602) (-1253.441) * (-1253.813) (-1253.243) [-1251.885] (-1253.877) -- 0:00:47
308000 -- [-1252.686] (-1253.509) (-1252.027) (-1254.407) * (-1252.633) (-1252.195) (-1252.807) [-1254.146] -- 0:00:47
308500 -- (-1255.382) (-1252.076) [-1251.755] (-1252.552) * (-1257.019) (-1251.860) [-1251.917] (-1250.944) -- 0:00:47
309000 -- (-1255.634) (-1251.604) [-1254.433] (-1250.401) * (-1250.825) (-1255.822) [-1250.454] (-1254.926) -- 0:00:46
309500 -- [-1257.890] (-1254.633) (-1252.520) (-1254.939) * (-1256.630) (-1256.520) (-1250.568) [-1252.231] -- 0:00:46
310000 -- (-1256.717) (-1253.652) [-1254.338] (-1255.623) * (-1253.463) [-1253.534] (-1252.864) (-1252.253) -- 0:00:46
Average standard deviation of split frequencies: 0.014247
310500 -- (-1255.757) [-1253.944] (-1255.233) (-1252.313) * (-1252.153) (-1253.310) [-1253.260] (-1254.575) -- 0:00:46
311000 -- (-1253.145) (-1257.221) [-1251.847] (-1253.009) * (-1252.731) (-1254.315) [-1250.494] (-1252.886) -- 0:00:46
311500 -- (-1255.016) (-1251.816) [-1252.620] (-1252.636) * (-1254.762) (-1249.742) (-1253.240) [-1250.872] -- 0:00:46
312000 -- (-1253.509) [-1251.482] (-1251.893) (-1254.297) * (-1253.652) (-1252.152) (-1250.612) [-1252.678] -- 0:00:46
312500 -- (-1253.518) (-1252.966) [-1253.527] (-1252.419) * (-1251.070) (-1251.051) (-1252.364) [-1254.343] -- 0:00:46
313000 -- (-1252.434) (-1253.482) (-1256.328) [-1251.836] * (-1251.425) [-1253.158] (-1256.386) (-1251.001) -- 0:00:46
313500 -- (-1255.635) (-1252.981) [-1253.639] (-1253.077) * (-1250.703) [-1252.662] (-1251.019) (-1251.637) -- 0:00:45
314000 -- (-1253.689) (-1254.602) (-1255.587) [-1254.082] * (-1251.593) (-1250.202) (-1253.013) [-1250.748] -- 0:00:45
314500 -- (-1252.164) [-1256.612] (-1254.882) (-1250.041) * [-1251.629] (-1255.584) (-1251.842) (-1250.085) -- 0:00:45
315000 -- [-1251.745] (-1252.421) (-1251.684) (-1252.516) * (-1251.663) (-1253.587) (-1251.955) [-1251.664] -- 0:00:45
Average standard deviation of split frequencies: 0.013112
315500 -- [-1251.049] (-1252.799) (-1253.042) (-1253.073) * (-1250.524) [-1253.164] (-1252.001) (-1251.209) -- 0:00:45
316000 -- (-1253.702) [-1249.926] (-1250.619) (-1251.653) * [-1252.443] (-1253.490) (-1251.917) (-1251.137) -- 0:00:45
316500 -- (-1254.018) [-1249.190] (-1250.595) (-1251.620) * (-1251.134) [-1251.329] (-1253.559) (-1252.990) -- 0:00:45
317000 -- (-1258.807) (-1252.676) [-1253.811] (-1252.139) * [-1251.914] (-1252.052) (-1251.091) (-1252.600) -- 0:00:45
317500 -- (-1254.422) [-1250.386] (-1252.966) (-1251.739) * (-1253.181) (-1253.832) (-1251.634) [-1256.612] -- 0:00:45
318000 -- (-1252.567) (-1254.149) (-1250.657) [-1252.963] * [-1253.441] (-1253.123) (-1255.466) (-1251.174) -- 0:00:45
318500 -- (-1253.864) (-1252.545) (-1250.926) [-1250.779] * [-1250.652] (-1252.622) (-1253.824) (-1253.498) -- 0:00:47
319000 -- (-1253.071) (-1252.918) (-1249.259) [-1251.425] * [-1250.740] (-1250.835) (-1254.890) (-1253.652) -- 0:00:46
319500 -- (-1251.828) (-1250.970) (-1252.629) [-1252.300] * (-1250.322) (-1250.536) (-1257.489) [-1251.377] -- 0:00:46
320000 -- (-1251.591) (-1252.731) (-1251.179) [-1249.059] * (-1252.605) [-1254.636] (-1259.256) (-1253.126) -- 0:00:46
Average standard deviation of split frequencies: 0.013385
320500 -- (-1256.052) (-1254.031) [-1250.477] (-1251.884) * (-1253.438) [-1251.128] (-1252.606) (-1255.248) -- 0:00:46
321000 -- (-1252.184) (-1254.834) (-1253.399) [-1251.660] * (-1253.041) (-1251.968) [-1251.793] (-1251.767) -- 0:00:46
321500 -- [-1253.026] (-1251.445) (-1250.792) (-1250.026) * (-1253.083) [-1252.592] (-1251.713) (-1253.474) -- 0:00:46
322000 -- (-1252.187) (-1249.509) [-1253.621] (-1251.004) * [-1257.733] (-1253.083) (-1255.858) (-1255.072) -- 0:00:46
322500 -- (-1251.910) [-1253.017] (-1252.959) (-1250.454) * (-1254.123) (-1254.401) [-1255.199] (-1254.243) -- 0:00:46
323000 -- (-1250.602) [-1253.332] (-1249.920) (-1251.188) * [-1253.801] (-1251.936) (-1252.001) (-1252.257) -- 0:00:46
323500 -- [-1256.515] (-1252.559) (-1252.145) (-1255.619) * (-1252.525) [-1254.496] (-1249.519) (-1250.580) -- 0:00:46
324000 -- (-1252.332) [-1251.237] (-1252.954) (-1251.667) * (-1251.373) (-1253.185) (-1251.790) [-1252.580] -- 0:00:45
324500 -- [-1252.065] (-1256.520) (-1255.603) (-1250.904) * (-1256.918) (-1257.978) [-1249.071] (-1253.607) -- 0:00:45
325000 -- (-1251.683) (-1252.977) [-1252.418] (-1252.689) * (-1252.492) (-1252.911) [-1250.671] (-1254.372) -- 0:00:45
Average standard deviation of split frequencies: 0.014384
325500 -- (-1252.063) (-1254.753) [-1253.938] (-1252.495) * [-1253.886] (-1250.088) (-1253.062) (-1252.808) -- 0:00:45
326000 -- [-1251.639] (-1254.552) (-1255.283) (-1253.849) * (-1252.780) (-1257.487) [-1253.421] (-1254.308) -- 0:00:45
326500 -- [-1252.587] (-1259.117) (-1251.728) (-1252.637) * (-1252.716) (-1251.111) (-1251.781) [-1252.338] -- 0:00:45
327000 -- (-1254.604) (-1251.740) [-1251.631] (-1251.478) * (-1253.486) (-1250.693) [-1252.860] (-1253.661) -- 0:00:45
327500 -- (-1251.128) [-1253.233] (-1251.993) (-1250.981) * (-1253.241) (-1251.125) [-1252.442] (-1253.204) -- 0:00:45
328000 -- (-1253.533) [-1252.752] (-1252.550) (-1248.883) * (-1253.375) [-1252.530] (-1251.554) (-1252.364) -- 0:00:45
328500 -- (-1254.331) (-1255.805) [-1251.585] (-1251.278) * [-1255.054] (-1251.429) (-1254.245) (-1253.349) -- 0:00:44
329000 -- [-1253.267] (-1251.087) (-1254.672) (-1252.753) * (-1252.244) (-1254.701) (-1253.345) [-1252.694] -- 0:00:44
329500 -- (-1257.668) [-1250.436] (-1255.221) (-1252.957) * (-1250.999) (-1251.404) (-1250.733) [-1253.310] -- 0:00:44
330000 -- (-1253.526) [-1250.799] (-1253.511) (-1254.400) * (-1253.405) [-1251.130] (-1252.151) (-1259.181) -- 0:00:44
Average standard deviation of split frequencies: 0.014181
330500 -- (-1253.989) (-1252.264) [-1250.119] (-1253.912) * (-1253.601) (-1250.952) (-1251.696) [-1254.553] -- 0:00:44
331000 -- (-1254.040) (-1251.909) (-1251.017) [-1250.523] * (-1254.458) (-1249.611) [-1251.567] (-1253.840) -- 0:00:44
331500 -- [-1253.735] (-1251.588) (-1251.644) (-1252.769) * [-1253.866] (-1253.096) (-1251.682) (-1254.348) -- 0:00:44
332000 -- (-1252.208) (-1253.456) [-1250.471] (-1252.034) * (-1251.830) (-1252.373) (-1251.177) [-1252.732] -- 0:00:44
332500 -- (-1251.584) (-1252.918) [-1251.732] (-1252.488) * (-1251.961) [-1251.034] (-1252.862) (-1253.287) -- 0:00:44
333000 -- (-1254.636) (-1255.157) (-1254.217) [-1252.450] * (-1251.247) (-1253.200) (-1254.601) [-1253.165] -- 0:00:46
333500 -- [-1252.059] (-1254.164) (-1253.150) (-1252.349) * (-1254.472) (-1252.336) [-1252.015] (-1251.578) -- 0:00:45
334000 -- (-1252.922) [-1254.297] (-1253.096) (-1253.683) * (-1256.090) (-1261.570) (-1255.668) [-1254.574] -- 0:00:45
334500 -- (-1252.898) (-1254.754) [-1252.052] (-1256.304) * (-1250.819) (-1258.233) [-1253.358] (-1253.980) -- 0:00:45
335000 -- (-1254.418) [-1254.801] (-1253.011) (-1254.620) * (-1251.220) [-1252.874] (-1256.373) (-1252.129) -- 0:00:45
Average standard deviation of split frequencies: 0.012627
335500 -- (-1250.844) (-1253.083) [-1253.416] (-1255.552) * [-1252.333] (-1249.541) (-1256.931) (-1254.571) -- 0:00:45
336000 -- (-1250.801) [-1251.249] (-1253.571) (-1255.252) * [-1252.026] (-1251.431) (-1255.989) (-1252.154) -- 0:00:45
336500 -- (-1251.516) (-1251.580) (-1254.453) [-1254.575] * [-1252.004] (-1251.940) (-1255.513) (-1252.325) -- 0:00:45
337000 -- (-1254.458) (-1253.405) (-1254.423) [-1251.533] * (-1251.916) (-1250.790) (-1253.577) [-1252.963] -- 0:00:45
337500 -- (-1253.588) [-1251.250] (-1253.087) (-1252.113) * (-1251.220) (-1249.927) (-1251.836) [-1253.969] -- 0:00:45
338000 -- (-1253.880) (-1251.373) [-1253.380] (-1252.966) * (-1252.183) (-1252.183) [-1252.052] (-1252.702) -- 0:00:45
338500 -- [-1252.155] (-1252.899) (-1256.427) (-1252.608) * (-1256.133) (-1252.207) [-1253.536] (-1253.292) -- 0:00:44
339000 -- (-1251.419) (-1251.991) (-1253.429) [-1255.673] * (-1252.612) (-1252.135) (-1253.200) [-1252.489] -- 0:00:44
339500 -- (-1252.695) [-1253.525] (-1252.314) (-1255.784) * (-1254.558) [-1249.739] (-1253.210) (-1253.497) -- 0:00:44
340000 -- (-1253.614) [-1251.038] (-1252.492) (-1253.327) * (-1252.849) (-1251.666) (-1252.771) [-1252.384] -- 0:00:44
Average standard deviation of split frequencies: 0.012838
340500 -- (-1254.656) (-1251.805) (-1251.264) [-1253.317] * (-1251.837) [-1252.821] (-1252.224) (-1253.086) -- 0:00:44
341000 -- (-1250.948) (-1255.800) (-1251.059) [-1252.104] * [-1253.103] (-1253.425) (-1253.347) (-1252.633) -- 0:00:44
341500 -- [-1251.681] (-1255.378) (-1251.049) (-1252.257) * (-1254.565) [-1253.497] (-1253.226) (-1252.695) -- 0:00:44
342000 -- (-1250.885) (-1256.452) (-1250.078) [-1251.894] * [-1253.759] (-1253.751) (-1252.541) (-1255.113) -- 0:00:44
342500 -- (-1252.485) (-1256.131) [-1250.927] (-1251.583) * (-1254.576) [-1254.610] (-1253.355) (-1252.819) -- 0:00:44
343000 -- (-1253.852) (-1253.300) (-1252.588) [-1251.208] * (-1253.230) (-1251.203) (-1256.126) [-1251.746] -- 0:00:44
343500 -- (-1252.574) (-1254.795) (-1250.922) [-1252.806] * [-1253.484] (-1253.603) (-1252.611) (-1254.190) -- 0:00:43
344000 -- (-1253.520) (-1254.827) [-1251.390] (-1255.937) * (-1251.811) (-1251.538) (-1253.124) [-1253.518] -- 0:00:43
344500 -- (-1253.736) (-1251.581) [-1252.700] (-1256.261) * (-1254.096) (-1251.435) (-1250.605) [-1250.265] -- 0:00:43
345000 -- [-1254.906] (-1255.635) (-1250.788) (-1252.157) * (-1254.670) [-1251.594] (-1250.209) (-1252.556) -- 0:00:43
Average standard deviation of split frequencies: 0.012764
345500 -- (-1252.493) (-1254.435) [-1252.877] (-1253.380) * (-1252.603) (-1254.376) (-1249.601) [-1250.671] -- 0:00:43
346000 -- [-1250.645] (-1252.817) (-1251.029) (-1252.534) * (-1253.451) [-1252.561] (-1251.225) (-1251.428) -- 0:00:43
346500 -- (-1250.433) (-1252.004) [-1252.302] (-1252.212) * [-1250.780] (-1251.613) (-1255.112) (-1254.813) -- 0:00:43
347000 -- (-1250.359) (-1251.965) (-1257.585) [-1250.914] * [-1254.566] (-1254.931) (-1256.160) (-1257.657) -- 0:00:43
347500 -- (-1250.482) (-1253.708) (-1253.796) [-1249.629] * [-1254.895] (-1256.700) (-1254.733) (-1252.486) -- 0:00:43
348000 -- (-1254.244) [-1250.514] (-1255.959) (-1254.850) * (-1254.716) [-1253.617] (-1251.461) (-1248.944) -- 0:00:44
348500 -- (-1252.066) (-1251.862) (-1253.428) [-1253.289] * (-1253.797) (-1251.447) [-1253.311] (-1253.750) -- 0:00:44
349000 -- (-1251.469) (-1253.545) (-1254.053) [-1250.653] * (-1254.345) [-1253.712] (-1252.650) (-1252.278) -- 0:00:44
349500 -- (-1253.357) (-1255.872) [-1249.585] (-1252.859) * (-1253.926) (-1253.495) [-1250.660] (-1251.181) -- 0:00:44
350000 -- [-1257.876] (-1254.343) (-1252.710) (-1249.899) * (-1258.296) (-1252.728) (-1252.062) [-1251.178] -- 0:00:44
Average standard deviation of split frequencies: 0.011957
350500 -- (-1254.591) (-1252.169) [-1257.287] (-1253.633) * (-1253.135) [-1253.881] (-1253.378) (-1256.070) -- 0:00:44
351000 -- (-1252.061) (-1254.525) [-1251.837] (-1251.734) * (-1253.455) (-1252.282) (-1254.609) [-1252.239] -- 0:00:44
351500 -- (-1255.939) (-1252.646) [-1252.708] (-1250.161) * (-1253.999) (-1253.804) [-1256.041] (-1253.298) -- 0:00:44
352000 -- (-1252.562) (-1254.226) [-1252.144] (-1252.595) * (-1256.340) [-1255.713] (-1257.517) (-1253.490) -- 0:00:44
352500 -- (-1250.115) (-1254.994) (-1253.287) [-1252.939] * (-1254.346) (-1251.445) (-1253.718) [-1250.067] -- 0:00:44
353000 -- [-1251.435] (-1253.123) (-1255.009) (-1251.166) * [-1251.135] (-1250.769) (-1253.246) (-1252.529) -- 0:00:43
353500 -- (-1251.016) [-1250.207] (-1255.524) (-1258.098) * [-1252.682] (-1251.780) (-1252.559) (-1249.697) -- 0:00:43
354000 -- (-1252.168) [-1250.644] (-1252.616) (-1253.517) * (-1251.947) (-1254.300) [-1253.543] (-1250.705) -- 0:00:43
354500 -- (-1252.722) (-1252.139) (-1251.662) [-1252.747] * (-1253.490) [-1252.349] (-1251.734) (-1253.115) -- 0:00:43
355000 -- [-1257.756] (-1252.507) (-1257.217) (-1250.718) * (-1251.706) [-1251.320] (-1254.335) (-1252.451) -- 0:00:43
Average standard deviation of split frequencies: 0.012359
355500 -- [-1254.731] (-1253.767) (-1253.573) (-1253.228) * [-1251.201] (-1251.758) (-1252.768) (-1253.908) -- 0:00:43
356000 -- (-1255.853) (-1253.053) [-1252.252] (-1251.898) * [-1255.406] (-1255.053) (-1253.474) (-1253.522) -- 0:00:43
356500 -- [-1252.593] (-1254.042) (-1253.038) (-1253.398) * (-1254.664) (-1253.493) [-1252.494] (-1254.564) -- 0:00:43
357000 -- [-1252.965] (-1257.337) (-1251.572) (-1249.897) * [-1249.646] (-1255.322) (-1252.561) (-1256.103) -- 0:00:43
357500 -- (-1251.361) [-1250.648] (-1253.130) (-1251.840) * [-1251.421] (-1253.589) (-1253.229) (-1255.520) -- 0:00:43
358000 -- (-1252.693) (-1250.671) [-1252.119] (-1252.734) * (-1251.464) (-1250.402) [-1251.969] (-1252.847) -- 0:00:43
358500 -- [-1253.438] (-1252.648) (-1253.387) (-1251.648) * [-1252.191] (-1251.260) (-1252.248) (-1258.160) -- 0:00:42
359000 -- (-1259.573) (-1252.555) [-1253.960] (-1253.260) * (-1255.383) (-1252.353) (-1256.055) [-1251.428] -- 0:00:42
359500 -- (-1252.120) (-1253.178) [-1255.068] (-1253.379) * [-1253.668] (-1254.656) (-1253.291) (-1251.294) -- 0:00:42
360000 -- (-1249.952) (-1254.532) (-1256.700) [-1253.560] * (-1251.624) (-1251.682) [-1252.753] (-1252.406) -- 0:00:42
Average standard deviation of split frequencies: 0.012993
360500 -- (-1256.246) [-1253.503] (-1252.019) (-1252.589) * (-1250.421) (-1252.742) [-1251.643] (-1253.912) -- 0:00:42
361000 -- (-1254.572) (-1251.543) [-1251.396] (-1253.083) * [-1250.032] (-1251.337) (-1252.357) (-1255.006) -- 0:00:42
361500 -- [-1250.248] (-1250.591) (-1250.400) (-1252.263) * [-1251.230] (-1252.996) (-1252.180) (-1256.029) -- 0:00:42
362000 -- (-1250.354) [-1254.155] (-1253.669) (-1254.078) * [-1254.781] (-1251.740) (-1250.552) (-1252.630) -- 0:00:42
362500 -- [-1250.967] (-1254.098) (-1252.552) (-1252.378) * [-1251.301] (-1252.897) (-1250.911) (-1253.615) -- 0:00:43
363000 -- [-1255.008] (-1252.266) (-1256.948) (-1252.882) * (-1251.093) (-1254.452) [-1252.483] (-1254.713) -- 0:00:43
363500 -- (-1248.536) [-1253.015] (-1255.785) (-1254.144) * (-1249.355) (-1252.811) [-1251.620] (-1253.749) -- 0:00:43
364000 -- [-1253.283] (-1254.247) (-1255.590) (-1251.312) * (-1255.062) (-1252.201) (-1251.352) [-1251.136] -- 0:00:43
364500 -- (-1250.290) (-1253.072) [-1253.410] (-1252.248) * (-1249.727) (-1253.151) [-1251.356] (-1250.312) -- 0:00:43
365000 -- (-1250.609) [-1251.323] (-1255.711) (-1253.019) * (-1250.749) [-1254.681] (-1255.589) (-1251.708) -- 0:00:43
Average standard deviation of split frequencies: 0.012808
365500 -- (-1254.738) (-1252.548) [-1253.534] (-1253.407) * [-1251.580] (-1251.343) (-1254.140) (-1252.465) -- 0:00:43
366000 -- [-1251.424] (-1251.482) (-1251.724) (-1253.581) * (-1255.881) (-1251.972) (-1250.300) [-1251.639] -- 0:00:43
366500 -- [-1255.733] (-1253.179) (-1252.751) (-1254.568) * [-1251.551] (-1256.817) (-1256.463) (-1251.939) -- 0:00:43
367000 -- (-1253.576) (-1254.414) [-1253.297] (-1253.142) * (-1256.123) [-1252.434] (-1256.277) (-1251.521) -- 0:00:43
367500 -- (-1252.490) (-1252.431) [-1248.983] (-1253.231) * (-1254.183) [-1253.136] (-1253.308) (-1253.214) -- 0:00:43
368000 -- (-1252.795) (-1252.152) (-1253.828) [-1254.632] * [-1252.668] (-1253.277) (-1250.300) (-1253.321) -- 0:00:42
368500 -- (-1251.793) [-1253.887] (-1255.604) (-1254.227) * (-1254.272) (-1253.348) (-1250.023) [-1252.038] -- 0:00:42
369000 -- (-1254.486) [-1251.232] (-1253.412) (-1251.918) * (-1255.988) (-1254.345) [-1250.089] (-1251.581) -- 0:00:42
369500 -- (-1253.126) [-1252.913] (-1252.268) (-1254.959) * (-1254.531) (-1254.756) (-1253.028) [-1251.676] -- 0:00:42
370000 -- (-1251.602) [-1252.652] (-1250.936) (-1257.213) * (-1252.190) (-1253.642) (-1252.180) [-1251.281] -- 0:00:42
Average standard deviation of split frequencies: 0.013071
370500 -- (-1253.023) (-1253.595) [-1251.500] (-1252.725) * [-1251.294] (-1257.129) (-1251.639) (-1251.516) -- 0:00:42
371000 -- (-1256.462) [-1253.754] (-1252.226) (-1254.893) * (-1250.047) (-1253.325) [-1252.804] (-1255.601) -- 0:00:42
371500 -- [-1251.444] (-1262.604) (-1249.947) (-1252.886) * (-1248.800) (-1252.700) (-1252.314) [-1251.365] -- 0:00:42
372000 -- (-1252.238) (-1254.350) [-1252.837] (-1253.937) * (-1251.525) [-1252.104] (-1255.614) (-1253.301) -- 0:00:42
372500 -- [-1251.026] (-1254.680) (-1253.743) (-1254.925) * [-1251.435] (-1253.239) (-1252.748) (-1257.551) -- 0:00:42
373000 -- (-1252.836) (-1255.117) [-1251.958] (-1255.005) * (-1250.603) (-1252.996) (-1257.840) [-1253.086] -- 0:00:42
373500 -- (-1255.118) (-1253.567) (-1253.071) [-1254.897] * (-1251.324) [-1250.201] (-1255.591) (-1253.910) -- 0:00:41
374000 -- (-1251.900) [-1251.904] (-1256.061) (-1255.846) * (-1253.390) [-1251.978] (-1254.756) (-1252.043) -- 0:00:41
374500 -- (-1252.589) [-1252.509] (-1251.644) (-1252.146) * (-1254.380) (-1252.997) (-1253.041) [-1251.289] -- 0:00:41
375000 -- (-1251.364) (-1251.586) (-1251.651) [-1251.911] * (-1251.014) [-1253.295] (-1253.241) (-1252.005) -- 0:00:41
Average standard deviation of split frequencies: 0.013373
375500 -- (-1252.527) (-1252.612) (-1251.351) [-1253.216] * (-1253.547) (-1251.727) [-1252.753] (-1252.054) -- 0:00:41
376000 -- (-1255.184) (-1254.898) (-1254.637) [-1253.991] * (-1254.438) [-1251.107] (-1251.648) (-1252.274) -- 0:00:41
376500 -- (-1252.706) [-1253.884] (-1254.099) (-1252.526) * (-1257.109) [-1252.682] (-1255.628) (-1252.785) -- 0:00:41
377000 -- (-1252.761) [-1251.929] (-1255.968) (-1251.350) * (-1250.452) [-1251.640] (-1253.266) (-1254.046) -- 0:00:42
377500 -- (-1252.525) (-1252.883) (-1257.167) [-1251.184] * (-1251.699) (-1252.049) (-1254.225) [-1253.320] -- 0:00:42
378000 -- [-1252.918] (-1255.071) (-1251.475) (-1251.068) * (-1250.695) (-1253.410) (-1253.070) [-1253.051] -- 0:00:42
378500 -- [-1252.821] (-1252.100) (-1255.629) (-1253.242) * (-1251.428) (-1251.167) [-1253.645] (-1251.209) -- 0:00:42
379000 -- [-1253.561] (-1254.085) (-1254.128) (-1254.022) * [-1250.650] (-1251.941) (-1253.666) (-1251.579) -- 0:00:42
379500 -- (-1252.038) (-1254.588) (-1253.271) [-1252.478] * [-1251.828] (-1250.996) (-1254.004) (-1252.696) -- 0:00:42
380000 -- (-1251.901) (-1259.866) [-1255.089] (-1254.315) * [-1253.641] (-1253.738) (-1252.827) (-1253.996) -- 0:00:42
Average standard deviation of split frequencies: 0.012970
380500 -- [-1252.385] (-1256.878) (-1252.721) (-1255.421) * (-1251.366) [-1253.224] (-1254.568) (-1255.232) -- 0:00:42
381000 -- (-1251.673) (-1257.015) (-1252.230) [-1251.776] * (-1249.869) [-1252.774] (-1253.280) (-1254.264) -- 0:00:42
381500 -- (-1259.549) (-1250.836) (-1253.659) [-1251.577] * [-1252.341] (-1255.007) (-1251.524) (-1252.331) -- 0:00:42
382000 -- (-1255.753) (-1252.905) (-1255.239) [-1252.315] * [-1252.124] (-1250.193) (-1251.531) (-1253.596) -- 0:00:42
382500 -- (-1254.608) (-1254.322) (-1256.641) [-1252.634] * (-1258.608) (-1251.538) (-1253.116) [-1252.137] -- 0:00:41
383000 -- (-1256.832) [-1251.984] (-1251.181) (-1252.617) * (-1254.050) [-1251.874] (-1255.269) (-1253.562) -- 0:00:41
383500 -- [-1253.645] (-1252.485) (-1252.445) (-1252.752) * [-1255.683] (-1253.118) (-1255.760) (-1251.918) -- 0:00:41
384000 -- (-1252.554) (-1251.944) (-1250.707) [-1253.145] * [-1252.460] (-1252.896) (-1253.550) (-1251.996) -- 0:00:41
384500 -- (-1256.660) (-1253.980) [-1248.373] (-1252.682) * [-1250.587] (-1256.704) (-1253.512) (-1253.436) -- 0:00:41
385000 -- (-1255.042) (-1253.595) [-1250.127] (-1253.764) * (-1251.844) (-1257.725) [-1250.359] (-1252.834) -- 0:00:41
Average standard deviation of split frequencies: 0.012470
385500 -- (-1252.679) (-1251.821) [-1250.799] (-1252.369) * [-1249.131] (-1255.260) (-1256.937) (-1255.874) -- 0:00:41
386000 -- (-1252.065) (-1252.375) (-1255.211) [-1254.330] * (-1252.863) [-1253.590] (-1254.379) (-1256.262) -- 0:00:41
386500 -- [-1252.762] (-1250.824) (-1254.533) (-1252.153) * (-1257.471) (-1252.669) [-1253.071] (-1255.207) -- 0:00:41
387000 -- (-1258.237) (-1250.488) (-1252.882) [-1251.049] * (-1254.248) (-1253.022) (-1255.323) [-1251.549] -- 0:00:41
387500 -- (-1254.055) (-1251.673) (-1251.719) [-1250.851] * (-1254.049) [-1251.322] (-1251.582) (-1252.562) -- 0:00:41
388000 -- [-1254.602] (-1251.190) (-1251.443) (-1253.603) * (-1253.803) (-1251.630) [-1254.227] (-1252.597) -- 0:00:41
388500 -- [-1253.065] (-1251.954) (-1250.904) (-1254.313) * (-1250.287) [-1254.145] (-1252.073) (-1250.737) -- 0:00:40
389000 -- (-1256.635) (-1253.177) (-1251.459) [-1250.837] * (-1251.064) (-1252.180) (-1252.329) [-1252.318] -- 0:00:40
389500 -- [-1254.402] (-1250.994) (-1251.376) (-1253.023) * [-1251.772] (-1251.495) (-1254.575) (-1251.767) -- 0:00:40
390000 -- (-1252.625) (-1250.475) [-1252.542] (-1253.380) * (-1252.888) (-1253.960) [-1252.689] (-1251.896) -- 0:00:40
Average standard deviation of split frequencies: 0.012765
390500 -- (-1253.201) (-1251.982) [-1250.033] (-1251.967) * (-1250.254) [-1252.873] (-1256.964) (-1256.989) -- 0:00:40
391000 -- (-1255.267) (-1257.748) [-1249.065] (-1254.263) * (-1251.722) [-1251.945] (-1254.517) (-1250.040) -- 0:00:40
391500 -- (-1253.144) (-1252.403) (-1249.200) [-1252.534] * [-1252.119] (-1252.566) (-1252.982) (-1255.895) -- 0:00:40
392000 -- (-1251.415) (-1253.849) [-1249.562] (-1253.499) * (-1252.099) (-1252.635) (-1252.879) [-1250.204] -- 0:00:41
392500 -- (-1252.285) (-1257.343) [-1250.448] (-1252.797) * (-1253.403) (-1251.897) [-1253.476] (-1250.642) -- 0:00:41
393000 -- (-1253.575) (-1254.084) (-1251.831) [-1253.517] * (-1251.151) [-1252.792] (-1253.089) (-1249.336) -- 0:00:41
393500 -- [-1253.654] (-1251.912) (-1254.413) (-1251.330) * [-1250.909] (-1250.509) (-1252.806) (-1253.664) -- 0:00:41
394000 -- (-1255.551) (-1250.783) (-1251.234) [-1255.193] * [-1250.091] (-1252.852) (-1255.133) (-1250.968) -- 0:00:41
394500 -- [-1253.380] (-1257.938) (-1251.398) (-1254.148) * (-1251.397) (-1252.717) (-1252.492) [-1250.182] -- 0:00:41
395000 -- (-1254.344) (-1254.030) (-1254.595) [-1251.996] * [-1251.553] (-1256.573) (-1260.754) (-1250.102) -- 0:00:41
Average standard deviation of split frequencies: 0.013157
395500 -- (-1252.083) [-1256.801] (-1251.409) (-1254.195) * (-1253.301) [-1254.159] (-1254.463) (-1252.448) -- 0:00:41
396000 -- (-1251.012) (-1252.995) [-1251.535] (-1252.600) * [-1252.579] (-1252.824) (-1251.566) (-1254.853) -- 0:00:41
396500 -- (-1252.995) (-1253.162) [-1251.749] (-1252.923) * (-1253.269) (-1251.740) (-1253.870) [-1254.165] -- 0:00:41
397000 -- [-1252.411] (-1250.558) (-1253.162) (-1252.307) * [-1252.888] (-1256.733) (-1254.234) (-1254.765) -- 0:00:41
397500 -- (-1252.930) [-1251.767] (-1255.341) (-1252.472) * [-1249.906] (-1253.242) (-1252.504) (-1252.305) -- 0:00:40
398000 -- (-1253.560) (-1251.753) (-1251.806) [-1252.621] * (-1252.092) (-1253.977) (-1252.848) [-1251.136] -- 0:00:40
398500 -- (-1254.958) [-1254.660] (-1252.092) (-1252.668) * (-1250.916) [-1252.979] (-1257.083) (-1251.760) -- 0:00:40
399000 -- [-1251.911] (-1254.156) (-1252.048) (-1252.769) * (-1250.718) [-1252.338] (-1254.093) (-1252.974) -- 0:00:40
399500 -- (-1255.183) [-1252.299] (-1252.258) (-1251.515) * (-1250.229) (-1254.621) (-1255.319) [-1254.142] -- 0:00:40
400000 -- (-1255.987) [-1252.669] (-1253.941) (-1253.327) * (-1252.162) [-1254.034] (-1251.902) (-1251.610) -- 0:00:40
Average standard deviation of split frequencies: 0.013465
400500 -- (-1252.706) (-1252.918) [-1252.196] (-1256.593) * (-1253.425) (-1254.892) (-1252.324) [-1252.949] -- 0:00:40
401000 -- (-1252.899) (-1253.011) (-1252.159) [-1252.908] * (-1252.765) (-1254.123) [-1251.754] (-1256.068) -- 0:00:40
401500 -- (-1252.942) [-1252.252] (-1250.578) (-1250.967) * (-1250.236) (-1255.590) (-1251.948) [-1255.898] -- 0:00:40
402000 -- (-1252.882) [-1256.455] (-1254.383) (-1251.496) * (-1251.999) (-1251.851) [-1253.436] (-1252.896) -- 0:00:40
402500 -- (-1254.825) [-1251.990] (-1251.694) (-1257.615) * (-1250.913) (-1252.124) [-1252.342] (-1254.628) -- 0:00:40
403000 -- (-1251.578) (-1250.566) (-1252.881) [-1251.269] * [-1252.258] (-1255.319) (-1256.322) (-1254.905) -- 0:00:39
403500 -- [-1250.961] (-1251.682) (-1254.503) (-1252.391) * (-1250.262) [-1253.641] (-1257.855) (-1256.147) -- 0:00:39
404000 -- (-1251.853) [-1253.958] (-1252.308) (-1252.401) * (-1250.320) [-1251.752] (-1253.079) (-1252.271) -- 0:00:39
404500 -- [-1252.461] (-1251.802) (-1254.183) (-1251.289) * (-1252.377) (-1251.768) (-1253.778) [-1251.174] -- 0:00:39
405000 -- (-1252.060) (-1249.706) [-1254.453] (-1251.377) * (-1252.389) [-1251.589] (-1253.296) (-1251.310) -- 0:00:39
Average standard deviation of split frequencies: 0.012837
405500 -- (-1257.206) (-1253.486) (-1252.577) [-1252.035] * (-1253.238) (-1252.205) [-1253.721] (-1251.912) -- 0:00:39
406000 -- (-1253.832) (-1255.479) [-1253.166] (-1251.771) * [-1251.657] (-1252.974) (-1253.844) (-1251.890) -- 0:00:39
406500 -- (-1254.886) (-1251.344) (-1253.546) [-1249.447] * (-1255.343) (-1254.287) (-1254.179) [-1254.534] -- 0:00:39
407000 -- (-1255.458) (-1254.301) (-1254.483) [-1251.964] * [-1253.412] (-1253.529) (-1252.932) (-1251.856) -- 0:00:40
407500 -- (-1256.497) (-1252.171) (-1254.177) [-1251.949] * (-1253.779) [-1251.320] (-1256.485) (-1252.111) -- 0:00:40
408000 -- [-1252.796] (-1251.655) (-1251.291) (-1251.850) * (-1253.153) (-1251.756) [-1252.888] (-1252.449) -- 0:00:40
408500 -- (-1252.653) (-1254.499) (-1251.746) [-1252.489] * [-1251.388] (-1252.845) (-1253.820) (-1254.478) -- 0:00:40
409000 -- (-1252.635) (-1254.172) (-1252.673) [-1250.618] * (-1253.123) [-1251.058] (-1253.940) (-1251.417) -- 0:00:40
409500 -- (-1252.139) (-1253.515) (-1252.987) [-1257.472] * [-1251.065] (-1252.106) (-1253.260) (-1252.461) -- 0:00:40
410000 -- (-1253.898) (-1255.630) [-1254.817] (-1253.109) * (-1251.768) [-1252.247] (-1255.449) (-1253.702) -- 0:00:40
Average standard deviation of split frequencies: 0.012053
410500 -- (-1253.357) [-1253.508] (-1251.202) (-1256.968) * [-1252.643] (-1253.134) (-1252.108) (-1253.620) -- 0:00:40
411000 -- [-1252.008] (-1251.845) (-1254.242) (-1252.695) * [-1252.387] (-1255.309) (-1252.440) (-1256.273) -- 0:00:40
411500 -- (-1251.943) (-1255.110) (-1257.262) [-1252.009] * (-1252.345) (-1251.847) (-1254.614) [-1252.261] -- 0:00:40
412000 -- [-1250.740] (-1251.648) (-1252.879) (-1254.623) * (-1254.450) [-1251.763] (-1251.944) (-1250.943) -- 0:00:39
412500 -- (-1254.056) (-1253.613) (-1252.307) [-1257.269] * (-1254.527) [-1253.052] (-1252.882) (-1254.575) -- 0:00:39
413000 -- (-1252.983) [-1256.322] (-1251.720) (-1251.434) * (-1254.086) [-1258.030] (-1252.960) (-1253.716) -- 0:00:39
413500 -- (-1253.513) (-1253.771) [-1253.283] (-1252.053) * (-1252.430) (-1257.316) (-1252.867) [-1252.848] -- 0:00:39
414000 -- (-1253.157) [-1253.857] (-1253.331) (-1253.432) * (-1254.513) (-1251.509) (-1250.987) [-1252.841] -- 0:00:39
414500 -- (-1254.295) [-1251.839] (-1253.383) (-1251.152) * (-1256.093) (-1250.446) (-1252.679) [-1253.057] -- 0:00:39
415000 -- (-1254.373) (-1253.576) (-1251.603) [-1253.349] * (-1252.024) (-1252.534) [-1252.167] (-1252.719) -- 0:00:39
Average standard deviation of split frequencies: 0.011080
415500 -- (-1254.017) (-1255.460) [-1252.294] (-1254.590) * (-1253.961) [-1255.074] (-1252.667) (-1252.342) -- 0:00:39
416000 -- (-1252.787) (-1254.987) (-1255.254) [-1252.565] * [-1251.045] (-1254.813) (-1252.714) (-1252.160) -- 0:00:39
416500 -- (-1253.384) (-1251.824) (-1255.529) [-1254.162] * (-1253.360) (-1252.589) (-1253.190) [-1254.974] -- 0:00:39
417000 -- (-1252.206) (-1251.464) (-1251.745) [-1255.292] * (-1256.526) [-1252.017] (-1252.537) (-1254.679) -- 0:00:39
417500 -- (-1251.271) (-1251.485) (-1254.225) [-1253.194] * (-1252.731) (-1251.058) (-1253.665) [-1254.764] -- 0:00:39
418000 -- (-1257.302) (-1254.577) (-1256.893) [-1249.709] * [-1252.312] (-1252.408) (-1252.839) (-1255.881) -- 0:00:38
418500 -- (-1252.069) [-1254.728] (-1258.432) (-1252.528) * (-1257.803) (-1255.821) [-1252.879] (-1253.761) -- 0:00:38
419000 -- (-1251.985) (-1252.051) [-1257.747] (-1251.233) * (-1249.870) (-1251.470) (-1254.112) [-1250.026] -- 0:00:38
419500 -- (-1255.431) (-1256.102) [-1253.180] (-1254.436) * (-1250.676) (-1251.725) [-1252.782] (-1252.504) -- 0:00:38
420000 -- (-1252.969) (-1254.641) (-1253.821) [-1250.225] * (-1252.628) [-1254.227] (-1252.429) (-1253.381) -- 0:00:38
Average standard deviation of split frequencies: 0.011019
420500 -- (-1255.704) [-1254.618] (-1252.413) (-1254.178) * [-1252.534] (-1253.591) (-1251.720) (-1252.485) -- 0:00:38
421000 -- (-1251.574) (-1251.937) (-1251.963) [-1255.053] * [-1257.762] (-1254.430) (-1253.137) (-1252.048) -- 0:00:38
421500 -- [-1251.753] (-1252.402) (-1251.942) (-1259.796) * (-1251.983) [-1254.436] (-1255.757) (-1254.429) -- 0:00:39
422000 -- (-1252.846) (-1252.788) (-1251.990) [-1251.868] * (-1252.757) (-1251.672) [-1250.815] (-1254.737) -- 0:00:39
422500 -- (-1252.190) (-1252.162) (-1253.848) [-1253.042] * [-1254.205] (-1251.764) (-1254.144) (-1253.103) -- 0:00:39
423000 -- (-1252.070) (-1253.663) [-1250.997] (-1250.828) * [-1254.026] (-1251.506) (-1250.955) (-1256.417) -- 0:00:39
423500 -- (-1254.452) (-1252.106) [-1250.699] (-1251.658) * [-1251.772] (-1252.988) (-1254.173) (-1255.381) -- 0:00:39
424000 -- [-1252.558] (-1253.337) (-1253.979) (-1251.607) * (-1255.659) (-1252.095) [-1255.051] (-1252.770) -- 0:00:39
424500 -- (-1251.906) (-1250.594) (-1253.217) [-1254.340] * (-1256.863) (-1251.856) (-1254.041) [-1251.555] -- 0:00:39
425000 -- (-1252.666) (-1253.931) [-1253.218] (-1255.548) * [-1251.584] (-1251.952) (-1252.378) (-1252.585) -- 0:00:39
Average standard deviation of split frequencies: 0.010697
425500 -- [-1253.480] (-1254.502) (-1253.563) (-1252.038) * [-1253.040] (-1253.148) (-1253.362) (-1250.875) -- 0:00:39
426000 -- (-1250.786) [-1252.535] (-1250.685) (-1250.885) * (-1254.728) (-1250.445) (-1252.845) [-1252.352] -- 0:00:39
426500 -- (-1253.485) (-1255.217) [-1251.320] (-1251.972) * (-1254.970) (-1251.834) [-1252.138] (-1254.290) -- 0:00:38
427000 -- (-1257.228) (-1255.675) (-1251.905) [-1251.760] * (-1255.081) (-1253.857) [-1252.821] (-1254.289) -- 0:00:38
427500 -- (-1260.364) (-1255.122) [-1253.242] (-1252.395) * (-1253.525) [-1250.201] (-1253.294) (-1255.914) -- 0:00:38
428000 -- (-1255.981) (-1253.103) (-1251.955) [-1250.962] * [-1257.165] (-1252.717) (-1251.989) (-1254.804) -- 0:00:38
428500 -- (-1256.318) (-1255.148) (-1250.970) [-1250.557] * (-1252.639) (-1253.280) [-1251.042] (-1251.890) -- 0:00:38
429000 -- (-1255.922) (-1256.499) (-1252.353) [-1250.833] * (-1252.033) (-1256.264) [-1253.630] (-1251.800) -- 0:00:38
429500 -- (-1252.380) [-1251.250] (-1256.857) (-1250.668) * (-1251.796) (-1258.007) [-1254.421] (-1251.747) -- 0:00:38
430000 -- (-1251.737) (-1254.334) (-1255.218) [-1252.268] * (-1254.494) (-1256.631) (-1252.921) [-1253.917] -- 0:00:38
Average standard deviation of split frequencies: 0.010399
430500 -- (-1252.188) (-1251.345) [-1250.737] (-1251.207) * (-1254.321) [-1253.965] (-1254.668) (-1252.347) -- 0:00:38
431000 -- [-1253.100] (-1254.558) (-1252.709) (-1252.472) * (-1254.093) (-1251.306) [-1251.577] (-1252.051) -- 0:00:38
431500 -- (-1256.113) [-1254.500] (-1252.657) (-1252.388) * (-1253.470) [-1251.819] (-1251.409) (-1253.059) -- 0:00:38
432000 -- (-1254.075) [-1252.728] (-1253.112) (-1252.804) * (-1253.134) (-1252.405) (-1256.674) [-1252.889] -- 0:00:38
432500 -- (-1254.571) (-1253.183) (-1251.088) [-1250.877] * (-1256.834) [-1251.834] (-1249.645) (-1252.219) -- 0:00:38
433000 -- (-1252.266) [-1253.055] (-1254.759) (-1259.297) * (-1254.618) (-1249.723) (-1256.398) [-1253.413] -- 0:00:37
433500 -- [-1250.539] (-1254.394) (-1249.393) (-1259.574) * (-1252.110) (-1253.253) [-1251.804] (-1255.424) -- 0:00:37
434000 -- (-1255.748) [-1258.488] (-1251.280) (-1259.373) * (-1251.746) (-1254.953) (-1254.743) [-1253.020] -- 0:00:37
434500 -- [-1252.703] (-1253.840) (-1258.223) (-1252.221) * [-1254.134] (-1253.506) (-1253.233) (-1251.927) -- 0:00:37
435000 -- (-1251.687) (-1253.807) (-1253.436) [-1252.163] * (-1252.344) (-1252.486) [-1252.108] (-1255.605) -- 0:00:37
Average standard deviation of split frequencies: 0.009731
435500 -- [-1254.083] (-1252.523) (-1258.690) (-1255.124) * (-1253.092) (-1251.947) (-1251.295) [-1252.201] -- 0:00:37
436000 -- (-1254.620) (-1256.627) [-1255.049] (-1251.911) * [-1251.753] (-1252.113) (-1253.938) (-1255.001) -- 0:00:38
436500 -- (-1256.028) (-1256.007) (-1254.442) [-1251.786] * (-1251.078) (-1253.214) (-1252.262) [-1252.679] -- 0:00:38
437000 -- (-1254.783) [-1252.333] (-1253.940) (-1251.132) * [-1251.573] (-1253.138) (-1253.617) (-1250.248) -- 0:00:38
437500 -- (-1252.742) (-1249.913) (-1250.073) [-1252.501] * (-1254.229) (-1252.464) [-1252.494] (-1253.101) -- 0:00:38
438000 -- (-1252.037) (-1251.739) (-1251.801) [-1250.592] * (-1253.294) [-1252.577] (-1252.740) (-1256.779) -- 0:00:38
438500 -- (-1250.703) (-1255.141) (-1254.583) [-1253.590] * (-1252.966) (-1252.947) (-1251.315) [-1251.157] -- 0:00:38
439000 -- (-1252.893) [-1251.582] (-1252.313) (-1252.079) * (-1253.404) [-1251.317] (-1251.728) (-1251.154) -- 0:00:38
439500 -- [-1251.961] (-1252.018) (-1252.864) (-1252.841) * (-1256.581) (-1253.555) (-1250.539) [-1250.834] -- 0:00:38
440000 -- (-1253.131) (-1252.625) [-1252.903] (-1254.540) * (-1256.503) [-1250.174] (-1254.789) (-1254.301) -- 0:00:38
Average standard deviation of split frequencies: 0.009942
440500 -- (-1254.363) (-1258.170) (-1252.944) [-1254.385] * [-1252.614] (-1251.529) (-1252.101) (-1253.109) -- 0:00:38
441000 -- (-1253.178) (-1253.740) (-1253.458) [-1251.320] * (-1253.016) [-1251.456] (-1254.772) (-1252.896) -- 0:00:38
441500 -- (-1252.544) [-1255.626] (-1250.128) (-1253.715) * [-1253.314] (-1253.631) (-1255.657) (-1252.695) -- 0:00:37
442000 -- (-1253.674) (-1254.692) (-1253.499) [-1254.076] * [-1252.694] (-1251.732) (-1255.653) (-1252.837) -- 0:00:37
442500 -- (-1254.141) (-1254.705) [-1251.908] (-1254.083) * (-1253.932) [-1251.831] (-1255.164) (-1252.244) -- 0:00:37
443000 -- [-1251.841] (-1255.094) (-1251.277) (-1251.836) * (-1251.552) (-1250.517) [-1252.513] (-1253.872) -- 0:00:37
443500 -- (-1251.445) (-1252.891) [-1251.248] (-1252.589) * (-1251.977) [-1253.089] (-1251.019) (-1254.055) -- 0:00:37
444000 -- (-1251.533) (-1256.033) [-1251.102] (-1251.910) * (-1253.485) (-1253.288) [-1251.060] (-1253.353) -- 0:00:37
444500 -- (-1255.029) [-1255.551] (-1251.141) (-1254.454) * (-1254.436) (-1254.166) (-1250.840) [-1251.981] -- 0:00:37
445000 -- (-1250.765) (-1253.468) (-1253.191) [-1250.976] * (-1252.601) (-1256.485) (-1252.722) [-1252.112] -- 0:00:37
Average standard deviation of split frequencies: 0.011005
445500 -- (-1250.810) (-1251.665) (-1252.997) [-1252.815] * (-1252.218) [-1253.009] (-1251.857) (-1252.276) -- 0:00:37
446000 -- [-1250.546] (-1251.715) (-1254.954) (-1250.344) * (-1252.728) [-1255.770] (-1254.851) (-1250.920) -- 0:00:37
446500 -- (-1255.036) (-1254.615) (-1253.440) [-1253.064] * (-1255.091) [-1252.008] (-1254.350) (-1254.598) -- 0:00:37
447000 -- (-1256.169) (-1253.712) [-1253.557] (-1252.593) * [-1254.651] (-1252.615) (-1252.526) (-1252.035) -- 0:00:37
447500 -- (-1251.803) (-1251.869) [-1254.766] (-1252.891) * (-1253.905) (-1252.437) [-1252.954] (-1251.912) -- 0:00:37
448000 -- (-1253.097) (-1253.986) [-1258.795] (-1261.891) * (-1253.531) [-1252.661] (-1253.770) (-1251.405) -- 0:00:36
448500 -- (-1251.614) [-1252.049] (-1254.667) (-1254.699) * (-1255.389) (-1254.485) [-1249.950] (-1250.913) -- 0:00:36
449000 -- (-1251.727) (-1255.407) (-1252.860) [-1250.339] * [-1254.947] (-1256.028) (-1251.950) (-1255.653) -- 0:00:36
449500 -- (-1254.066) (-1251.945) [-1250.964] (-1250.918) * (-1253.099) [-1251.569] (-1251.059) (-1254.726) -- 0:00:36
450000 -- [-1253.183] (-1254.289) (-1251.899) (-1251.379) * (-1251.112) [-1253.567] (-1252.524) (-1253.544) -- 0:00:36
Average standard deviation of split frequencies: 0.011137
450500 -- (-1252.630) (-1253.931) [-1251.792] (-1250.847) * (-1251.064) [-1252.534] (-1250.814) (-1254.024) -- 0:00:36
451000 -- (-1252.287) (-1255.805) (-1253.397) [-1249.628] * (-1253.133) (-1252.669) [-1252.664] (-1251.745) -- 0:00:37
451500 -- (-1253.312) (-1256.231) [-1250.772] (-1255.518) * [-1252.709] (-1254.362) (-1252.569) (-1252.676) -- 0:00:37
452000 -- (-1253.730) [-1252.402] (-1250.729) (-1251.982) * [-1253.427] (-1251.843) (-1251.651) (-1252.262) -- 0:00:37
452500 -- (-1254.858) (-1256.474) [-1252.491] (-1251.967) * (-1250.584) [-1251.949] (-1251.341) (-1253.088) -- 0:00:37
453000 -- (-1252.822) (-1253.724) (-1253.864) [-1255.699] * [-1253.617] (-1255.193) (-1251.968) (-1251.348) -- 0:00:37
453500 -- (-1251.441) (-1255.288) [-1253.341] (-1258.164) * (-1251.403) (-1253.336) [-1251.116] (-1250.517) -- 0:00:37
454000 -- (-1252.332) (-1253.679) (-1250.875) [-1252.570] * (-1255.572) (-1254.872) (-1253.469) [-1253.069] -- 0:00:37
454500 -- (-1253.295) (-1254.456) (-1252.735) [-1253.565] * [-1253.017] (-1257.444) (-1252.097) (-1252.793) -- 0:00:37
455000 -- (-1253.677) (-1252.124) [-1253.885] (-1252.212) * (-1251.376) [-1254.857] (-1250.243) (-1249.596) -- 0:00:37
Average standard deviation of split frequencies: 0.011128
455500 -- (-1256.907) (-1256.424) (-1252.155) [-1252.456] * [-1249.948] (-1253.354) (-1255.172) (-1251.503) -- 0:00:37
456000 -- (-1252.782) [-1254.313] (-1251.398) (-1252.435) * (-1254.030) (-1251.588) (-1253.521) [-1252.903] -- 0:00:36
456500 -- [-1252.478] (-1251.290) (-1251.976) (-1252.372) * (-1251.482) [-1251.910] (-1258.215) (-1255.296) -- 0:00:36
457000 -- (-1252.024) (-1254.084) [-1251.437] (-1252.975) * (-1254.041) [-1251.719] (-1254.053) (-1255.074) -- 0:00:36
457500 -- (-1252.893) [-1253.160] (-1254.036) (-1251.067) * (-1252.694) (-1252.818) (-1253.372) [-1252.721] -- 0:00:36
458000 -- (-1253.533) (-1253.650) (-1253.338) [-1250.786] * (-1252.781) (-1258.335) (-1251.378) [-1255.003] -- 0:00:36
458500 -- (-1252.136) (-1253.306) (-1257.753) [-1250.838] * (-1256.607) (-1252.585) (-1250.692) [-1253.343] -- 0:00:36
459000 -- [-1252.978] (-1254.243) (-1257.483) (-1251.866) * (-1253.866) (-1252.871) [-1250.748] (-1251.688) -- 0:00:36
459500 -- [-1250.762] (-1255.319) (-1254.629) (-1256.914) * (-1253.238) (-1252.642) [-1250.535] (-1253.970) -- 0:00:36
460000 -- (-1250.878) (-1254.671) (-1259.397) [-1253.788] * (-1253.157) (-1252.075) (-1250.247) [-1250.358] -- 0:00:36
Average standard deviation of split frequencies: 0.010775
460500 -- (-1251.715) [-1253.140] (-1254.326) (-1250.753) * [-1252.389] (-1251.869) (-1252.248) (-1255.146) -- 0:00:36
461000 -- (-1251.869) (-1251.857) (-1256.006) [-1253.955] * (-1254.092) [-1253.140] (-1251.698) (-1253.539) -- 0:00:36
461500 -- (-1252.414) [-1252.720] (-1257.960) (-1255.216) * [-1252.360] (-1251.365) (-1257.348) (-1250.042) -- 0:00:36
462000 -- (-1254.082) (-1254.934) (-1252.976) [-1251.618] * [-1251.060] (-1252.418) (-1253.267) (-1251.363) -- 0:00:36
462500 -- (-1255.064) (-1254.755) (-1255.832) [-1251.244] * (-1253.441) (-1252.715) (-1250.272) [-1253.683] -- 0:00:36
463000 -- [-1254.314] (-1253.380) (-1255.298) (-1253.409) * (-1255.886) [-1251.109] (-1251.734) (-1251.840) -- 0:00:35
463500 -- (-1252.374) (-1252.017) (-1254.238) [-1252.982] * (-1254.622) (-1252.782) (-1253.850) [-1255.100] -- 0:00:35
464000 -- (-1252.242) [-1250.726] (-1258.464) (-1251.638) * (-1252.455) (-1251.915) [-1252.509] (-1254.718) -- 0:00:35
464500 -- (-1250.762) (-1253.087) (-1255.082) [-1250.883] * [-1251.699] (-1253.062) (-1253.065) (-1257.348) -- 0:00:35
465000 -- [-1250.771] (-1253.235) (-1254.737) (-1255.962) * (-1250.771) (-1252.309) [-1250.822] (-1254.220) -- 0:00:35
Average standard deviation of split frequencies: 0.009997
465500 -- (-1249.585) (-1258.331) [-1251.168] (-1250.601) * (-1250.834) (-1252.151) (-1251.933) [-1253.714] -- 0:00:36
466000 -- (-1254.247) (-1252.039) [-1252.392] (-1256.967) * (-1257.572) (-1251.479) (-1250.710) [-1252.088] -- 0:00:36
466500 -- (-1250.442) (-1250.343) [-1252.818] (-1250.441) * (-1253.868) (-1254.694) (-1251.078) [-1252.713] -- 0:00:36
467000 -- (-1252.214) (-1250.837) [-1254.493] (-1252.729) * (-1255.687) (-1252.866) (-1253.220) [-1252.535] -- 0:00:36
467500 -- (-1251.398) (-1250.991) [-1255.166] (-1250.634) * (-1252.106) (-1254.733) (-1257.961) [-1252.576] -- 0:00:36
468000 -- (-1252.916) (-1253.326) [-1251.069] (-1250.845) * (-1254.445) [-1253.664] (-1250.541) (-1254.423) -- 0:00:36
468500 -- (-1255.928) (-1253.011) (-1251.817) [-1251.363] * (-1252.285) (-1251.829) [-1250.422] (-1254.497) -- 0:00:36
469000 -- [-1250.131] (-1255.317) (-1250.487) (-1251.906) * [-1252.108] (-1251.878) (-1252.040) (-1252.631) -- 0:00:36
469500 -- (-1252.248) (-1255.472) (-1251.978) [-1252.081] * (-1250.734) [-1253.969] (-1251.924) (-1253.774) -- 0:00:36
470000 -- (-1253.982) (-1252.098) (-1250.649) [-1249.439] * [-1252.932] (-1252.670) (-1252.709) (-1255.160) -- 0:00:36
Average standard deviation of split frequencies: 0.009544
470500 -- (-1253.436) (-1252.432) [-1251.871] (-1252.266) * (-1250.778) [-1250.696] (-1253.560) (-1251.656) -- 0:00:36
471000 -- [-1251.927] (-1253.260) (-1251.901) (-1250.143) * (-1253.049) (-1255.980) [-1252.650] (-1251.740) -- 0:00:35
471500 -- (-1253.510) (-1252.671) (-1252.060) [-1250.135] * (-1253.620) (-1253.669) [-1253.106] (-1250.264) -- 0:00:35
472000 -- (-1251.408) (-1253.966) [-1253.565] (-1253.678) * (-1252.964) [-1254.048] (-1255.675) (-1251.583) -- 0:00:35
472500 -- (-1251.678) (-1254.702) [-1253.198] (-1255.229) * (-1253.490) (-1254.675) (-1256.288) [-1250.520] -- 0:00:35
473000 -- [-1251.069] (-1251.158) (-1253.681) (-1251.002) * (-1253.522) (-1252.887) (-1253.773) [-1253.007] -- 0:00:35
473500 -- (-1252.289) (-1253.002) (-1253.640) [-1254.966] * [-1254.788] (-1254.274) (-1253.940) (-1251.418) -- 0:00:35
474000 -- (-1251.253) (-1252.734) [-1250.932] (-1254.030) * [-1253.876] (-1252.595) (-1251.955) (-1250.662) -- 0:00:35
474500 -- [-1250.126] (-1251.995) (-1252.289) (-1254.173) * (-1254.321) (-1257.970) (-1252.700) [-1254.038] -- 0:00:35
475000 -- (-1253.613) [-1250.514] (-1254.338) (-1252.866) * [-1250.654] (-1253.306) (-1253.795) (-1252.343) -- 0:00:35
Average standard deviation of split frequencies: 0.009903
475500 -- (-1252.052) [-1251.686] (-1251.286) (-1257.784) * (-1251.543) [-1252.401] (-1254.180) (-1252.411) -- 0:00:35
476000 -- (-1252.525) [-1253.526] (-1257.083) (-1252.771) * [-1251.092] (-1251.525) (-1253.038) (-1255.633) -- 0:00:35
476500 -- (-1253.592) (-1254.358) (-1253.364) [-1252.004] * (-1251.962) (-1250.595) [-1250.690] (-1251.546) -- 0:00:35
477000 -- (-1255.840) (-1255.114) [-1251.417] (-1252.876) * (-1256.697) [-1252.387] (-1251.705) (-1251.843) -- 0:00:35
477500 -- (-1258.279) [-1251.015] (-1261.415) (-1260.422) * (-1252.856) (-1253.810) [-1253.359] (-1254.833) -- 0:00:35
478000 -- (-1254.265) [-1252.036] (-1260.094) (-1257.580) * (-1254.834) (-1251.736) (-1251.291) [-1253.022] -- 0:00:34
478500 -- (-1252.185) (-1253.022) [-1251.930] (-1253.248) * (-1250.622) (-1254.806) [-1253.350] (-1255.496) -- 0:00:34
479000 -- (-1252.733) (-1251.573) (-1253.088) [-1250.980] * (-1251.899) (-1254.269) (-1254.200) [-1253.237] -- 0:00:34
479500 -- (-1253.381) (-1255.613) (-1252.098) [-1251.434] * (-1251.621) (-1253.666) [-1254.098] (-1248.657) -- 0:00:34
480000 -- (-1253.773) (-1251.937) [-1253.549] (-1252.680) * (-1252.028) (-1252.885) [-1252.127] (-1250.735) -- 0:00:34
Average standard deviation of split frequencies: 0.009692
480500 -- [-1254.507] (-1251.779) (-1251.473) (-1251.763) * [-1249.971] (-1252.378) (-1253.915) (-1251.502) -- 0:00:35
481000 -- [-1250.710] (-1254.503) (-1252.353) (-1254.859) * (-1250.886) (-1252.398) [-1252.256] (-1254.196) -- 0:00:35
481500 -- (-1255.122) [-1254.208] (-1251.189) (-1251.198) * [-1253.724] (-1254.013) (-1256.443) (-1254.421) -- 0:00:35
482000 -- (-1256.300) (-1256.084) [-1252.512] (-1251.138) * (-1251.831) (-1256.349) (-1255.159) [-1254.112] -- 0:00:35
482500 -- [-1252.616] (-1254.061) (-1253.699) (-1253.226) * (-1252.858) (-1256.169) [-1255.649] (-1252.197) -- 0:00:35
483000 -- (-1251.387) (-1257.119) [-1251.670] (-1254.858) * (-1250.010) [-1251.281] (-1253.858) (-1252.811) -- 0:00:35
483500 -- (-1253.315) (-1254.194) [-1253.712] (-1251.467) * (-1251.770) [-1249.990] (-1252.251) (-1251.766) -- 0:00:35
484000 -- [-1252.985] (-1254.138) (-1256.946) (-1253.263) * (-1255.813) [-1251.699] (-1250.485) (-1254.597) -- 0:00:35
484500 -- (-1255.367) [-1253.951] (-1252.513) (-1252.405) * [-1255.804] (-1251.604) (-1253.220) (-1251.201) -- 0:00:35
485000 -- [-1251.001] (-1253.507) (-1252.311) (-1251.668) * (-1250.035) [-1252.780] (-1252.960) (-1251.854) -- 0:00:35
Average standard deviation of split frequencies: 0.009928
485500 -- (-1255.278) [-1253.547] (-1251.985) (-1258.113) * (-1252.403) (-1251.681) (-1261.456) [-1253.870] -- 0:00:34
486000 -- [-1253.151] (-1252.530) (-1251.702) (-1254.685) * (-1250.037) (-1251.276) [-1253.936] (-1258.068) -- 0:00:34
486500 -- (-1252.231) (-1252.348) [-1254.365] (-1251.710) * (-1251.089) [-1251.008] (-1252.287) (-1252.265) -- 0:00:34
487000 -- (-1254.019) (-1252.444) (-1255.634) [-1250.832] * (-1252.600) (-1251.785) [-1252.834] (-1251.668) -- 0:00:34
487500 -- (-1254.545) (-1254.660) (-1255.733) [-1254.732] * (-1253.905) (-1254.366) (-1252.175) [-1255.029] -- 0:00:34
488000 -- (-1251.899) (-1252.332) (-1251.419) [-1254.594] * (-1251.961) [-1253.750] (-1251.138) (-1252.101) -- 0:00:34
488500 -- (-1253.928) (-1251.697) [-1254.782] (-1255.380) * (-1252.412) (-1251.969) [-1252.509] (-1258.464) -- 0:00:34
489000 -- (-1253.465) (-1253.002) [-1251.937] (-1251.108) * [-1252.043] (-1250.838) (-1253.411) (-1253.739) -- 0:00:34
489500 -- (-1253.155) (-1256.434) (-1253.919) [-1252.418] * [-1253.687] (-1253.688) (-1253.626) (-1251.132) -- 0:00:34
490000 -- (-1251.813) [-1252.840] (-1251.251) (-1256.970) * (-1251.888) (-1253.859) (-1252.810) [-1249.144] -- 0:00:34
Average standard deviation of split frequencies: 0.008914
490500 -- (-1250.263) [-1252.967] (-1251.146) (-1250.766) * (-1252.044) [-1251.199] (-1255.742) (-1251.092) -- 0:00:34
491000 -- (-1254.282) (-1254.635) (-1254.474) [-1250.382] * [-1253.240] (-1251.564) (-1254.985) (-1251.529) -- 0:00:34
491500 -- [-1252.700] (-1252.011) (-1253.839) (-1254.943) * (-1253.047) (-1251.921) [-1250.999] (-1252.855) -- 0:00:34
492000 -- [-1254.327] (-1255.035) (-1252.948) (-1253.187) * (-1250.846) (-1252.938) [-1251.204] (-1250.263) -- 0:00:34
492500 -- (-1251.327) (-1252.009) [-1252.520] (-1252.989) * (-1255.815) (-1253.003) (-1252.049) [-1252.308] -- 0:00:34
493000 -- (-1256.598) [-1252.015] (-1253.312) (-1253.018) * [-1252.351] (-1258.346) (-1252.608) (-1252.762) -- 0:00:33
493500 -- [-1252.751] (-1254.155) (-1252.165) (-1252.816) * (-1253.259) [-1254.497] (-1253.374) (-1251.426) -- 0:00:33
494000 -- (-1252.942) (-1254.873) (-1250.534) [-1253.399] * [-1254.058] (-1255.218) (-1256.052) (-1254.013) -- 0:00:33
494500 -- (-1251.887) (-1254.104) (-1251.108) [-1250.538] * (-1254.896) (-1254.602) (-1253.472) [-1251.904] -- 0:00:33
495000 -- [-1252.399] (-1252.257) (-1255.724) (-1251.048) * (-1251.431) (-1254.846) [-1253.497] (-1250.508) -- 0:00:33
Average standard deviation of split frequencies: 0.008184
495500 -- [-1251.909] (-1252.962) (-1251.739) (-1252.287) * (-1251.661) (-1252.819) (-1257.220) [-1251.723] -- 0:00:34
496000 -- [-1250.746] (-1252.548) (-1253.068) (-1251.844) * [-1250.990] (-1252.866) (-1256.000) (-1254.231) -- 0:00:34
496500 -- (-1252.907) (-1256.502) [-1252.825] (-1252.026) * (-1250.156) (-1253.824) (-1256.379) [-1251.893] -- 0:00:34
497000 -- [-1253.276] (-1252.436) (-1253.881) (-1251.535) * (-1251.427) (-1253.330) [-1253.160] (-1250.101) -- 0:00:34
497500 -- (-1252.176) [-1253.270] (-1256.319) (-1253.000) * (-1253.625) (-1260.367) [-1250.558] (-1252.468) -- 0:00:34
498000 -- (-1251.452) (-1251.680) [-1251.775] (-1255.780) * (-1252.494) (-1253.763) (-1251.468) [-1252.918] -- 0:00:34
498500 -- [-1252.468] (-1253.974) (-1252.068) (-1253.349) * (-1250.820) (-1252.546) [-1250.776] (-1253.123) -- 0:00:34
499000 -- (-1253.072) (-1254.201) (-1253.228) [-1252.355] * (-1249.696) [-1252.790] (-1251.676) (-1252.923) -- 0:00:34
499500 -- (-1254.674) [-1252.955] (-1253.696) (-1252.417) * (-1252.832) (-1256.013) [-1252.735] (-1253.585) -- 0:00:34
500000 -- [-1251.543] (-1254.015) (-1251.316) (-1249.982) * (-1251.008) (-1252.145) (-1255.714) [-1253.671] -- 0:00:34
Average standard deviation of split frequencies: 0.008108
500500 -- (-1251.261) (-1250.688) (-1256.504) [-1251.056] * [-1250.919] (-1253.153) (-1252.065) (-1255.759) -- 0:00:33
501000 -- [-1251.476] (-1252.652) (-1253.005) (-1250.036) * [-1251.700] (-1253.718) (-1257.819) (-1254.404) -- 0:00:33
501500 -- [-1257.699] (-1251.219) (-1253.278) (-1254.275) * (-1253.798) [-1256.676] (-1255.418) (-1253.461) -- 0:00:33
502000 -- [-1252.773] (-1253.401) (-1250.214) (-1254.353) * (-1254.808) (-1250.491) (-1252.453) [-1252.049] -- 0:00:33
502500 -- [-1252.220] (-1250.516) (-1252.563) (-1250.688) * (-1254.978) [-1251.900] (-1255.358) (-1249.948) -- 0:00:33
503000 -- (-1256.132) [-1251.761] (-1254.806) (-1253.952) * (-1258.058) (-1252.348) [-1256.160] (-1251.505) -- 0:00:33
503500 -- (-1252.301) (-1252.750) [-1251.804] (-1251.731) * [-1250.963] (-1252.883) (-1254.257) (-1253.485) -- 0:00:33
504000 -- (-1252.163) (-1254.716) (-1251.161) [-1250.082] * (-1254.708) [-1253.360] (-1250.828) (-1251.447) -- 0:00:33
504500 -- (-1253.088) [-1252.195] (-1252.519) (-1255.583) * [-1253.327] (-1252.455) (-1252.619) (-1251.281) -- 0:00:33
505000 -- (-1250.670) (-1253.193) (-1252.024) [-1253.303] * (-1255.511) (-1256.709) [-1254.073] (-1252.289) -- 0:00:33
Average standard deviation of split frequencies: 0.007764
505500 -- (-1251.832) [-1250.193] (-1252.503) (-1258.099) * (-1254.350) (-1253.078) (-1252.896) [-1250.836] -- 0:00:33
506000 -- (-1253.873) (-1250.981) [-1251.470] (-1253.468) * (-1253.883) (-1254.464) [-1252.388] (-1250.522) -- 0:00:33
506500 -- [-1255.025] (-1251.931) (-1251.347) (-1251.049) * [-1251.992] (-1252.516) (-1252.855) (-1254.520) -- 0:00:33
507000 -- [-1251.275] (-1250.281) (-1250.388) (-1252.272) * (-1250.914) [-1255.543] (-1253.422) (-1255.733) -- 0:00:33
507500 -- [-1252.111] (-1253.714) (-1251.846) (-1250.914) * [-1250.377] (-1253.163) (-1251.349) (-1252.273) -- 0:00:32
508000 -- (-1255.433) (-1253.602) (-1252.310) [-1250.767] * (-1251.936) (-1255.030) [-1251.783] (-1252.840) -- 0:00:32
508500 -- (-1253.577) [-1249.877] (-1253.155) (-1251.213) * [-1252.978] (-1253.789) (-1252.582) (-1257.170) -- 0:00:32
509000 -- (-1254.367) (-1252.460) [-1250.044] (-1254.620) * (-1251.791) (-1251.128) [-1251.037] (-1249.667) -- 0:00:32
509500 -- (-1251.063) (-1257.735) [-1252.655] (-1251.764) * [-1250.436] (-1251.499) (-1254.478) (-1252.732) -- 0:00:32
510000 -- (-1250.723) [-1259.468] (-1259.028) (-1250.802) * (-1250.020) (-1250.886) [-1253.630] (-1253.748) -- 0:00:32
Average standard deviation of split frequencies: 0.007539
510500 -- (-1251.063) (-1261.127) [-1254.712] (-1250.887) * (-1250.842) (-1252.113) [-1251.304] (-1253.620) -- 0:00:33
511000 -- [-1253.931] (-1252.070) (-1251.298) (-1253.726) * (-1251.963) [-1254.521] (-1253.144) (-1249.185) -- 0:00:33
511500 -- (-1254.819) (-1255.435) (-1255.357) [-1252.037] * (-1253.685) [-1252.420] (-1251.337) (-1252.797) -- 0:00:33
512000 -- (-1255.088) (-1253.573) [-1252.439] (-1255.674) * (-1253.078) (-1253.221) (-1249.860) [-1251.945] -- 0:00:33
512500 -- (-1259.757) (-1253.868) (-1252.355) [-1253.410] * (-1252.184) [-1253.466] (-1251.289) (-1254.377) -- 0:00:33
513000 -- (-1252.393) [-1255.330] (-1252.903) (-1253.193) * (-1256.949) (-1256.822) [-1250.973] (-1252.429) -- 0:00:33
513500 -- (-1251.243) (-1252.234) (-1251.819) [-1250.930] * [-1251.890] (-1252.831) (-1251.182) (-1250.102) -- 0:00:33
514000 -- (-1253.455) (-1251.281) (-1251.255) [-1251.599] * [-1254.749] (-1252.519) (-1252.543) (-1252.066) -- 0:00:33
514500 -- (-1253.064) (-1251.319) [-1253.649] (-1251.167) * (-1250.358) (-1255.722) (-1251.637) [-1254.044] -- 0:00:33
515000 -- [-1253.120] (-1259.593) (-1255.264) (-1252.423) * (-1253.168) [-1255.463] (-1248.999) (-1251.952) -- 0:00:32
Average standard deviation of split frequencies: 0.007207
515500 -- (-1254.155) [-1252.802] (-1253.094) (-1253.037) * [-1251.619] (-1255.248) (-1251.578) (-1253.692) -- 0:00:32
516000 -- (-1251.802) (-1252.769) [-1255.480] (-1252.900) * [-1251.933] (-1256.060) (-1253.258) (-1251.476) -- 0:00:32
516500 -- (-1252.496) (-1250.925) [-1251.244] (-1250.670) * (-1253.190) (-1257.462) (-1252.364) [-1251.607] -- 0:00:32
517000 -- [-1252.554] (-1249.428) (-1252.246) (-1251.572) * [-1256.328] (-1254.298) (-1252.722) (-1252.560) -- 0:00:32
517500 -- (-1253.995) (-1252.051) [-1252.617] (-1252.993) * (-1252.409) (-1252.372) (-1252.629) [-1249.985] -- 0:00:32
518000 -- (-1253.007) [-1251.162] (-1253.288) (-1251.762) * (-1250.935) (-1252.428) (-1252.925) [-1255.110] -- 0:00:32
518500 -- (-1252.558) (-1253.321) [-1255.566] (-1252.036) * (-1254.463) [-1253.493] (-1250.552) (-1249.775) -- 0:00:32
519000 -- (-1252.217) (-1254.432) [-1257.753] (-1255.217) * [-1251.910] (-1255.146) (-1251.394) (-1249.952) -- 0:00:32
519500 -- [-1251.613] (-1252.490) (-1255.339) (-1253.407) * [-1250.464] (-1252.602) (-1251.136) (-1251.719) -- 0:00:32
520000 -- [-1252.354] (-1253.461) (-1259.574) (-1252.709) * (-1251.357) (-1256.854) [-1253.848] (-1252.266) -- 0:00:32
Average standard deviation of split frequencies: 0.007142
520500 -- (-1253.019) (-1251.886) (-1254.578) [-1252.478] * (-1252.806) (-1256.189) (-1251.338) [-1254.733] -- 0:00:32
521000 -- (-1251.607) (-1256.178) [-1252.691] (-1253.219) * [-1250.281] (-1253.360) (-1256.029) (-1252.616) -- 0:00:32
521500 -- (-1254.419) (-1256.228) (-1251.504) [-1252.894] * (-1250.302) (-1251.692) [-1253.170] (-1252.627) -- 0:00:32
522000 -- (-1252.275) (-1254.551) (-1252.104) [-1254.174] * [-1249.753] (-1251.515) (-1255.752) (-1250.713) -- 0:00:32
522500 -- (-1251.703) (-1257.436) [-1255.912] (-1254.026) * (-1250.584) (-1252.535) (-1253.473) [-1253.612] -- 0:00:31
523000 -- [-1251.654] (-1252.390) (-1250.867) (-1255.660) * (-1252.471) (-1254.612) [-1253.940] (-1255.212) -- 0:00:31
523500 -- (-1253.411) (-1254.042) [-1251.999] (-1253.422) * (-1250.186) (-1256.829) [-1252.328] (-1254.502) -- 0:00:31
524000 -- [-1251.218] (-1258.653) (-1251.997) (-1254.083) * (-1251.095) [-1251.952] (-1253.272) (-1251.392) -- 0:00:31
524500 -- [-1250.662] (-1257.399) (-1253.793) (-1254.971) * [-1250.935] (-1252.202) (-1252.032) (-1252.951) -- 0:00:31
525000 -- (-1252.762) (-1253.197) [-1252.901] (-1253.480) * (-1250.786) [-1254.674] (-1252.917) (-1252.578) -- 0:00:31
Average standard deviation of split frequencies: 0.007120
525500 -- [-1251.764] (-1252.813) (-1251.207) (-1250.942) * (-1252.305) [-1251.785] (-1251.370) (-1251.654) -- 0:00:32
526000 -- (-1254.334) (-1250.584) [-1250.193] (-1254.264) * (-1255.992) [-1252.079] (-1253.849) (-1255.259) -- 0:00:32
526500 -- (-1252.388) (-1252.814) (-1251.885) [-1250.020] * (-1254.643) [-1255.460] (-1253.243) (-1255.521) -- 0:00:32
527000 -- (-1253.448) [-1253.342] (-1252.275) (-1251.402) * (-1252.707) (-1251.450) (-1252.174) [-1253.887] -- 0:00:32
527500 -- (-1251.763) [-1251.048] (-1252.726) (-1250.828) * (-1250.280) [-1252.153] (-1260.773) (-1256.177) -- 0:00:32
528000 -- (-1251.439) (-1250.892) (-1251.743) [-1255.200] * [-1250.438] (-1255.852) (-1252.325) (-1253.210) -- 0:00:32
528500 -- (-1255.465) (-1254.481) (-1253.531) [-1251.008] * (-1254.536) (-1253.653) [-1254.978] (-1253.311) -- 0:00:32
529000 -- [-1252.169] (-1252.112) (-1250.780) (-1250.949) * (-1254.536) [-1254.081] (-1251.828) (-1252.478) -- 0:00:32
529500 -- (-1257.400) (-1254.149) (-1252.014) [-1253.483] * [-1255.203] (-1254.981) (-1255.338) (-1252.573) -- 0:00:31
530000 -- (-1251.790) [-1252.575] (-1252.527) (-1252.176) * [-1256.434] (-1252.296) (-1255.725) (-1252.980) -- 0:00:31
Average standard deviation of split frequencies: 0.007946
530500 -- (-1253.699) [-1252.865] (-1252.334) (-1249.901) * (-1251.681) [-1251.704] (-1254.576) (-1252.352) -- 0:00:31
531000 -- [-1253.175] (-1257.254) (-1252.376) (-1249.931) * (-1248.592) (-1251.018) (-1254.117) [-1252.579] -- 0:00:31
531500 -- (-1251.880) (-1252.430) (-1253.492) [-1250.787] * (-1253.620) (-1255.775) (-1256.410) [-1252.369] -- 0:00:31
532000 -- (-1254.007) (-1252.944) [-1252.166] (-1254.384) * (-1253.229) (-1254.600) (-1252.356) [-1256.245] -- 0:00:31
532500 -- (-1253.634) (-1252.050) [-1253.907] (-1255.132) * (-1254.154) [-1253.662] (-1252.935) (-1252.142) -- 0:00:31
533000 -- [-1250.515] (-1249.995) (-1253.132) (-1253.904) * (-1251.353) (-1257.837) [-1253.329] (-1251.355) -- 0:00:31
533500 -- (-1251.913) [-1252.348] (-1252.460) (-1258.421) * [-1251.653] (-1250.636) (-1253.919) (-1255.262) -- 0:00:31
534000 -- [-1257.398] (-1253.516) (-1252.199) (-1252.808) * (-1252.819) [-1252.710] (-1254.493) (-1253.884) -- 0:00:31
534500 -- (-1256.726) [-1250.694] (-1251.027) (-1252.338) * [-1250.203] (-1251.951) (-1252.056) (-1255.028) -- 0:00:31
535000 -- (-1257.929) [-1248.609] (-1250.954) (-1253.596) * (-1252.750) (-1252.355) [-1253.744] (-1252.656) -- 0:00:31
Average standard deviation of split frequencies: 0.008013
535500 -- (-1253.282) (-1251.152) [-1252.236] (-1251.662) * (-1255.061) [-1252.516] (-1253.541) (-1253.789) -- 0:00:31
536000 -- [-1251.991] (-1253.348) (-1251.330) (-1252.147) * (-1251.229) (-1251.133) [-1256.823] (-1254.352) -- 0:00:31
536500 -- (-1252.612) (-1252.489) [-1252.164] (-1252.759) * (-1255.672) (-1251.836) [-1254.147] (-1252.532) -- 0:00:31
537000 -- (-1252.059) (-1252.749) (-1253.254) [-1252.055] * (-1253.783) (-1250.583) (-1252.158) [-1252.309] -- 0:00:31
537500 -- (-1251.428) [-1251.974] (-1251.748) (-1251.068) * (-1251.975) (-1252.186) [-1251.579] (-1250.770) -- 0:00:30
538000 -- (-1252.370) [-1250.432] (-1252.951) (-1253.379) * [-1252.477] (-1251.045) (-1258.301) (-1256.014) -- 0:00:30
538500 -- (-1252.685) (-1252.292) [-1253.065] (-1254.629) * (-1252.405) (-1249.537) [-1252.310] (-1254.795) -- 0:00:30
539000 -- (-1251.560) [-1250.295] (-1254.003) (-1252.113) * (-1252.016) [-1250.663] (-1252.406) (-1253.480) -- 0:00:30
539500 -- (-1253.059) [-1251.903] (-1250.330) (-1256.086) * [-1253.555] (-1250.255) (-1253.458) (-1251.794) -- 0:00:30
540000 -- (-1252.988) (-1254.310) [-1250.822] (-1255.698) * (-1252.009) (-1250.960) (-1253.230) [-1255.626] -- 0:00:30
Average standard deviation of split frequencies: 0.007944
540500 -- (-1253.859) (-1250.273) [-1254.418] (-1253.692) * (-1253.478) (-1252.850) (-1252.933) [-1250.584] -- 0:00:31
541000 -- [-1252.439] (-1251.781) (-1253.685) (-1255.248) * (-1254.858) [-1250.797] (-1256.603) (-1253.010) -- 0:00:31
541500 -- (-1254.075) (-1256.766) [-1252.975] (-1255.116) * (-1253.036) [-1251.669] (-1253.778) (-1252.903) -- 0:00:31
542000 -- (-1252.299) (-1252.935) [-1255.868] (-1256.393) * (-1251.015) [-1253.465] (-1253.492) (-1257.156) -- 0:00:31
542500 -- (-1253.615) [-1253.022] (-1254.488) (-1253.846) * (-1252.754) (-1251.684) [-1254.480] (-1256.624) -- 0:00:31
543000 -- (-1252.324) [-1249.664] (-1253.527) (-1253.107) * (-1254.261) (-1250.031) (-1252.906) [-1252.399] -- 0:00:31
543500 -- (-1252.784) (-1250.946) (-1253.170) [-1253.101] * (-1254.600) [-1250.338] (-1257.709) (-1253.667) -- 0:00:31
544000 -- (-1251.769) (-1255.186) [-1252.800] (-1252.372) * (-1253.559) [-1255.234] (-1252.254) (-1254.313) -- 0:00:31
544500 -- (-1253.047) [-1250.805] (-1256.588) (-1252.463) * [-1253.378] (-1250.844) (-1256.331) (-1255.738) -- 0:00:30
545000 -- (-1251.971) (-1252.048) [-1251.895] (-1253.546) * (-1252.955) (-1254.335) [-1257.063] (-1256.871) -- 0:00:30
Average standard deviation of split frequencies: 0.007818
545500 -- (-1251.618) [-1251.952] (-1251.624) (-1250.989) * (-1251.258) (-1251.666) (-1255.865) [-1251.739] -- 0:00:30
546000 -- (-1252.974) [-1250.105] (-1258.537) (-1253.175) * (-1254.861) (-1252.596) (-1254.519) [-1252.641] -- 0:00:30
546500 -- (-1256.079) (-1252.071) (-1258.722) [-1251.827] * (-1253.666) (-1253.643) (-1252.142) [-1251.928] -- 0:00:30
547000 -- (-1251.153) (-1253.677) (-1256.649) [-1256.145] * (-1250.527) (-1251.780) [-1251.457] (-1253.214) -- 0:00:30
547500 -- (-1254.044) [-1250.145] (-1256.939) (-1254.158) * (-1255.003) [-1251.826] (-1252.474) (-1252.344) -- 0:00:30
548000 -- (-1254.607) (-1254.138) (-1259.068) [-1252.523] * [-1254.039] (-1251.134) (-1255.807) (-1253.642) -- 0:00:30
548500 -- (-1253.878) (-1249.730) (-1253.880) [-1252.470] * (-1253.760) [-1251.893] (-1254.414) (-1251.865) -- 0:00:30
549000 -- (-1251.597) (-1251.937) (-1251.565) [-1253.774] * (-1252.066) (-1251.674) (-1252.671) [-1253.744] -- 0:00:30
549500 -- (-1251.940) (-1252.422) [-1251.688] (-1256.442) * (-1254.144) (-1255.961) (-1253.558) [-1253.638] -- 0:00:30
550000 -- (-1251.348) (-1253.246) [-1251.677] (-1259.918) * (-1251.864) (-1250.482) (-1251.044) [-1253.112] -- 0:00:30
Average standard deviation of split frequencies: 0.007372
550500 -- (-1254.581) (-1254.362) (-1252.300) [-1252.607] * [-1250.776] (-1252.536) (-1250.095) (-1254.693) -- 0:00:30
551000 -- (-1252.847) (-1250.584) (-1250.990) [-1251.043] * (-1252.113) (-1250.820) [-1250.785] (-1253.703) -- 0:00:30
551500 -- (-1252.800) (-1253.859) [-1249.825] (-1250.994) * (-1253.051) (-1252.731) (-1249.831) [-1251.476] -- 0:00:30
552000 -- (-1254.191) [-1250.307] (-1252.283) (-1257.349) * [-1252.169] (-1249.264) (-1250.548) (-1255.684) -- 0:00:30
552500 -- (-1256.121) (-1253.386) [-1254.343] (-1252.418) * (-1252.024) [-1251.100] (-1251.187) (-1250.948) -- 0:00:29
553000 -- [-1256.148] (-1251.129) (-1251.209) (-1253.373) * (-1252.233) (-1250.938) [-1253.511] (-1256.750) -- 0:00:29
553500 -- (-1255.757) [-1250.834] (-1252.722) (-1251.510) * (-1254.591) [-1251.227] (-1256.549) (-1253.315) -- 0:00:29
554000 -- [-1249.411] (-1249.058) (-1255.030) (-1251.053) * (-1252.732) (-1250.287) [-1255.214] (-1251.888) -- 0:00:29
554500 -- [-1251.669] (-1251.761) (-1252.295) (-1257.347) * (-1252.313) [-1250.904] (-1257.889) (-1252.653) -- 0:00:29
555000 -- (-1251.391) [-1253.835] (-1252.486) (-1252.927) * [-1250.772] (-1252.845) (-1257.056) (-1252.403) -- 0:00:29
Average standard deviation of split frequencies: 0.006830
555500 -- (-1254.158) (-1254.269) [-1252.648] (-1254.432) * [-1252.456] (-1254.640) (-1254.951) (-1251.204) -- 0:00:30
556000 -- (-1253.617) [-1251.514] (-1252.799) (-1253.848) * (-1253.414) (-1251.612) (-1253.348) [-1251.082] -- 0:00:30
556500 -- [-1256.686] (-1253.126) (-1251.728) (-1250.623) * (-1253.031) (-1252.080) (-1255.460) [-1251.639] -- 0:00:30
557000 -- (-1251.261) [-1250.662] (-1254.609) (-1255.444) * (-1252.687) [-1250.540] (-1253.546) (-1253.752) -- 0:00:30
557500 -- (-1253.150) [-1251.109] (-1253.558) (-1251.150) * (-1252.765) [-1250.567] (-1252.764) (-1251.508) -- 0:00:30
558000 -- (-1251.945) [-1254.474] (-1251.805) (-1253.055) * (-1253.335) (-1251.553) [-1252.160] (-1250.476) -- 0:00:30
558500 -- (-1254.178) (-1250.322) [-1252.336] (-1253.190) * (-1254.388) [-1249.550] (-1252.880) (-1254.775) -- 0:00:30
559000 -- (-1252.838) (-1251.679) [-1255.200] (-1253.288) * [-1251.134] (-1253.848) (-1254.885) (-1256.510) -- 0:00:29
559500 -- [-1253.758] (-1251.434) (-1252.114) (-1254.328) * (-1251.848) (-1252.336) (-1255.718) [-1252.130] -- 0:00:29
560000 -- [-1251.953] (-1254.805) (-1258.266) (-1252.583) * (-1252.584) (-1254.101) [-1251.615] (-1251.213) -- 0:00:29
Average standard deviation of split frequencies: 0.006726
560500 -- (-1251.651) [-1253.078] (-1255.511) (-1253.313) * (-1254.196) (-1256.162) [-1251.237] (-1253.288) -- 0:00:29
561000 -- (-1254.329) [-1252.332] (-1250.394) (-1252.131) * [-1254.172] (-1255.281) (-1255.237) (-1251.590) -- 0:00:29
561500 -- (-1256.544) [-1251.612] (-1251.327) (-1250.794) * (-1257.352) [-1251.555] (-1255.645) (-1252.391) -- 0:00:29
562000 -- (-1254.760) [-1251.814] (-1250.013) (-1253.806) * (-1250.294) [-1251.322] (-1259.827) (-1257.818) -- 0:00:29
562500 -- [-1253.625] (-1253.614) (-1251.404) (-1251.974) * (-1253.133) (-1250.813) (-1251.236) [-1250.390] -- 0:00:29
563000 -- [-1252.623] (-1252.282) (-1252.055) (-1256.723) * [-1252.565] (-1250.704) (-1254.243) (-1253.466) -- 0:00:29
563500 -- (-1252.233) (-1250.019) [-1252.882] (-1260.243) * (-1251.093) [-1252.132] (-1251.566) (-1252.431) -- 0:00:29
564000 -- [-1256.724] (-1252.249) (-1252.031) (-1253.342) * (-1251.069) [-1252.401] (-1252.259) (-1251.765) -- 0:00:29
564500 -- (-1251.329) (-1253.742) (-1252.641) [-1251.857] * (-1254.315) (-1252.553) (-1253.445) [-1251.347] -- 0:00:29
565000 -- (-1252.252) [-1251.463] (-1257.058) (-1253.677) * (-1251.606) (-1250.967) (-1253.078) [-1253.411] -- 0:00:29
Average standard deviation of split frequencies: 0.007311
565500 -- (-1251.623) [-1249.809] (-1254.284) (-1251.742) * (-1250.897) (-1251.529) [-1252.883] (-1259.954) -- 0:00:29
566000 -- (-1256.324) [-1253.816] (-1253.461) (-1252.355) * (-1253.154) [-1252.711] (-1253.801) (-1253.058) -- 0:00:29
566500 -- (-1249.647) [-1251.578] (-1251.693) (-1252.577) * (-1256.782) (-1256.090) [-1253.077] (-1253.692) -- 0:00:29
567000 -- (-1253.275) (-1251.863) (-1252.677) [-1252.080] * (-1251.181) [-1255.009] (-1254.081) (-1251.819) -- 0:00:29
567500 -- (-1250.689) (-1255.702) [-1252.694] (-1252.229) * (-1251.055) [-1254.815] (-1252.003) (-1255.470) -- 0:00:28
568000 -- (-1256.487) (-1253.178) (-1254.565) [-1251.746] * (-1252.523) [-1254.016] (-1253.604) (-1252.519) -- 0:00:28
568500 -- (-1251.052) (-1254.465) [-1254.484] (-1251.287) * [-1249.505] (-1255.125) (-1256.050) (-1252.001) -- 0:00:28
569000 -- (-1251.921) [-1253.974] (-1252.366) (-1253.960) * [-1252.461] (-1251.742) (-1250.860) (-1253.028) -- 0:00:28
569500 -- [-1253.279] (-1254.285) (-1252.958) (-1253.700) * [-1251.133] (-1251.295) (-1253.484) (-1251.330) -- 0:00:28
570000 -- (-1253.068) (-1251.127) [-1252.626] (-1256.278) * (-1262.803) (-1252.781) [-1252.025] (-1253.619) -- 0:00:28
Average standard deviation of split frequencies: 0.007618
570500 -- (-1253.767) [-1251.940] (-1253.727) (-1250.871) * [-1253.366] (-1252.133) (-1252.176) (-1254.258) -- 0:00:29
571000 -- [-1254.893] (-1252.180) (-1258.910) (-1251.526) * (-1251.269) (-1251.668) (-1252.136) [-1253.811] -- 0:00:29
571500 -- [-1254.787] (-1252.830) (-1255.216) (-1251.098) * (-1252.665) (-1252.962) [-1252.612] (-1253.096) -- 0:00:29
572000 -- (-1252.552) [-1252.929] (-1253.474) (-1251.700) * (-1252.214) [-1252.936] (-1254.359) (-1251.654) -- 0:00:29
572500 -- (-1252.674) (-1254.176) (-1253.225) [-1252.090] * [-1250.362] (-1254.017) (-1250.924) (-1256.449) -- 0:00:29
573000 -- (-1253.165) (-1253.522) [-1251.421] (-1253.527) * (-1252.317) [-1251.755] (-1255.536) (-1254.811) -- 0:00:29
573500 -- (-1253.807) (-1254.414) (-1251.034) [-1252.315] * (-1253.185) [-1252.226] (-1256.403) (-1256.088) -- 0:00:29
574000 -- (-1253.115) (-1250.041) (-1251.186) [-1250.389] * (-1253.642) (-1254.053) (-1252.409) [-1252.567] -- 0:00:28
574500 -- (-1253.007) (-1252.302) (-1253.141) [-1251.626] * (-1256.570) (-1254.107) (-1250.506) [-1254.494] -- 0:00:28
575000 -- (-1257.310) (-1253.663) (-1253.082) [-1252.942] * (-1251.152) (-1261.162) [-1251.645] (-1253.889) -- 0:00:28
Average standard deviation of split frequencies: 0.007548
575500 -- (-1258.748) [-1251.697] (-1251.594) (-1254.543) * (-1252.141) [-1255.328] (-1252.667) (-1251.803) -- 0:00:28
576000 -- (-1253.174) [-1251.230] (-1251.075) (-1257.220) * (-1252.475) [-1253.546] (-1256.431) (-1254.953) -- 0:00:28
576500 -- (-1252.641) (-1253.979) [-1249.983] (-1252.436) * (-1254.455) (-1252.887) [-1255.685] (-1252.778) -- 0:00:28
577000 -- (-1252.048) [-1254.591] (-1252.973) (-1255.793) * [-1252.747] (-1253.458) (-1257.890) (-1254.128) -- 0:00:28
577500 -- (-1252.788) [-1252.745] (-1255.310) (-1251.274) * [-1251.364] (-1252.894) (-1253.166) (-1254.359) -- 0:00:28
578000 -- (-1252.458) (-1250.397) (-1258.190) [-1251.908] * (-1253.541) [-1251.989] (-1252.077) (-1250.934) -- 0:00:28
578500 -- (-1255.204) (-1257.121) [-1255.408] (-1254.181) * [-1253.235] (-1253.354) (-1255.439) (-1254.550) -- 0:00:28
579000 -- [-1255.734] (-1252.321) (-1256.287) (-1253.942) * (-1252.048) (-1259.370) (-1252.480) [-1254.566] -- 0:00:28
579500 -- (-1253.039) (-1250.950) [-1254.612] (-1254.068) * (-1252.560) (-1251.775) [-1252.479] (-1255.943) -- 0:00:28
580000 -- (-1254.403) [-1250.837] (-1252.371) (-1253.963) * (-1251.948) (-1253.627) (-1252.899) [-1250.879] -- 0:00:28
Average standard deviation of split frequencies: 0.008028
580500 -- (-1256.124) (-1251.434) [-1250.963] (-1253.302) * (-1252.121) [-1256.316] (-1252.100) (-1251.839) -- 0:00:28
581000 -- (-1255.541) (-1251.683) [-1253.102] (-1251.233) * (-1252.831) (-1256.650) (-1251.747) [-1250.269] -- 0:00:28
581500 -- [-1255.109] (-1253.295) (-1250.762) (-1255.607) * (-1254.419) [-1252.727] (-1252.247) (-1251.139) -- 0:00:28
582000 -- (-1252.089) [-1251.397] (-1253.675) (-1253.182) * (-1253.528) (-1252.681) [-1251.884] (-1257.033) -- 0:00:28
582500 -- (-1251.062) [-1251.860] (-1254.132) (-1255.548) * [-1252.706] (-1251.145) (-1251.827) (-1251.703) -- 0:00:27
583000 -- (-1251.673) (-1250.789) (-1254.987) [-1252.743] * (-1253.302) (-1255.838) (-1254.400) [-1251.407] -- 0:00:27
583500 -- (-1251.327) [-1251.997] (-1251.712) (-1253.456) * (-1252.440) (-1254.179) (-1254.573) [-1252.699] -- 0:00:28
584000 -- (-1251.039) (-1253.979) [-1253.587] (-1255.353) * (-1252.087) (-1252.787) [-1252.468] (-1252.316) -- 0:00:28
584500 -- (-1251.539) [-1252.133] (-1252.513) (-1252.397) * (-1250.819) (-1252.018) (-1254.234) [-1251.618] -- 0:00:28
585000 -- (-1252.778) [-1252.062] (-1250.742) (-1253.026) * (-1253.183) (-1253.689) (-1253.448) [-1251.922] -- 0:00:28
Average standard deviation of split frequencies: 0.008044
585500 -- [-1251.477] (-1252.217) (-1252.674) (-1253.329) * (-1252.106) [-1252.147] (-1252.402) (-1251.737) -- 0:00:28
586000 -- (-1252.165) (-1252.636) (-1252.499) [-1252.272] * (-1254.735) (-1252.842) [-1253.558] (-1252.517) -- 0:00:28
586500 -- (-1252.427) [-1251.034] (-1252.885) (-1254.241) * (-1254.436) (-1255.734) (-1259.862) [-1254.794] -- 0:00:28
587000 -- (-1252.323) [-1251.332] (-1255.001) (-1253.178) * (-1254.752) [-1250.446] (-1253.299) (-1251.741) -- 0:00:28
587500 -- (-1249.910) (-1252.445) (-1251.984) [-1255.564] * (-1254.675) (-1251.919) [-1254.301] (-1248.761) -- 0:00:28
588000 -- (-1251.280) (-1254.683) (-1253.631) [-1251.768] * (-1253.707) (-1251.989) (-1255.645) [-1250.725] -- 0:00:28
588500 -- (-1249.585) [-1251.437] (-1252.315) (-1252.493) * (-1254.521) (-1253.995) [-1253.388] (-1255.195) -- 0:00:27
589000 -- (-1254.155) (-1251.910) [-1253.900] (-1251.529) * (-1252.882) (-1252.616) (-1251.643) [-1250.843] -- 0:00:27
589500 -- (-1254.965) (-1251.658) (-1251.777) [-1249.972] * (-1253.730) (-1253.636) (-1253.118) [-1254.152] -- 0:00:27
590000 -- [-1256.910] (-1254.764) (-1251.672) (-1251.068) * (-1253.200) (-1251.434) [-1251.280] (-1251.887) -- 0:00:27
Average standard deviation of split frequencies: 0.007626
590500 -- [-1251.833] (-1254.574) (-1250.831) (-1251.621) * [-1253.524] (-1250.650) (-1253.060) (-1253.395) -- 0:00:27
591000 -- (-1252.236) (-1253.513) (-1251.929) [-1252.114] * [-1252.348] (-1250.679) (-1253.867) (-1255.091) -- 0:00:27
591500 -- (-1251.588) (-1253.862) [-1252.012] (-1250.972) * (-1252.991) (-1251.288) (-1255.038) [-1251.480] -- 0:00:27
592000 -- (-1253.914) (-1252.596) (-1252.884) [-1252.847] * (-1253.190) (-1250.918) [-1252.543] (-1250.794) -- 0:00:27
592500 -- [-1253.906] (-1252.859) (-1250.664) (-1250.212) * (-1254.916) (-1254.267) [-1252.275] (-1251.414) -- 0:00:27
593000 -- (-1255.243) (-1253.073) [-1254.499] (-1253.561) * (-1254.871) (-1255.616) (-1253.669) [-1253.063] -- 0:00:27
593500 -- (-1251.456) (-1250.675) [-1251.798] (-1253.174) * [-1254.378] (-1251.786) (-1255.546) (-1254.171) -- 0:00:27
594000 -- [-1250.019] (-1251.122) (-1256.720) (-1253.977) * (-1254.789) (-1252.253) [-1254.141] (-1251.694) -- 0:00:27
594500 -- (-1253.874) (-1251.897) (-1260.496) [-1254.844] * (-1253.940) (-1253.847) [-1255.392] (-1251.759) -- 0:00:27
595000 -- (-1254.564) (-1253.920) (-1252.741) [-1254.184] * [-1253.711] (-1253.576) (-1249.402) (-1250.223) -- 0:00:27
Average standard deviation of split frequencies: 0.007250
595500 -- (-1251.948) (-1251.565) [-1250.584] (-1251.644) * (-1252.851) (-1254.968) [-1251.819] (-1254.883) -- 0:00:27
596000 -- (-1257.411) (-1257.637) (-1252.717) [-1250.568] * (-1252.121) (-1254.125) (-1252.223) [-1252.977] -- 0:00:27
596500 -- (-1257.604) (-1251.280) (-1253.104) [-1252.353] * [-1253.249] (-1252.700) (-1251.624) (-1253.622) -- 0:00:27
597000 -- [-1250.168] (-1251.235) (-1255.490) (-1250.915) * [-1249.688] (-1252.435) (-1252.878) (-1251.128) -- 0:00:27
597500 -- (-1252.419) (-1253.965) [-1254.261] (-1252.453) * (-1255.079) (-1252.625) [-1255.034] (-1251.196) -- 0:00:27
598000 -- (-1251.640) (-1258.397) [-1251.964] (-1250.691) * (-1255.765) [-1252.013] (-1253.691) (-1253.188) -- 0:00:27
598500 -- (-1252.110) (-1251.838) (-1252.175) [-1252.089] * [-1253.012] (-1253.907) (-1254.820) (-1254.392) -- 0:00:27
599000 -- (-1252.606) (-1256.704) [-1249.287] (-1252.320) * (-1252.130) (-1252.839) [-1253.570] (-1255.457) -- 0:00:27
599500 -- (-1252.440) (-1250.606) [-1249.008] (-1251.287) * (-1252.834) [-1252.024] (-1252.256) (-1252.798) -- 0:00:27
600000 -- (-1251.762) (-1252.628) [-1250.780] (-1252.196) * [-1252.823] (-1254.184) (-1259.767) (-1256.389) -- 0:00:27
Average standard deviation of split frequencies: 0.007020
600500 -- (-1252.087) (-1253.947) (-1251.675) [-1250.714] * (-1252.841) [-1255.036] (-1262.844) (-1254.990) -- 0:00:27
601000 -- (-1254.236) (-1251.665) [-1250.212] (-1260.345) * (-1253.385) [-1250.836] (-1254.415) (-1256.373) -- 0:00:27
601500 -- (-1251.971) [-1252.282] (-1251.178) (-1251.849) * (-1253.098) (-1251.672) (-1254.039) [-1251.581] -- 0:00:27
602000 -- [-1251.638] (-1252.734) (-1251.022) (-1253.121) * (-1252.831) [-1252.328] (-1255.475) (-1251.792) -- 0:00:27
602500 -- (-1256.306) [-1253.607] (-1254.332) (-1258.957) * (-1252.973) (-1252.806) (-1253.621) [-1254.539] -- 0:00:27
603000 -- (-1253.640) (-1252.921) [-1250.404] (-1252.226) * (-1252.212) (-1258.862) (-1252.955) [-1256.505] -- 0:00:26
603500 -- (-1255.374) [-1255.375] (-1251.238) (-1252.030) * (-1252.799) (-1256.075) (-1253.154) [-1252.022] -- 0:00:26
604000 -- (-1259.318) (-1256.314) (-1252.674) [-1251.520] * (-1252.270) (-1253.062) (-1255.034) [-1251.634] -- 0:00:26
604500 -- (-1256.384) [-1252.700] (-1250.834) (-1251.378) * (-1251.985) [-1251.528] (-1255.371) (-1254.591) -- 0:00:26
605000 -- [-1253.766] (-1257.641) (-1251.562) (-1251.898) * [-1252.423] (-1252.140) (-1250.484) (-1252.520) -- 0:00:26
Average standard deviation of split frequencies: 0.007131
605500 -- (-1255.054) (-1253.388) (-1250.202) [-1251.399] * (-1252.093) (-1254.454) [-1252.054] (-1253.959) -- 0:00:26
606000 -- (-1253.097) [-1253.504] (-1252.791) (-1252.942) * (-1251.345) [-1253.310] (-1255.972) (-1256.199) -- 0:00:26
606500 -- (-1254.434) (-1251.494) (-1254.959) [-1252.120] * (-1251.594) (-1252.252) [-1256.134] (-1253.149) -- 0:00:26
607000 -- (-1251.881) (-1252.990) (-1255.028) [-1253.104] * (-1253.730) (-1252.443) [-1251.009] (-1253.827) -- 0:00:26
607500 -- (-1252.330) (-1253.101) [-1254.605] (-1254.712) * [-1250.946] (-1253.241) (-1251.890) (-1254.771) -- 0:00:26
608000 -- [-1252.291] (-1252.595) (-1253.252) (-1252.952) * (-1252.956) (-1253.838) (-1253.609) [-1253.482] -- 0:00:26
608500 -- (-1253.218) (-1252.766) [-1254.325] (-1258.221) * (-1255.733) (-1254.285) (-1254.243) [-1256.458] -- 0:00:26
609000 -- [-1252.968] (-1255.444) (-1260.034) (-1256.776) * [-1251.117] (-1252.708) (-1258.265) (-1252.370) -- 0:00:26
609500 -- [-1255.129] (-1254.266) (-1253.900) (-1251.722) * (-1251.096) [-1251.955] (-1255.214) (-1251.672) -- 0:00:26
610000 -- (-1253.780) [-1253.149] (-1251.527) (-1254.942) * (-1248.937) (-1251.290) (-1251.002) [-1256.820] -- 0:00:26
Average standard deviation of split frequencies: 0.007548
610500 -- (-1251.903) (-1253.015) (-1252.108) [-1253.234] * [-1251.331] (-1251.179) (-1250.499) (-1251.871) -- 0:00:26
611000 -- (-1253.182) (-1252.455) [-1252.746] (-1252.018) * [-1254.964] (-1255.699) (-1251.676) (-1253.458) -- 0:00:26
611500 -- (-1253.738) (-1255.474) [-1252.270] (-1251.659) * (-1251.393) (-1255.262) (-1252.981) [-1252.951] -- 0:00:26
612000 -- [-1251.277] (-1252.480) (-1252.642) (-1253.765) * [-1251.479] (-1253.265) (-1254.519) (-1252.166) -- 0:00:25
612500 -- [-1251.767] (-1256.078) (-1251.719) (-1252.091) * (-1255.791) (-1255.467) [-1250.943] (-1253.344) -- 0:00:26
613000 -- (-1253.515) (-1253.153) [-1253.562] (-1252.269) * [-1252.737] (-1251.878) (-1251.752) (-1252.966) -- 0:00:26
613500 -- (-1254.088) (-1251.869) (-1253.020) [-1251.002] * [-1251.907] (-1252.534) (-1252.249) (-1253.172) -- 0:00:26
614000 -- (-1252.132) (-1252.369) (-1254.337) [-1252.370] * (-1255.168) (-1251.934) (-1252.852) [-1254.132] -- 0:00:26
614500 -- [-1253.566] (-1254.231) (-1254.054) (-1252.854) * (-1251.167) [-1251.615] (-1252.344) (-1253.643) -- 0:00:26
615000 -- [-1252.326] (-1253.934) (-1252.068) (-1252.266) * [-1253.695] (-1253.684) (-1254.011) (-1255.381) -- 0:00:26
Average standard deviation of split frequencies: 0.007015
615500 -- (-1252.434) (-1255.208) (-1251.318) [-1253.389] * (-1251.723) (-1251.587) [-1252.418] (-1253.826) -- 0:00:26
616000 -- (-1249.801) (-1251.106) (-1251.637) [-1254.718] * [-1253.140] (-1256.849) (-1251.878) (-1253.610) -- 0:00:26
616500 -- (-1253.726) (-1252.511) [-1252.771] (-1251.392) * [-1250.240] (-1257.148) (-1255.216) (-1252.027) -- 0:00:26
617000 -- (-1256.293) (-1252.035) [-1254.076] (-1257.345) * (-1250.969) (-1252.952) (-1251.475) [-1252.767] -- 0:00:26
617500 -- [-1250.889] (-1249.960) (-1253.452) (-1253.989) * (-1250.238) (-1253.981) [-1252.103] (-1255.951) -- 0:00:26
618000 -- (-1253.304) [-1250.696] (-1258.030) (-1255.416) * (-1255.201) [-1252.866] (-1258.972) (-1251.414) -- 0:00:25
618500 -- (-1251.235) (-1254.621) (-1254.376) [-1256.198] * (-1251.852) (-1253.047) (-1252.120) [-1252.203] -- 0:00:25
619000 -- (-1256.823) (-1254.631) [-1252.688] (-1252.769) * (-1250.252) (-1254.228) (-1250.269) [-1253.864] -- 0:00:25
619500 -- (-1254.536) (-1250.946) [-1251.076] (-1254.175) * (-1251.705) (-1252.029) [-1249.855] (-1253.675) -- 0:00:25
620000 -- (-1255.986) (-1252.407) (-1251.916) [-1254.854] * (-1252.124) [-1252.942] (-1252.380) (-1252.687) -- 0:00:25
Average standard deviation of split frequencies: 0.006667
620500 -- (-1254.754) (-1253.915) (-1254.057) [-1252.939] * (-1252.013) (-1252.261) [-1251.154] (-1251.597) -- 0:00:25
621000 -- (-1255.234) (-1251.888) [-1250.135] (-1252.075) * (-1254.964) (-1252.179) [-1252.666] (-1252.474) -- 0:00:25
621500 -- (-1254.334) [-1251.826] (-1251.137) (-1251.562) * (-1252.643) (-1252.719) (-1253.069) [-1252.424] -- 0:00:25
622000 -- [-1249.851] (-1252.198) (-1251.448) (-1255.076) * (-1252.348) (-1252.555) (-1253.117) [-1253.593] -- 0:00:25
622500 -- (-1250.543) (-1254.490) [-1254.313] (-1254.649) * (-1253.286) (-1252.672) (-1255.540) [-1251.956] -- 0:00:25
623000 -- (-1252.013) (-1253.663) (-1253.819) [-1259.092] * (-1253.715) (-1254.563) (-1253.832) [-1254.757] -- 0:00:25
623500 -- [-1252.807] (-1256.081) (-1255.929) (-1256.408) * [-1250.221] (-1251.719) (-1253.393) (-1253.014) -- 0:00:25
624000 -- (-1252.669) [-1252.361] (-1254.677) (-1257.240) * [-1252.182] (-1258.194) (-1256.584) (-1254.515) -- 0:00:25
624500 -- [-1250.470] (-1253.691) (-1263.570) (-1257.258) * (-1251.280) [-1250.823] (-1256.317) (-1253.247) -- 0:00:25
625000 -- (-1252.797) (-1254.243) (-1255.292) [-1257.008] * [-1250.720] (-1252.978) (-1256.861) (-1252.276) -- 0:00:25
Average standard deviation of split frequencies: 0.006443
625500 -- [-1250.221] (-1252.380) (-1253.781) (-1256.775) * (-1252.952) (-1254.369) (-1253.574) [-1252.207] -- 0:00:25
626000 -- (-1251.366) (-1253.590) [-1252.800] (-1257.317) * [-1251.895] (-1251.244) (-1253.936) (-1252.863) -- 0:00:25
626500 -- [-1252.052] (-1256.949) (-1255.519) (-1252.808) * (-1252.348) (-1252.266) (-1253.633) [-1260.508] -- 0:00:25
627000 -- (-1254.216) (-1254.118) [-1253.875] (-1253.374) * [-1253.225] (-1254.572) (-1254.021) (-1260.367) -- 0:00:24
627500 -- [-1250.382] (-1251.308) (-1255.767) (-1253.456) * [-1255.173] (-1253.347) (-1252.576) (-1252.746) -- 0:00:25
628000 -- (-1253.558) (-1252.282) (-1254.385) [-1252.975] * (-1253.577) (-1251.956) (-1253.521) [-1254.210] -- 0:00:25
628500 -- (-1250.991) (-1252.104) [-1254.472] (-1253.006) * (-1255.779) (-1254.484) [-1252.728] (-1255.413) -- 0:00:25
629000 -- (-1251.974) [-1251.293] (-1253.287) (-1255.723) * (-1253.072) (-1251.821) [-1251.396] (-1254.048) -- 0:00:25
629500 -- (-1250.781) (-1254.428) [-1252.766] (-1252.362) * (-1253.311) [-1252.837] (-1253.445) (-1252.059) -- 0:00:25
630000 -- (-1251.989) (-1256.288) (-1250.611) [-1255.525] * (-1253.776) [-1253.761] (-1252.303) (-1253.820) -- 0:00:25
Average standard deviation of split frequencies: 0.006353
630500 -- (-1251.524) [-1251.887] (-1254.241) (-1252.876) * [-1252.519] (-1252.379) (-1252.698) (-1253.136) -- 0:00:25
631000 -- (-1256.439) (-1253.824) (-1252.162) [-1251.559] * (-1253.911) [-1252.415] (-1252.873) (-1250.305) -- 0:00:25
631500 -- (-1254.841) (-1254.893) [-1252.824] (-1250.701) * (-1253.929) (-1252.870) (-1256.774) [-1251.818] -- 0:00:25
632000 -- (-1254.127) (-1254.667) [-1252.258] (-1253.058) * (-1253.210) [-1252.274] (-1254.403) (-1252.227) -- 0:00:25
632500 -- (-1253.158) (-1252.975) (-1254.092) [-1255.417] * (-1250.689) (-1251.828) (-1252.807) [-1251.772] -- 0:00:24
633000 -- (-1252.414) (-1258.435) (-1252.812) [-1252.023] * (-1251.260) (-1251.255) [-1250.878] (-1250.528) -- 0:00:24
633500 -- (-1252.238) [-1255.858] (-1252.844) (-1253.642) * (-1252.183) (-1251.331) (-1252.724) [-1252.014] -- 0:00:24
634000 -- [-1253.620] (-1254.187) (-1252.843) (-1252.607) * (-1249.917) [-1254.167] (-1252.967) (-1252.351) -- 0:00:24
634500 -- (-1253.572) [-1254.401] (-1252.110) (-1253.503) * (-1255.524) [-1253.348] (-1252.540) (-1254.409) -- 0:00:24
635000 -- [-1254.047] (-1251.071) (-1252.597) (-1254.737) * [-1252.185] (-1253.773) (-1254.424) (-1252.470) -- 0:00:24
Average standard deviation of split frequencies: 0.006547
635500 -- (-1253.399) [-1251.705] (-1255.236) (-1251.325) * (-1254.834) [-1252.379] (-1256.452) (-1252.395) -- 0:00:24
636000 -- (-1254.934) [-1252.524] (-1254.847) (-1253.404) * [-1255.271] (-1251.233) (-1253.289) (-1252.046) -- 0:00:24
636500 -- (-1250.103) [-1251.479] (-1251.770) (-1253.201) * [-1254.250] (-1250.017) (-1252.421) (-1251.907) -- 0:00:24
637000 -- [-1252.835] (-1252.945) (-1251.970) (-1253.883) * [-1251.186] (-1253.396) (-1252.596) (-1251.059) -- 0:00:24
637500 -- (-1253.774) (-1253.495) [-1253.359] (-1252.507) * (-1252.053) (-1251.009) [-1252.772] (-1252.901) -- 0:00:24
638000 -- (-1250.460) [-1251.457] (-1251.936) (-1254.792) * [-1253.707] (-1253.313) (-1251.575) (-1252.664) -- 0:00:24
638500 -- (-1252.115) [-1251.688] (-1252.773) (-1254.114) * (-1252.493) (-1253.163) (-1250.665) [-1250.878] -- 0:00:24
639000 -- (-1253.017) (-1253.225) [-1252.349] (-1250.627) * (-1253.313) (-1253.949) (-1251.575) [-1251.426] -- 0:00:24
639500 -- (-1254.034) (-1253.230) (-1253.510) [-1250.260] * (-1254.161) (-1253.534) (-1251.174) [-1252.029] -- 0:00:24
640000 -- [-1253.019] (-1251.912) (-1257.215) (-1252.782) * (-1255.449) (-1259.989) (-1250.490) [-1253.812] -- 0:00:24
Average standard deviation of split frequencies: 0.006882
640500 -- (-1254.322) (-1251.364) (-1257.296) [-1250.622] * [-1253.957] (-1254.774) (-1254.199) (-1252.761) -- 0:00:24
641000 -- (-1251.028) (-1250.431) (-1255.889) [-1250.103] * [-1257.308] (-1253.234) (-1254.824) (-1252.513) -- 0:00:24
641500 -- [-1253.631] (-1252.969) (-1256.062) (-1253.657) * (-1254.452) (-1252.635) (-1253.313) [-1253.401] -- 0:00:24
642000 -- (-1253.267) [-1253.135] (-1253.613) (-1251.937) * (-1253.773) (-1254.611) (-1253.227) [-1252.501] -- 0:00:23
642500 -- (-1251.977) [-1252.097] (-1250.220) (-1252.929) * (-1251.580) [-1253.157] (-1252.270) (-1257.923) -- 0:00:24
643000 -- (-1251.740) (-1251.280) [-1252.459] (-1252.277) * [-1252.772] (-1252.786) (-1253.474) (-1252.039) -- 0:00:24
643500 -- [-1253.637] (-1252.613) (-1254.338) (-1252.132) * (-1253.647) (-1251.790) [-1255.150] (-1251.904) -- 0:00:24
644000 -- (-1254.420) (-1255.831) [-1252.579] (-1252.007) * [-1255.656] (-1256.802) (-1252.612) (-1254.920) -- 0:00:24
644500 -- (-1253.665) (-1252.879) (-1255.224) [-1251.946] * (-1255.275) [-1251.634] (-1252.378) (-1252.452) -- 0:00:24
645000 -- [-1254.901] (-1252.437) (-1253.100) (-1254.396) * (-1254.909) (-1252.400) [-1251.034] (-1255.636) -- 0:00:24
Average standard deviation of split frequencies: 0.006482
645500 -- [-1251.202] (-1255.185) (-1253.784) (-1253.403) * (-1252.399) (-1252.247) [-1252.796] (-1255.785) -- 0:00:24
646000 -- [-1252.435] (-1254.076) (-1254.794) (-1252.608) * (-1251.869) (-1252.615) [-1253.226] (-1253.420) -- 0:00:24
646500 -- (-1256.963) [-1250.422] (-1252.805) (-1251.914) * (-1253.131) [-1253.982] (-1252.545) (-1253.741) -- 0:00:24
647000 -- (-1254.975) (-1252.773) [-1254.391] (-1251.535) * [-1252.794] (-1253.678) (-1252.002) (-1254.256) -- 0:00:24
647500 -- (-1252.520) [-1253.887] (-1251.466) (-1253.169) * (-1254.845) (-1252.753) (-1251.104) [-1251.778] -- 0:00:23
648000 -- (-1250.955) (-1252.174) (-1251.818) [-1252.491] * (-1252.081) (-1255.134) (-1254.246) [-1250.900] -- 0:00:23
648500 -- (-1252.889) (-1253.700) [-1253.486] (-1252.312) * (-1251.962) (-1253.841) [-1256.569] (-1253.709) -- 0:00:23
649000 -- [-1249.987] (-1252.708) (-1255.773) (-1256.339) * [-1252.049] (-1254.100) (-1253.730) (-1251.620) -- 0:00:23
649500 -- [-1255.947] (-1253.301) (-1254.240) (-1254.189) * [-1253.378] (-1255.014) (-1254.221) (-1254.013) -- 0:00:23
650000 -- [-1252.135] (-1251.505) (-1255.562) (-1251.660) * [-1253.178] (-1251.275) (-1250.957) (-1254.093) -- 0:00:23
Average standard deviation of split frequencies: 0.006606
650500 -- (-1252.103) (-1249.953) (-1254.873) [-1256.019] * (-1254.213) (-1253.010) (-1252.106) [-1254.870] -- 0:00:23
651000 -- [-1250.601] (-1251.449) (-1252.865) (-1254.584) * (-1252.001) (-1257.830) [-1252.259] (-1251.417) -- 0:00:23
651500 -- (-1253.990) (-1251.262) (-1250.777) [-1254.273] * [-1252.765] (-1252.730) (-1259.879) (-1252.185) -- 0:00:23
652000 -- [-1250.314] (-1252.122) (-1251.602) (-1252.377) * (-1253.500) (-1251.533) (-1254.406) [-1253.334] -- 0:00:23
652500 -- (-1252.891) [-1251.624] (-1251.205) (-1251.481) * (-1254.662) (-1253.149) (-1252.071) [-1252.971] -- 0:00:23
653000 -- (-1250.388) (-1250.715) [-1251.632] (-1251.798) * (-1257.867) [-1249.460] (-1252.972) (-1252.826) -- 0:00:23
653500 -- (-1251.793) (-1256.669) [-1250.219] (-1254.320) * (-1252.156) [-1252.915] (-1255.945) (-1251.700) -- 0:00:23
654000 -- (-1254.337) (-1251.825) (-1251.382) [-1251.592] * [-1256.293] (-1252.622) (-1253.962) (-1251.436) -- 0:00:23
654500 -- (-1252.411) (-1255.783) [-1254.074] (-1256.382) * (-1252.471) [-1251.787] (-1253.593) (-1251.019) -- 0:00:23
655000 -- (-1254.562) (-1254.031) [-1252.786] (-1256.592) * [-1253.657] (-1255.973) (-1252.155) (-1253.198) -- 0:00:23
Average standard deviation of split frequencies: 0.006298
655500 -- (-1251.278) (-1250.093) [-1250.467] (-1254.925) * [-1252.111] (-1252.681) (-1252.472) (-1252.439) -- 0:00:23
656000 -- [-1250.729] (-1254.057) (-1250.356) (-1253.404) * (-1250.962) [-1252.578] (-1251.880) (-1252.503) -- 0:00:23
656500 -- (-1252.654) [-1251.780] (-1252.781) (-1253.410) * (-1252.085) (-1251.707) [-1252.815] (-1250.748) -- 0:00:23
657000 -- [-1252.833] (-1252.579) (-1252.504) (-1252.074) * (-1251.856) (-1249.041) [-1251.851] (-1255.160) -- 0:00:22
657500 -- (-1249.789) [-1252.937] (-1252.735) (-1249.839) * [-1250.365] (-1249.513) (-1252.759) (-1251.310) -- 0:00:23
658000 -- (-1251.717) [-1249.182] (-1251.636) (-1253.093) * (-1252.961) (-1252.199) (-1249.996) [-1252.004] -- 0:00:23
658500 -- (-1254.754) (-1252.282) [-1252.854] (-1251.119) * (-1253.569) (-1252.436) (-1253.118) [-1251.967] -- 0:00:23
659000 -- (-1251.072) [-1251.776] (-1258.681) (-1253.232) * (-1256.266) (-1251.462) (-1256.060) [-1252.203] -- 0:00:23
659500 -- [-1254.118] (-1251.161) (-1257.803) (-1256.238) * (-1252.350) (-1250.766) [-1252.333] (-1251.950) -- 0:00:23
660000 -- (-1259.173) (-1252.455) (-1251.956) [-1253.863] * (-1253.356) (-1250.832) (-1254.022) [-1250.738] -- 0:00:23
Average standard deviation of split frequencies: 0.006590
660500 -- (-1255.120) (-1252.458) (-1249.828) [-1252.100] * (-1254.657) (-1253.820) (-1254.140) [-1250.029] -- 0:00:23
661000 -- (-1255.189) [-1250.350] (-1251.253) (-1253.254) * (-1252.132) [-1256.399] (-1253.284) (-1254.955) -- 0:00:23
661500 -- [-1255.228] (-1250.580) (-1251.076) (-1254.554) * [-1252.380] (-1255.651) (-1255.901) (-1252.622) -- 0:00:23
662000 -- [-1252.414] (-1250.185) (-1253.277) (-1253.186) * [-1253.748] (-1253.604) (-1252.706) (-1253.017) -- 0:00:22
662500 -- (-1252.555) [-1252.367] (-1252.721) (-1252.556) * (-1251.819) (-1252.729) [-1252.628] (-1252.587) -- 0:00:22
663000 -- (-1253.625) (-1253.024) (-1253.838) [-1252.436] * [-1253.832] (-1250.264) (-1251.468) (-1252.672) -- 0:00:22
663500 -- (-1255.564) (-1252.439) [-1251.090] (-1252.500) * [-1250.621] (-1253.033) (-1251.834) (-1251.868) -- 0:00:22
664000 -- (-1254.241) [-1252.539] (-1251.108) (-1250.099) * (-1255.062) [-1258.045] (-1250.633) (-1254.073) -- 0:00:22
664500 -- (-1250.746) (-1253.148) (-1254.274) [-1253.140] * [-1252.071] (-1260.167) (-1253.296) (-1251.420) -- 0:00:22
665000 -- (-1252.994) [-1251.952] (-1256.284) (-1254.397) * (-1253.465) [-1254.969] (-1251.252) (-1251.716) -- 0:00:22
Average standard deviation of split frequencies: 0.006662
665500 -- (-1253.543) (-1252.888) (-1251.972) [-1251.354] * (-1252.961) [-1255.662] (-1251.683) (-1254.506) -- 0:00:22
666000 -- (-1252.189) [-1252.823] (-1250.562) (-1250.715) * (-1252.068) (-1258.924) (-1253.005) [-1251.597] -- 0:00:22
666500 -- (-1251.098) (-1251.236) [-1252.597] (-1252.006) * [-1251.738] (-1252.919) (-1253.028) (-1251.821) -- 0:00:22
667000 -- (-1252.038) (-1250.663) (-1252.925) [-1250.859] * (-1251.882) (-1253.392) [-1250.805] (-1253.736) -- 0:00:22
667500 -- [-1251.833] (-1250.393) (-1252.317) (-1254.373) * (-1253.120) (-1259.235) [-1254.317] (-1252.399) -- 0:00:22
668000 -- (-1252.914) (-1252.061) (-1252.341) [-1252.736] * (-1258.783) (-1262.484) (-1253.736) [-1251.807] -- 0:00:22
668500 -- (-1253.428) (-1253.645) [-1252.380] (-1253.375) * (-1257.730) (-1253.952) [-1249.507] (-1251.798) -- 0:00:22
669000 -- (-1253.473) (-1252.545) (-1252.325) [-1254.013] * [-1252.512] (-1252.091) (-1251.547) (-1250.744) -- 0:00:22
669500 -- [-1253.226] (-1251.703) (-1250.378) (-1249.603) * (-1253.746) (-1252.894) (-1252.828) [-1252.737] -- 0:00:22
670000 -- (-1251.597) (-1251.422) [-1251.954] (-1250.942) * (-1253.704) (-1252.891) (-1251.673) [-1250.932] -- 0:00:22
Average standard deviation of split frequencies: 0.006409
670500 -- (-1252.206) [-1248.892] (-1254.218) (-1254.278) * (-1253.615) [-1254.051] (-1252.758) (-1253.474) -- 0:00:22
671000 -- [-1255.380] (-1251.726) (-1254.080) (-1252.236) * (-1253.199) (-1256.131) [-1254.550] (-1254.253) -- 0:00:22
671500 -- (-1253.834) (-1251.316) [-1251.702] (-1252.796) * [-1252.562] (-1252.059) (-1253.006) (-1252.369) -- 0:00:22
672000 -- (-1252.004) (-1250.973) (-1253.339) [-1251.461] * (-1253.012) (-1252.134) (-1252.462) [-1252.017] -- 0:00:21
672500 -- (-1253.026) [-1252.043] (-1254.181) (-1252.811) * (-1253.438) (-1261.560) [-1254.339] (-1251.608) -- 0:00:21
673000 -- (-1253.061) [-1251.152] (-1253.197) (-1255.659) * (-1252.475) [-1250.646] (-1254.406) (-1256.856) -- 0:00:22
673500 -- (-1255.389) (-1249.183) (-1252.099) [-1254.733] * (-1252.830) [-1252.310] (-1256.275) (-1256.244) -- 0:00:22
674000 -- (-1255.267) [-1249.936] (-1253.607) (-1252.730) * [-1252.237] (-1251.339) (-1249.786) (-1253.704) -- 0:00:22
674500 -- [-1253.485] (-1252.452) (-1255.679) (-1250.962) * (-1255.886) (-1256.470) (-1250.388) [-1253.171] -- 0:00:22
675000 -- [-1250.476] (-1252.946) (-1254.379) (-1254.899) * (-1255.422) [-1254.736] (-1251.559) (-1251.745) -- 0:00:22
Average standard deviation of split frequencies: 0.006399
675500 -- (-1249.851) [-1251.687] (-1252.097) (-1254.220) * (-1255.803) (-1254.811) [-1252.219] (-1253.451) -- 0:00:22
676000 -- (-1250.552) [-1249.708] (-1250.620) (-1253.509) * [-1254.715] (-1251.251) (-1256.624) (-1254.055) -- 0:00:22
676500 -- (-1253.168) [-1251.469] (-1251.625) (-1252.368) * [-1251.259] (-1251.768) (-1252.497) (-1251.425) -- 0:00:21
677000 -- (-1256.062) (-1254.287) [-1250.962] (-1251.865) * (-1251.302) (-1251.978) (-1254.874) [-1255.488] -- 0:00:21
677500 -- (-1257.398) (-1253.994) [-1252.234] (-1255.252) * [-1254.806] (-1257.184) (-1249.972) (-1254.780) -- 0:00:21
678000 -- (-1254.502) [-1253.683] (-1252.604) (-1252.270) * [-1252.491] (-1255.630) (-1253.090) (-1253.447) -- 0:00:21
678500 -- (-1251.450) (-1253.594) (-1254.712) [-1252.189] * (-1252.484) (-1251.399) [-1250.298] (-1251.421) -- 0:00:21
679000 -- [-1252.978] (-1251.515) (-1253.507) (-1250.534) * (-1252.530) [-1253.180] (-1252.586) (-1253.260) -- 0:00:21
679500 -- (-1255.493) (-1253.497) [-1252.770] (-1250.912) * (-1252.761) (-1252.577) (-1255.079) [-1252.392] -- 0:00:21
680000 -- (-1251.742) [-1250.701] (-1254.105) (-1252.147) * (-1250.545) [-1251.718] (-1251.942) (-1253.458) -- 0:00:21
Average standard deviation of split frequencies: 0.006406
680500 -- (-1252.589) (-1250.465) [-1251.032] (-1253.007) * (-1254.127) (-1254.421) [-1256.101] (-1252.080) -- 0:00:21
681000 -- (-1251.767) (-1251.736) (-1252.012) [-1252.963] * (-1253.273) [-1250.523] (-1252.156) (-1252.953) -- 0:00:21
681500 -- (-1251.832) (-1253.949) (-1253.242) [-1254.070] * (-1253.445) (-1253.724) [-1251.880] (-1251.832) -- 0:00:21
682000 -- (-1251.870) (-1256.166) [-1253.889] (-1250.617) * (-1250.975) (-1253.779) [-1253.865] (-1253.617) -- 0:00:21
682500 -- (-1251.922) (-1256.271) [-1255.938] (-1250.499) * (-1253.837) (-1252.256) [-1250.443] (-1253.742) -- 0:00:21
683000 -- (-1251.273) [-1253.627] (-1251.259) (-1252.283) * (-1261.897) [-1249.557] (-1254.898) (-1252.789) -- 0:00:21
683500 -- (-1253.130) (-1251.965) [-1254.020] (-1252.495) * (-1253.326) (-1252.272) (-1258.418) [-1254.864] -- 0:00:21
684000 -- [-1255.036] (-1255.058) (-1253.692) (-1251.619) * (-1255.082) (-1255.218) [-1253.989] (-1253.112) -- 0:00:21
684500 -- (-1251.675) [-1251.967] (-1250.611) (-1251.707) * (-1254.363) (-1253.499) [-1252.422] (-1255.656) -- 0:00:21
685000 -- (-1252.312) [-1253.421] (-1251.059) (-1251.991) * [-1251.803] (-1252.973) (-1252.339) (-1252.877) -- 0:00:21
Average standard deviation of split frequencies: 0.006013
685500 -- (-1254.496) (-1252.885) (-1253.186) [-1252.760] * (-1254.355) (-1250.901) [-1251.577] (-1256.265) -- 0:00:21
686000 -- (-1252.358) [-1252.755] (-1252.260) (-1252.544) * (-1254.897) (-1253.097) [-1252.541] (-1253.304) -- 0:00:21
686500 -- (-1251.975) (-1252.462) [-1251.656] (-1254.062) * (-1253.060) (-1254.244) (-1252.937) [-1251.875] -- 0:00:21
687000 -- [-1252.681] (-1251.464) (-1252.653) (-1252.914) * (-1251.510) [-1253.124] (-1251.583) (-1252.249) -- 0:00:20
687500 -- (-1251.868) (-1251.120) (-1255.193) [-1257.509] * [-1254.646] (-1251.691) (-1251.416) (-1254.893) -- 0:00:20
688000 -- (-1253.016) (-1254.480) (-1252.424) [-1252.152] * [-1252.857] (-1252.320) (-1252.348) (-1253.483) -- 0:00:21
688500 -- [-1251.725] (-1253.190) (-1251.778) (-1250.131) * (-1252.452) (-1250.100) [-1252.848] (-1252.132) -- 0:00:21
689000 -- (-1257.427) (-1253.817) (-1251.873) [-1252.353] * (-1254.067) (-1251.326) (-1253.025) [-1252.529] -- 0:00:21
689500 -- (-1250.258) [-1251.729] (-1252.067) (-1253.095) * (-1255.010) (-1251.790) [-1253.576] (-1255.887) -- 0:00:21
690000 -- (-1251.260) [-1253.093] (-1250.741) (-1254.962) * (-1254.556) (-1254.225) [-1252.122] (-1253.099) -- 0:00:21
Average standard deviation of split frequencies: 0.005802
690500 -- (-1251.575) (-1252.691) (-1251.560) [-1257.960] * (-1251.153) (-1254.266) (-1251.741) [-1252.575] -- 0:00:21
691000 -- [-1252.517] (-1252.787) (-1251.958) (-1253.662) * (-1251.983) [-1255.822] (-1251.719) (-1252.841) -- 0:00:21
691500 -- [-1251.541] (-1254.368) (-1252.329) (-1252.112) * (-1252.041) [-1255.740] (-1252.279) (-1251.891) -- 0:00:20
692000 -- (-1254.742) (-1252.263) (-1253.697) [-1255.685] * (-1253.002) (-1251.289) [-1252.739] (-1252.126) -- 0:00:20
692500 -- (-1252.105) [-1250.767] (-1254.219) (-1253.178) * (-1251.043) (-1252.853) [-1251.808] (-1253.484) -- 0:00:20
693000 -- [-1252.549] (-1251.790) (-1250.449) (-1252.818) * (-1255.090) [-1250.900] (-1255.965) (-1253.145) -- 0:00:20
693500 -- [-1252.323] (-1250.318) (-1254.443) (-1251.313) * (-1253.042) [-1251.258] (-1252.907) (-1254.698) -- 0:00:20
694000 -- (-1251.791) (-1252.542) [-1253.464] (-1250.152) * (-1250.431) (-1256.178) [-1254.188] (-1256.404) -- 0:00:20
694500 -- (-1255.722) (-1253.253) (-1250.278) [-1251.294] * (-1256.408) (-1256.043) (-1251.870) [-1251.932] -- 0:00:20
695000 -- (-1256.135) (-1252.650) [-1252.310] (-1252.025) * [-1252.498] (-1257.523) (-1251.520) (-1255.561) -- 0:00:20
Average standard deviation of split frequencies: 0.005418
695500 -- (-1253.401) (-1253.330) [-1251.185] (-1250.809) * (-1251.524) (-1255.325) [-1251.212] (-1253.171) -- 0:00:20
696000 -- [-1254.062] (-1254.555) (-1255.172) (-1251.726) * (-1254.212) (-1253.720) [-1252.515] (-1253.299) -- 0:00:20
696500 -- (-1254.492) [-1250.355] (-1252.988) (-1252.225) * (-1256.222) (-1251.737) (-1252.143) [-1253.309] -- 0:00:20
697000 -- [-1254.096] (-1255.174) (-1251.274) (-1254.672) * (-1253.279) (-1258.862) (-1254.057) [-1254.063] -- 0:00:20
697500 -- (-1252.749) [-1254.415] (-1252.356) (-1258.462) * (-1252.145) (-1252.503) (-1252.052) [-1252.133] -- 0:00:20
698000 -- (-1252.335) (-1252.201) (-1251.940) [-1250.668] * (-1253.381) [-1251.691] (-1253.247) (-1250.538) -- 0:00:20
698500 -- [-1253.515] (-1253.704) (-1251.080) (-1253.785) * [-1254.210] (-1252.050) (-1254.413) (-1249.545) -- 0:00:20
699000 -- (-1253.836) (-1253.802) [-1250.761] (-1253.007) * (-1255.451) (-1251.819) (-1257.476) [-1251.799] -- 0:00:20
699500 -- (-1260.374) [-1250.890] (-1254.946) (-1251.085) * (-1253.614) [-1251.258] (-1254.021) (-1255.966) -- 0:00:20
700000 -- [-1253.856] (-1253.059) (-1254.248) (-1251.402) * (-1257.626) (-1250.579) (-1252.900) [-1254.013] -- 0:00:20
Average standard deviation of split frequencies: 0.005677
700500 -- (-1253.290) [-1251.633] (-1255.170) (-1257.634) * [-1252.340] (-1252.307) (-1252.238) (-1252.541) -- 0:00:20
701000 -- [-1251.303] (-1252.150) (-1249.658) (-1251.100) * (-1251.928) [-1252.188] (-1251.538) (-1253.692) -- 0:00:20
701500 -- (-1252.485) (-1252.145) [-1253.538] (-1250.773) * (-1251.371) (-1254.591) [-1251.885] (-1253.187) -- 0:00:19
702000 -- (-1250.393) (-1254.509) (-1252.602) [-1250.569] * [-1252.482] (-1252.457) (-1253.880) (-1251.312) -- 0:00:19
702500 -- (-1252.601) (-1252.907) [-1251.617] (-1251.398) * (-1252.703) (-1251.840) [-1253.990] (-1253.007) -- 0:00:19
703000 -- (-1253.450) (-1253.801) (-1249.684) [-1251.415] * (-1252.605) [-1250.521] (-1251.880) (-1252.136) -- 0:00:20
703500 -- (-1251.041) (-1251.565) (-1252.437) [-1251.627] * (-1252.704) (-1252.010) (-1251.598) [-1254.457] -- 0:00:20
704000 -- (-1249.265) (-1255.451) (-1252.589) [-1252.154] * (-1254.896) (-1253.014) [-1253.348] (-1258.094) -- 0:00:20
704500 -- (-1250.992) [-1254.167] (-1253.781) (-1253.040) * (-1252.490) [-1250.483] (-1250.561) (-1254.075) -- 0:00:20
705000 -- (-1251.124) (-1257.306) [-1253.916] (-1252.246) * (-1256.182) [-1251.774] (-1250.733) (-1253.054) -- 0:00:20
Average standard deviation of split frequencies: 0.005968
705500 -- (-1249.966) (-1253.371) (-1250.967) [-1252.913] * (-1253.833) (-1255.788) [-1250.672] (-1251.096) -- 0:00:20
706000 -- (-1249.546) (-1254.177) (-1252.541) [-1252.469] * (-1253.446) (-1250.099) [-1253.525] (-1256.508) -- 0:00:19
706500 -- (-1251.393) [-1251.931] (-1252.824) (-1255.615) * (-1252.735) (-1253.953) [-1253.338] (-1253.178) -- 0:00:19
707000 -- (-1251.673) (-1253.793) [-1259.119] (-1252.655) * (-1253.208) (-1255.454) [-1253.814] (-1252.271) -- 0:00:19
707500 -- (-1251.665) (-1251.151) (-1254.872) [-1253.169] * [-1256.115] (-1253.377) (-1252.187) (-1255.015) -- 0:00:19
708000 -- (-1251.837) (-1255.295) (-1250.866) [-1251.908] * (-1255.557) (-1259.713) (-1250.640) [-1251.385] -- 0:00:19
708500 -- [-1250.760] (-1255.468) (-1250.961) (-1250.853) * (-1255.076) (-1252.595) [-1253.049] (-1253.555) -- 0:00:19
709000 -- [-1252.316] (-1250.512) (-1258.884) (-1253.585) * (-1255.139) (-1252.132) [-1260.058] (-1255.792) -- 0:00:19
709500 -- (-1250.033) (-1253.525) (-1253.613) [-1252.224] * (-1251.023) (-1252.880) [-1254.508] (-1252.534) -- 0:00:19
710000 -- (-1254.793) (-1253.757) (-1252.288) [-1252.825] * (-1252.895) (-1254.788) [-1254.502] (-1251.591) -- 0:00:19
Average standard deviation of split frequencies: 0.006011
710500 -- (-1251.653) (-1256.101) [-1250.666] (-1256.901) * [-1252.531] (-1252.140) (-1252.874) (-1250.599) -- 0:00:19
711000 -- (-1255.358) [-1254.535] (-1252.222) (-1253.196) * (-1253.077) [-1254.922] (-1250.799) (-1252.527) -- 0:00:19
711500 -- (-1255.462) [-1252.040] (-1254.297) (-1251.039) * [-1252.332] (-1249.714) (-1256.176) (-1254.091) -- 0:00:19
712000 -- (-1254.268) (-1252.612) [-1251.511] (-1255.505) * (-1251.490) (-1249.874) (-1258.170) [-1249.497] -- 0:00:19
712500 -- (-1254.782) [-1251.180] (-1253.736) (-1253.298) * (-1251.974) [-1253.514] (-1250.838) (-1254.254) -- 0:00:19
713000 -- (-1252.517) (-1251.275) [-1252.480] (-1251.882) * (-1254.360) (-1251.396) [-1251.845] (-1253.570) -- 0:00:19
713500 -- (-1253.471) (-1252.606) (-1252.941) [-1252.786] * (-1256.460) [-1251.026] (-1252.681) (-1254.462) -- 0:00:19
714000 -- (-1253.671) (-1252.973) [-1253.201] (-1252.268) * (-1251.025) [-1252.701] (-1253.576) (-1255.061) -- 0:00:19
714500 -- (-1254.540) (-1254.235) [-1252.193] (-1254.912) * (-1251.379) [-1253.836] (-1252.587) (-1257.085) -- 0:00:19
715000 -- [-1256.227] (-1252.436) (-1251.020) (-1251.271) * (-1250.149) (-1255.087) [-1251.858] (-1254.796) -- 0:00:19
Average standard deviation of split frequencies: 0.005843
715500 -- (-1253.241) [-1252.770] (-1254.346) (-1252.746) * [-1250.801] (-1251.568) (-1257.114) (-1253.121) -- 0:00:19
716000 -- (-1253.786) (-1253.091) [-1253.203] (-1252.768) * [-1253.819] (-1251.460) (-1250.392) (-1249.812) -- 0:00:19
716500 -- (-1254.500) (-1252.752) (-1256.186) [-1255.563] * (-1254.636) (-1250.054) [-1251.369] (-1254.792) -- 0:00:18
717000 -- [-1255.491] (-1252.162) (-1252.342) (-1258.100) * (-1251.226) (-1250.818) (-1251.701) [-1252.400] -- 0:00:18
717500 -- (-1255.389) [-1254.002] (-1253.531) (-1253.541) * [-1253.204] (-1252.140) (-1253.829) (-1251.531) -- 0:00:19
718000 -- [-1251.416] (-1253.143) (-1253.111) (-1252.276) * (-1252.676) (-1251.209) [-1252.303] (-1251.789) -- 0:00:19
718500 -- (-1254.304) (-1253.268) (-1251.586) [-1252.981] * (-1255.000) (-1253.169) (-1251.482) [-1251.505] -- 0:00:19
719000 -- [-1253.298] (-1252.396) (-1257.378) (-1254.435) * [-1252.083] (-1254.237) (-1250.535) (-1251.176) -- 0:00:19
719500 -- (-1254.279) (-1255.124) (-1252.004) [-1250.495] * (-1255.042) [-1253.521] (-1255.511) (-1250.789) -- 0:00:19
720000 -- (-1252.662) [-1251.138] (-1254.058) (-1252.791) * (-1253.344) (-1256.748) [-1255.074] (-1253.051) -- 0:00:19
Average standard deviation of split frequencies: 0.005846
720500 -- [-1253.236] (-1251.457) (-1254.398) (-1253.155) * (-1258.255) [-1255.647] (-1253.380) (-1252.408) -- 0:00:19
721000 -- (-1253.433) [-1252.420] (-1252.723) (-1252.096) * [-1252.963] (-1255.447) (-1251.850) (-1256.800) -- 0:00:18
721500 -- (-1253.761) [-1249.754] (-1254.513) (-1249.955) * [-1251.200] (-1251.248) (-1253.769) (-1258.160) -- 0:00:18
722000 -- [-1252.751] (-1253.141) (-1254.617) (-1250.747) * (-1253.220) (-1252.902) [-1251.892] (-1251.505) -- 0:00:18
722500 -- (-1253.789) (-1251.898) [-1253.388] (-1251.373) * (-1254.816) [-1250.913] (-1251.913) (-1251.179) -- 0:00:18
723000 -- (-1251.202) (-1251.887) (-1252.866) [-1251.289] * (-1250.722) (-1255.828) (-1253.515) [-1251.500] -- 0:00:18
723500 -- (-1251.229) [-1252.190] (-1253.113) (-1252.622) * [-1251.606] (-1254.040) (-1253.640) (-1256.827) -- 0:00:18
724000 -- (-1252.079) [-1251.566] (-1253.610) (-1257.548) * (-1254.064) (-1251.654) [-1255.249] (-1252.654) -- 0:00:18
724500 -- (-1250.629) (-1250.871) [-1252.359] (-1252.401) * (-1252.492) [-1252.156] (-1253.931) (-1254.043) -- 0:00:18
725000 -- [-1254.316] (-1251.450) (-1252.947) (-1252.634) * (-1252.869) (-1251.062) [-1252.057] (-1254.025) -- 0:00:18
Average standard deviation of split frequencies: 0.006169
725500 -- (-1262.662) [-1251.154] (-1251.487) (-1250.881) * (-1257.116) (-1251.422) (-1251.400) [-1252.061] -- 0:00:18
726000 -- (-1252.762) [-1252.466] (-1251.182) (-1252.601) * (-1252.486) (-1253.215) (-1254.699) [-1252.088] -- 0:00:18
726500 -- (-1253.397) (-1252.296) (-1258.773) [-1252.024] * (-1252.986) (-1252.658) (-1253.926) [-1253.619] -- 0:00:18
727000 -- (-1252.200) (-1251.791) [-1253.909] (-1252.577) * [-1251.450] (-1252.640) (-1251.815) (-1253.606) -- 0:00:18
727500 -- (-1253.949) [-1252.611] (-1255.281) (-1252.437) * (-1252.971) (-1253.137) [-1254.553] (-1251.399) -- 0:00:18
728000 -- (-1257.941) (-1254.185) [-1253.679] (-1251.437) * (-1254.163) [-1252.672] (-1256.231) (-1257.571) -- 0:00:18
728500 -- [-1254.198] (-1253.617) (-1253.434) (-1253.257) * (-1253.924) (-1254.357) (-1256.255) [-1255.274] -- 0:00:18
729000 -- (-1253.713) [-1252.628] (-1253.229) (-1256.280) * [-1251.165] (-1252.329) (-1253.349) (-1256.192) -- 0:00:18
729500 -- (-1253.266) (-1252.161) [-1253.750] (-1250.467) * [-1249.679] (-1251.761) (-1253.255) (-1253.913) -- 0:00:18
730000 -- [-1255.303] (-1253.646) (-1252.953) (-1250.404) * (-1252.623) [-1253.725] (-1253.831) (-1251.218) -- 0:00:18
Average standard deviation of split frequencies: 0.006774
730500 -- (-1254.306) [-1252.001] (-1257.896) (-1259.183) * (-1254.757) (-1251.722) [-1251.361] (-1252.936) -- 0:00:18
731000 -- (-1252.367) (-1251.765) [-1256.407] (-1250.844) * (-1253.615) [-1250.693] (-1252.644) (-1254.905) -- 0:00:18
731500 -- (-1252.519) [-1253.359] (-1254.812) (-1250.106) * (-1254.771) [-1251.993] (-1252.515) (-1252.226) -- 0:00:17
732000 -- (-1252.896) (-1256.997) (-1252.536) [-1251.797] * (-1256.476) [-1251.645] (-1256.806) (-1251.318) -- 0:00:17
732500 -- (-1253.691) (-1258.457) [-1252.041] (-1251.304) * [-1250.908] (-1252.949) (-1255.832) (-1250.352) -- 0:00:17
733000 -- [-1253.635] (-1253.273) (-1255.147) (-1254.980) * (-1252.261) [-1254.108] (-1258.394) (-1253.353) -- 0:00:18
733500 -- (-1254.944) (-1253.260) (-1254.979) [-1257.000] * [-1253.150] (-1251.634) (-1252.351) (-1254.349) -- 0:00:18
734000 -- (-1254.906) (-1256.460) [-1251.070] (-1254.787) * (-1252.547) (-1252.871) [-1250.978] (-1251.627) -- 0:00:18
734500 -- (-1255.573) (-1252.023) [-1252.012] (-1255.182) * (-1249.952) (-1254.298) (-1255.403) [-1257.824] -- 0:00:18
735000 -- (-1251.693) [-1253.190] (-1253.305) (-1249.203) * (-1252.869) (-1253.549) (-1257.189) [-1251.060] -- 0:00:18
Average standard deviation of split frequencies: 0.007045
735500 -- (-1253.739) (-1252.800) (-1251.975) [-1253.776] * (-1250.835) (-1252.487) [-1254.728] (-1252.775) -- 0:00:17
736000 -- (-1254.069) (-1252.506) (-1257.889) [-1251.455] * (-1251.044) [-1250.078] (-1252.606) (-1254.332) -- 0:00:17
736500 -- (-1251.936) (-1252.109) (-1252.943) [-1252.687] * [-1252.251] (-1254.681) (-1253.641) (-1252.336) -- 0:00:17
737000 -- (-1254.088) (-1253.222) (-1255.093) [-1253.437] * (-1250.805) (-1253.383) [-1258.303] (-1254.350) -- 0:00:17
737500 -- (-1253.330) (-1254.291) [-1252.800] (-1254.084) * (-1252.503) (-1255.837) (-1260.139) [-1260.703] -- 0:00:17
738000 -- [-1254.466] (-1253.010) (-1254.030) (-1256.506) * (-1251.425) (-1253.785) (-1251.413) [-1250.560] -- 0:00:17
738500 -- (-1256.946) [-1252.293] (-1249.999) (-1252.660) * [-1252.006] (-1253.999) (-1252.025) (-1250.794) -- 0:00:17
739000 -- (-1253.792) (-1253.283) (-1251.739) [-1254.003] * (-1250.822) (-1255.379) [-1253.254] (-1252.224) -- 0:00:17
739500 -- (-1251.943) (-1255.851) [-1252.204] (-1252.839) * (-1252.141) [-1252.938] (-1250.909) (-1252.735) -- 0:00:17
740000 -- (-1251.747) [-1252.625] (-1254.627) (-1254.951) * [-1249.899] (-1252.663) (-1251.443) (-1253.716) -- 0:00:17
Average standard deviation of split frequencies: 0.007001
740500 -- (-1254.012) [-1252.557] (-1254.824) (-1252.910) * (-1251.650) (-1251.803) [-1251.894] (-1251.763) -- 0:00:17
741000 -- [-1249.933] (-1254.284) (-1253.946) (-1250.817) * (-1250.445) (-1253.715) [-1251.946] (-1252.659) -- 0:00:17
741500 -- (-1250.925) [-1254.594] (-1253.379) (-1251.797) * [-1251.525] (-1254.291) (-1251.685) (-1251.935) -- 0:00:17
742000 -- (-1250.400) (-1253.656) [-1255.787] (-1250.787) * (-1254.567) (-1255.613) [-1250.897] (-1250.164) -- 0:00:17
742500 -- [-1251.008] (-1253.316) (-1255.527) (-1256.706) * (-1255.578) [-1253.257] (-1254.892) (-1252.535) -- 0:00:17
743000 -- (-1253.058) (-1251.711) [-1253.623] (-1253.624) * (-1249.984) [-1251.552] (-1250.603) (-1251.865) -- 0:00:17
743500 -- (-1252.105) (-1251.184) [-1255.473] (-1254.419) * [-1256.340] (-1249.857) (-1251.110) (-1251.561) -- 0:00:17
744000 -- (-1258.144) [-1250.868] (-1255.866) (-1253.436) * (-1254.323) [-1250.347] (-1251.313) (-1252.317) -- 0:00:17
744500 -- (-1252.273) (-1253.597) (-1251.536) [-1252.029] * (-1253.242) [-1251.756] (-1251.360) (-1253.735) -- 0:00:17
745000 -- [-1252.028] (-1251.463) (-1253.733) (-1253.218) * [-1250.480] (-1253.759) (-1253.953) (-1253.883) -- 0:00:17
Average standard deviation of split frequencies: 0.006635
745500 -- (-1254.731) (-1251.626) (-1256.683) [-1252.873] * (-1250.596) (-1254.282) [-1254.431] (-1253.305) -- 0:00:17
746000 -- [-1249.905] (-1251.750) (-1256.282) (-1252.771) * (-1255.789) (-1251.326) (-1253.152) [-1254.888] -- 0:00:17
746500 -- [-1252.046] (-1252.424) (-1254.629) (-1253.635) * [-1252.787] (-1252.906) (-1250.823) (-1252.270) -- 0:00:16
747000 -- (-1250.807) (-1250.803) [-1252.233] (-1252.792) * (-1252.813) (-1254.092) (-1252.422) [-1251.685] -- 0:00:16
747500 -- (-1255.223) (-1250.797) (-1253.621) [-1254.761] * (-1252.509) (-1249.887) [-1252.241] (-1255.840) -- 0:00:16
748000 -- (-1250.405) (-1250.455) [-1253.196] (-1252.738) * [-1253.142] (-1250.952) (-1252.455) (-1254.234) -- 0:00:17
748500 -- (-1252.991) (-1251.003) (-1255.130) [-1253.223] * [-1250.871] (-1252.831) (-1251.841) (-1251.317) -- 0:00:17
749000 -- (-1253.274) [-1251.605] (-1259.210) (-1254.437) * (-1251.983) [-1251.417] (-1252.225) (-1251.821) -- 0:00:17
749500 -- [-1249.595] (-1251.723) (-1258.197) (-1253.882) * (-1254.543) [-1251.903] (-1253.385) (-1250.347) -- 0:00:17
750000 -- (-1251.931) (-1250.566) (-1251.506) [-1250.371] * (-1252.865) (-1254.726) [-1252.169] (-1252.096) -- 0:00:17
Average standard deviation of split frequencies: 0.006084
750500 -- (-1251.301) (-1250.758) (-1252.841) [-1250.968] * [-1254.787] (-1253.871) (-1249.931) (-1255.449) -- 0:00:16
751000 -- [-1251.301] (-1253.670) (-1254.250) (-1250.423) * (-1250.733) (-1255.859) [-1252.115] (-1252.139) -- 0:00:16
751500 -- (-1253.242) [-1253.064] (-1251.864) (-1251.449) * (-1255.753) (-1251.352) [-1250.056] (-1253.486) -- 0:00:16
752000 -- (-1251.633) (-1253.858) [-1251.408] (-1256.899) * (-1253.797) [-1255.400] (-1251.147) (-1253.981) -- 0:00:16
752500 -- (-1250.477) [-1249.949] (-1251.653) (-1254.698) * (-1255.581) (-1251.313) (-1257.595) [-1255.463] -- 0:00:16
753000 -- [-1253.539] (-1251.731) (-1253.332) (-1257.060) * (-1251.643) (-1252.151) (-1253.662) [-1252.506] -- 0:00:16
753500 -- (-1254.410) (-1255.101) [-1252.943] (-1259.503) * (-1254.857) (-1253.583) (-1253.795) [-1253.896] -- 0:00:16
754000 -- [-1253.433] (-1253.171) (-1252.878) (-1250.107) * (-1254.333) (-1254.241) (-1254.081) [-1250.327] -- 0:00:16
754500 -- (-1254.349) (-1254.213) (-1251.762) [-1253.158] * (-1257.548) (-1250.505) (-1256.611) [-1254.222] -- 0:00:16
755000 -- [-1249.104] (-1252.200) (-1254.045) (-1253.359) * (-1256.914) (-1256.358) [-1254.392] (-1260.705) -- 0:00:16
Average standard deviation of split frequencies: 0.006002
755500 -- [-1252.121] (-1251.206) (-1253.206) (-1253.275) * (-1252.737) [-1252.119] (-1253.433) (-1250.807) -- 0:00:16
756000 -- [-1251.310] (-1252.671) (-1251.258) (-1255.315) * [-1251.731] (-1254.805) (-1255.408) (-1254.925) -- 0:00:16
756500 -- (-1250.915) [-1250.984] (-1251.388) (-1250.918) * (-1252.153) (-1252.043) (-1252.924) [-1257.640] -- 0:00:16
757000 -- [-1249.367] (-1251.574) (-1252.736) (-1252.035) * (-1249.419) (-1252.872) (-1252.741) [-1254.181] -- 0:00:16
757500 -- (-1252.754) [-1251.731] (-1252.183) (-1250.570) * (-1260.834) [-1253.162] (-1251.848) (-1254.301) -- 0:00:16
758000 -- (-1253.596) [-1252.346] (-1252.558) (-1249.967) * [-1255.110] (-1253.237) (-1252.458) (-1254.481) -- 0:00:16
758500 -- [-1253.072] (-1255.039) (-1251.847) (-1253.480) * (-1255.706) (-1259.950) [-1252.187] (-1250.970) -- 0:00:16
759000 -- (-1253.096) (-1251.531) [-1258.497] (-1251.343) * (-1259.166) (-1250.147) (-1260.428) [-1252.228] -- 0:00:16
759500 -- [-1249.601] (-1250.359) (-1254.997) (-1250.976) * (-1252.946) [-1252.346] (-1255.991) (-1249.949) -- 0:00:16
760000 -- (-1255.622) [-1248.806] (-1253.027) (-1257.830) * (-1250.580) (-1249.670) (-1252.586) [-1250.674] -- 0:00:16
Average standard deviation of split frequencies: 0.005965
760500 -- (-1251.541) (-1251.899) (-1250.483) [-1256.738] * (-1253.959) (-1250.797) (-1251.368) [-1249.108] -- 0:00:16
761000 -- (-1256.981) (-1253.008) [-1250.871] (-1251.641) * (-1251.630) [-1251.563] (-1255.383) (-1250.324) -- 0:00:16
761500 -- [-1254.820] (-1250.433) (-1253.377) (-1250.794) * (-1255.631) (-1251.395) (-1253.835) [-1251.393] -- 0:00:15
762000 -- (-1251.374) (-1252.998) (-1254.037) [-1251.029] * [-1251.501] (-1250.946) (-1254.879) (-1253.846) -- 0:00:15
762500 -- (-1254.994) (-1253.082) [-1252.032] (-1252.595) * [-1251.926] (-1250.714) (-1253.494) (-1256.382) -- 0:00:15
763000 -- (-1255.777) (-1251.508) (-1251.900) [-1250.545] * [-1251.099] (-1251.091) (-1251.563) (-1252.728) -- 0:00:16
763500 -- (-1252.013) (-1257.844) (-1251.384) [-1251.662] * (-1250.089) [-1252.980] (-1253.255) (-1253.708) -- 0:00:16
764000 -- (-1251.526) [-1252.681] (-1251.787) (-1255.097) * (-1249.559) [-1252.260] (-1255.873) (-1253.834) -- 0:00:16
764500 -- (-1252.964) (-1252.686) [-1253.644] (-1256.302) * (-1250.594) (-1255.383) [-1251.305] (-1250.603) -- 0:00:16
765000 -- (-1254.046) (-1252.216) [-1253.436] (-1250.110) * (-1256.002) [-1250.128] (-1254.294) (-1249.393) -- 0:00:15
Average standard deviation of split frequencies: 0.006116
765500 -- [-1255.203] (-1251.099) (-1251.949) (-1250.936) * (-1253.047) (-1251.277) [-1252.655] (-1254.617) -- 0:00:15
766000 -- (-1255.365) (-1252.383) [-1252.827] (-1250.693) * [-1253.798] (-1252.698) (-1252.957) (-1260.002) -- 0:00:15
766500 -- (-1256.820) (-1251.392) (-1256.376) [-1251.288] * [-1260.215] (-1253.091) (-1252.135) (-1254.157) -- 0:00:15
767000 -- (-1257.880) [-1253.189] (-1253.280) (-1250.047) * (-1253.301) (-1252.182) (-1252.161) [-1251.447] -- 0:00:15
767500 -- (-1251.955) (-1252.505) (-1252.007) [-1251.288] * (-1258.680) (-1249.807) (-1254.394) [-1250.198] -- 0:00:15
768000 -- (-1252.074) (-1255.410) (-1252.828) [-1251.532] * [-1253.193] (-1250.000) (-1255.788) (-1251.905) -- 0:00:15
768500 -- (-1251.667) (-1253.637) [-1253.439] (-1250.597) * [-1254.187] (-1253.296) (-1254.465) (-1250.099) -- 0:00:15
769000 -- [-1250.254] (-1254.271) (-1255.093) (-1251.541) * (-1254.055) (-1253.478) (-1252.425) [-1250.009] -- 0:00:15
769500 -- (-1251.529) (-1252.193) [-1250.891] (-1253.073) * (-1249.870) (-1257.286) (-1252.784) [-1252.506] -- 0:00:15
770000 -- (-1254.840) [-1252.902] (-1256.407) (-1252.811) * (-1251.657) (-1251.778) [-1253.123] (-1256.491) -- 0:00:15
Average standard deviation of split frequencies: 0.006040
770500 -- (-1253.752) [-1252.023] (-1254.400) (-1252.179) * (-1255.693) [-1249.163] (-1256.025) (-1252.339) -- 0:00:15
771000 -- (-1253.237) [-1251.916] (-1253.288) (-1250.365) * (-1254.090) (-1252.020) (-1251.333) [-1253.802] -- 0:00:15
771500 -- (-1257.082) [-1251.854] (-1252.284) (-1250.866) * [-1253.359] (-1252.227) (-1249.543) (-1253.387) -- 0:00:15
772000 -- (-1252.167) (-1252.565) (-1251.573) [-1253.337] * (-1252.754) [-1251.781] (-1251.131) (-1252.601) -- 0:00:15
772500 -- (-1255.041) (-1253.667) (-1251.383) [-1251.410] * [-1252.177] (-1254.681) (-1253.230) (-1253.062) -- 0:00:15
773000 -- (-1253.844) [-1253.737] (-1253.977) (-1254.437) * [-1252.731] (-1252.337) (-1252.188) (-1252.769) -- 0:00:15
773500 -- [-1252.479] (-1255.743) (-1252.268) (-1253.233) * (-1251.136) (-1253.255) (-1253.746) [-1252.064] -- 0:00:15
774000 -- (-1253.047) [-1251.949] (-1257.852) (-1250.908) * (-1252.370) (-1254.073) [-1252.702] (-1253.059) -- 0:00:15
774500 -- (-1254.686) [-1251.159] (-1252.139) (-1251.976) * (-1252.542) (-1253.419) [-1254.891] (-1253.120) -- 0:00:15
775000 -- [-1251.940] (-1252.394) (-1251.272) (-1255.939) * (-1252.678) (-1252.719) [-1249.311] (-1252.524) -- 0:00:15
Average standard deviation of split frequencies: 0.006111
775500 -- (-1257.552) (-1256.993) (-1252.581) [-1252.694] * [-1252.977] (-1252.508) (-1252.667) (-1250.518) -- 0:00:15
776000 -- (-1253.861) (-1254.857) (-1258.029) [-1251.782] * (-1253.882) (-1254.561) [-1254.248] (-1252.309) -- 0:00:15
776500 -- (-1254.388) (-1253.412) (-1253.435) [-1254.547] * [-1250.415] (-1254.992) (-1251.312) (-1258.022) -- 0:00:14
777000 -- (-1252.549) (-1250.975) [-1252.892] (-1251.322) * (-1251.962) (-1251.232) [-1253.193] (-1253.977) -- 0:00:14
777500 -- [-1251.364] (-1251.268) (-1253.007) (-1254.023) * (-1250.942) (-1253.833) (-1250.651) [-1255.946] -- 0:00:14
778000 -- [-1252.876] (-1249.931) (-1252.992) (-1252.358) * (-1252.513) (-1251.820) (-1251.615) [-1249.597] -- 0:00:15
778500 -- (-1251.677) [-1250.706] (-1253.732) (-1254.500) * (-1253.910) [-1252.005] (-1251.922) (-1250.282) -- 0:00:15
779000 -- (-1252.986) (-1251.192) [-1251.323] (-1253.954) * (-1253.897) (-1254.426) (-1252.531) [-1254.035] -- 0:00:15
779500 -- (-1253.358) (-1254.508) (-1254.295) [-1251.109] * [-1251.950] (-1254.619) (-1250.631) (-1252.717) -- 0:00:14
780000 -- [-1255.167] (-1252.252) (-1253.750) (-1252.857) * [-1251.767] (-1252.746) (-1251.664) (-1251.654) -- 0:00:14
Average standard deviation of split frequencies: 0.006562
780500 -- (-1250.709) [-1250.754] (-1253.980) (-1252.396) * (-1250.246) (-1253.295) (-1252.289) [-1252.331] -- 0:00:14
781000 -- (-1251.505) (-1252.336) [-1255.719] (-1251.902) * (-1256.727) (-1254.470) [-1250.262] (-1256.490) -- 0:00:14
781500 -- (-1252.735) [-1252.025] (-1253.635) (-1258.238) * [-1253.347] (-1256.051) (-1251.584) (-1249.584) -- 0:00:14
782000 -- (-1250.571) [-1251.049] (-1254.691) (-1254.458) * (-1254.341) (-1258.681) (-1249.917) [-1251.700] -- 0:00:14
782500 -- [-1250.187] (-1256.600) (-1254.041) (-1255.458) * (-1254.230) [-1254.908] (-1251.001) (-1251.598) -- 0:00:14
783000 -- (-1253.868) (-1252.153) (-1253.046) [-1254.629] * (-1254.222) (-1251.049) (-1251.582) [-1252.862] -- 0:00:14
783500 -- (-1252.798) (-1257.625) [-1254.474] (-1252.471) * (-1251.881) (-1251.092) [-1250.746] (-1252.901) -- 0:00:14
784000 -- [-1250.857] (-1252.977) (-1255.721) (-1252.302) * (-1252.412) (-1251.547) (-1253.039) [-1252.167] -- 0:00:14
784500 -- [-1250.514] (-1252.704) (-1255.479) (-1254.716) * (-1254.661) (-1250.723) [-1252.694] (-1252.106) -- 0:00:14
785000 -- (-1252.153) [-1251.750] (-1253.249) (-1258.057) * (-1251.872) [-1252.172] (-1254.112) (-1251.452) -- 0:00:14
Average standard deviation of split frequencies: 0.006485
785500 -- (-1252.152) (-1252.644) (-1255.134) [-1252.063] * (-1252.227) [-1255.193] (-1255.553) (-1250.615) -- 0:00:14
786000 -- (-1251.399) (-1251.434) (-1251.979) [-1253.184] * (-1251.138) (-1250.606) [-1252.010] (-1252.152) -- 0:00:14
786500 -- [-1251.050] (-1253.676) (-1253.090) (-1252.685) * (-1253.908) [-1251.364] (-1253.067) (-1254.143) -- 0:00:14
787000 -- (-1250.357) (-1252.341) [-1255.080] (-1252.554) * (-1251.913) [-1255.407] (-1252.631) (-1251.226) -- 0:00:14
787500 -- (-1249.817) [-1248.935] (-1253.725) (-1253.568) * (-1252.666) [-1249.939] (-1251.669) (-1250.766) -- 0:00:14
788000 -- (-1250.960) (-1251.568) (-1257.565) [-1252.327] * (-1252.082) (-1252.206) [-1252.821] (-1255.072) -- 0:00:14
788500 -- [-1255.074] (-1253.634) (-1255.221) (-1255.158) * [-1253.691] (-1255.345) (-1254.741) (-1257.821) -- 0:00:14
789000 -- (-1252.949) [-1255.656] (-1252.156) (-1254.285) * (-1252.790) [-1254.379] (-1254.558) (-1251.641) -- 0:00:14
789500 -- (-1249.708) [-1252.151] (-1256.259) (-1252.267) * (-1251.493) (-1254.645) [-1251.521] (-1249.441) -- 0:00:14
790000 -- (-1251.228) [-1253.355] (-1257.389) (-1252.752) * (-1253.976) (-1252.637) [-1251.943] (-1250.832) -- 0:00:14
Average standard deviation of split frequencies: 0.005857
790500 -- (-1252.825) [-1250.919] (-1253.276) (-1249.757) * (-1253.078) (-1256.031) (-1253.564) [-1254.187] -- 0:00:14
791000 -- (-1252.812) (-1252.406) (-1253.461) [-1250.295] * [-1251.210] (-1251.249) (-1252.406) (-1254.432) -- 0:00:14
791500 -- [-1255.203] (-1251.080) (-1251.172) (-1253.382) * [-1253.451] (-1252.768) (-1255.164) (-1253.017) -- 0:00:13
792000 -- (-1254.023) [-1251.022] (-1250.450) (-1256.361) * (-1249.390) (-1253.482) [-1251.852] (-1257.649) -- 0:00:13
792500 -- (-1254.056) [-1250.140] (-1254.201) (-1252.464) * (-1252.597) (-1252.049) (-1251.693) [-1253.965] -- 0:00:13
793000 -- [-1250.423] (-1258.209) (-1253.945) (-1252.618) * (-1252.789) (-1254.223) (-1256.225) [-1255.511] -- 0:00:14
793500 -- (-1253.882) (-1251.652) (-1250.575) [-1251.505] * (-1260.900) (-1250.786) (-1253.807) [-1258.619] -- 0:00:14
794000 -- (-1253.708) (-1253.717) [-1251.252] (-1253.658) * [-1250.225] (-1252.013) (-1254.132) (-1253.559) -- 0:00:14
794500 -- (-1252.380) (-1250.666) (-1252.324) [-1251.819] * (-1251.644) (-1252.240) [-1251.513] (-1252.148) -- 0:00:13
795000 -- [-1251.767] (-1251.701) (-1252.031) (-1252.474) * (-1254.489) [-1253.043] (-1252.493) (-1252.342) -- 0:00:13
Average standard deviation of split frequencies: 0.006159
795500 -- (-1254.909) [-1250.479] (-1256.492) (-1251.838) * (-1251.124) [-1253.988] (-1253.776) (-1252.748) -- 0:00:13
796000 -- (-1252.581) [-1254.316] (-1255.255) (-1252.549) * [-1253.807] (-1251.275) (-1252.579) (-1251.386) -- 0:00:13
796500 -- [-1250.942] (-1252.701) (-1255.080) (-1255.346) * (-1256.718) (-1253.689) [-1253.760] (-1252.517) -- 0:00:13
797000 -- (-1252.020) [-1252.183] (-1252.154) (-1250.687) * [-1250.734] (-1257.339) (-1255.751) (-1253.041) -- 0:00:13
797500 -- (-1253.707) [-1252.130] (-1252.977) (-1250.341) * (-1252.292) [-1252.147] (-1254.540) (-1252.796) -- 0:00:13
798000 -- (-1255.591) [-1254.699] (-1253.872) (-1251.955) * (-1252.170) (-1256.534) [-1255.948] (-1253.420) -- 0:00:13
798500 -- (-1254.595) (-1252.365) [-1251.278] (-1250.503) * (-1253.478) (-1251.792) (-1253.028) [-1252.107] -- 0:00:13
799000 -- [-1253.477] (-1250.621) (-1256.790) (-1252.124) * (-1252.882) [-1253.012] (-1251.697) (-1251.327) -- 0:00:13
799500 -- (-1256.239) [-1251.783] (-1262.525) (-1250.228) * (-1259.517) [-1254.022] (-1251.727) (-1251.911) -- 0:00:13
800000 -- (-1251.533) (-1251.591) (-1256.059) [-1249.488] * [-1256.157] (-1254.298) (-1250.885) (-1251.639) -- 0:00:13
Average standard deviation of split frequencies: 0.006476
800500 -- [-1257.688] (-1252.022) (-1262.523) (-1251.481) * (-1253.052) (-1251.003) (-1252.938) [-1256.098] -- 0:00:13
801000 -- (-1251.420) (-1250.008) [-1252.143] (-1250.692) * (-1255.821) (-1251.339) (-1252.234) [-1250.885] -- 0:00:13
801500 -- [-1253.728] (-1254.265) (-1254.658) (-1249.889) * (-1253.276) (-1251.953) [-1253.003] (-1252.498) -- 0:00:13
802000 -- (-1252.241) [-1252.778] (-1255.072) (-1252.255) * (-1251.327) (-1252.157) [-1249.690] (-1252.668) -- 0:00:13
802500 -- (-1252.341) (-1256.597) (-1251.290) [-1251.300] * (-1254.468) (-1253.087) [-1251.517] (-1252.711) -- 0:00:13
803000 -- [-1257.602] (-1251.475) (-1250.960) (-1254.099) * (-1253.868) (-1252.886) (-1257.777) [-1253.221] -- 0:00:13
803500 -- (-1253.571) [-1253.714] (-1251.524) (-1251.577) * [-1253.404] (-1252.675) (-1254.472) (-1250.500) -- 0:00:13
804000 -- (-1254.659) (-1254.587) [-1251.027] (-1249.929) * [-1254.683] (-1255.531) (-1253.518) (-1251.086) -- 0:00:13
804500 -- (-1254.875) (-1258.725) (-1253.597) [-1251.041] * [-1251.870] (-1255.044) (-1250.337) (-1251.174) -- 0:00:13
805000 -- [-1253.085] (-1253.922) (-1249.809) (-1256.317) * (-1253.268) (-1252.674) (-1254.649) [-1253.317] -- 0:00:13
Average standard deviation of split frequencies: 0.006356
805500 -- [-1253.788] (-1253.708) (-1253.291) (-1254.969) * [-1253.267] (-1252.417) (-1252.588) (-1254.772) -- 0:00:13
806000 -- [-1255.297] (-1252.706) (-1252.119) (-1255.773) * (-1253.804) (-1254.315) (-1249.829) [-1254.247] -- 0:00:12
806500 -- (-1253.755) [-1251.324] (-1261.213) (-1253.899) * (-1256.112) [-1252.875] (-1252.272) (-1253.773) -- 0:00:12
807000 -- (-1252.783) [-1252.080] (-1261.134) (-1253.114) * (-1254.760) (-1252.706) [-1250.126] (-1254.025) -- 0:00:12
807500 -- (-1251.105) (-1250.143) (-1253.669) [-1254.983] * (-1252.431) [-1250.672] (-1251.771) (-1255.003) -- 0:00:12
808000 -- (-1253.081) (-1252.633) [-1250.330] (-1253.769) * (-1254.735) (-1253.305) [-1251.929] (-1252.878) -- 0:00:13
808500 -- (-1252.858) (-1251.876) (-1252.139) [-1252.768] * (-1250.656) [-1250.032] (-1258.723) (-1250.626) -- 0:00:13
809000 -- (-1252.723) [-1252.468] (-1254.511) (-1253.477) * (-1252.633) [-1250.686] (-1252.737) (-1254.276) -- 0:00:12
809500 -- (-1252.638) (-1252.676) (-1255.160) [-1252.003] * (-1252.041) (-1250.510) (-1254.067) [-1253.332] -- 0:00:12
810000 -- (-1251.825) (-1253.506) (-1255.387) [-1253.974] * [-1252.533] (-1251.564) (-1253.315) (-1249.929) -- 0:00:12
Average standard deviation of split frequencies: 0.006474
810500 -- [-1252.312] (-1251.388) (-1253.471) (-1254.138) * (-1251.662) (-1249.574) [-1253.031] (-1252.542) -- 0:00:12
811000 -- (-1251.074) (-1253.369) [-1251.431] (-1254.634) * (-1254.683) (-1252.138) (-1251.381) [-1252.127] -- 0:00:12
811500 -- (-1253.169) [-1255.703] (-1252.411) (-1252.761) * [-1251.018] (-1252.044) (-1251.063) (-1253.916) -- 0:00:12
812000 -- (-1255.752) (-1252.934) (-1253.519) [-1251.704] * (-1250.956) (-1251.853) [-1258.619] (-1252.996) -- 0:00:12
812500 -- (-1250.107) (-1253.416) [-1256.542] (-1250.424) * [-1252.058] (-1257.368) (-1252.486) (-1251.222) -- 0:00:12
813000 -- (-1251.401) (-1255.132) [-1254.408] (-1250.779) * (-1255.440) (-1250.862) (-1256.037) [-1252.432] -- 0:00:12
813500 -- [-1252.475] (-1251.235) (-1255.340) (-1251.107) * (-1252.335) [-1251.367] (-1254.978) (-1249.092) -- 0:00:12
814000 -- (-1251.886) (-1250.471) [-1250.820] (-1255.037) * (-1253.651) (-1251.418) (-1255.882) [-1250.383] -- 0:00:12
814500 -- (-1253.899) (-1252.236) [-1252.059] (-1252.978) * [-1252.158] (-1252.012) (-1255.947) (-1250.778) -- 0:00:12
815000 -- (-1252.872) [-1252.037] (-1252.003) (-1250.819) * (-1253.404) (-1252.943) (-1252.197) [-1252.038] -- 0:00:12
Average standard deviation of split frequencies: 0.006535
815500 -- (-1252.832) (-1252.151) (-1251.357) [-1254.140] * (-1255.470) (-1252.107) (-1252.316) [-1250.997] -- 0:00:12
816000 -- (-1252.390) (-1256.277) [-1252.981] (-1251.845) * (-1260.078) (-1253.609) [-1254.026] (-1252.122) -- 0:00:12
816500 -- (-1254.408) (-1257.551) (-1252.503) [-1252.613] * (-1252.245) [-1249.644] (-1253.077) (-1253.513) -- 0:00:12
817000 -- (-1251.802) [-1255.797] (-1251.777) (-1252.377) * [-1251.886] (-1249.976) (-1255.757) (-1253.338) -- 0:00:12
817500 -- (-1252.033) (-1251.639) (-1250.832) [-1251.729] * [-1253.161] (-1252.728) (-1253.851) (-1252.465) -- 0:00:12
818000 -- (-1253.479) (-1252.410) (-1252.689) [-1252.074] * (-1252.251) [-1251.910] (-1251.263) (-1253.348) -- 0:00:12
818500 -- (-1251.315) [-1253.363] (-1252.835) (-1249.903) * [-1254.325] (-1252.847) (-1256.647) (-1252.727) -- 0:00:12
819000 -- (-1256.859) (-1252.634) (-1253.707) [-1250.115] * (-1252.005) (-1251.484) (-1254.468) [-1252.823] -- 0:00:12
819500 -- (-1255.243) (-1253.275) [-1253.896] (-1254.481) * (-1253.267) (-1252.977) (-1252.019) [-1251.924] -- 0:00:12
820000 -- (-1250.458) (-1251.201) [-1252.535] (-1254.410) * [-1255.096] (-1251.088) (-1252.226) (-1253.229) -- 0:00:12
Average standard deviation of split frequencies: 0.006498
820500 -- [-1251.165] (-1249.834) (-1252.089) (-1252.501) * (-1253.242) (-1250.592) (-1250.647) [-1251.612] -- 0:00:12
821000 -- (-1253.844) (-1254.653) [-1251.253] (-1250.727) * (-1251.713) [-1252.051] (-1254.785) (-1253.500) -- 0:00:11
821500 -- (-1251.601) (-1251.777) (-1251.384) [-1250.670] * [-1255.906] (-1251.192) (-1254.061) (-1253.717) -- 0:00:11
822000 -- (-1252.504) (-1255.925) [-1255.130] (-1251.144) * (-1253.352) [-1249.849] (-1254.215) (-1255.322) -- 0:00:11
822500 -- [-1251.995] (-1252.386) (-1257.921) (-1252.087) * [-1256.280] (-1249.409) (-1253.898) (-1253.057) -- 0:00:12
823000 -- (-1252.733) (-1251.101) (-1251.590) [-1252.385] * (-1255.406) [-1252.528] (-1255.885) (-1250.038) -- 0:00:12
823500 -- [-1251.107] (-1250.126) (-1251.575) (-1249.943) * (-1253.504) [-1251.922] (-1257.645) (-1251.975) -- 0:00:12
824000 -- [-1251.764] (-1251.654) (-1252.461) (-1256.301) * (-1252.357) (-1249.479) (-1256.642) [-1251.265] -- 0:00:11
824500 -- (-1254.437) [-1250.699] (-1254.189) (-1256.364) * (-1252.547) [-1252.341] (-1253.332) (-1255.331) -- 0:00:11
825000 -- (-1252.349) (-1253.049) [-1250.692] (-1254.713) * (-1253.744) (-1256.015) (-1254.079) [-1252.627] -- 0:00:11
Average standard deviation of split frequencies: 0.006242
825500 -- [-1253.318] (-1253.048) (-1252.038) (-1251.112) * (-1253.814) (-1252.782) [-1251.094] (-1254.368) -- 0:00:11
826000 -- (-1253.377) (-1252.602) (-1251.974) [-1254.875] * (-1252.866) (-1249.627) [-1254.530] (-1256.743) -- 0:00:11
826500 -- (-1258.721) (-1252.984) (-1255.974) [-1251.728] * (-1251.182) (-1252.035) [-1252.688] (-1253.107) -- 0:00:11
827000 -- (-1258.309) [-1251.359] (-1255.214) (-1250.186) * (-1253.927) [-1252.205] (-1253.460) (-1251.241) -- 0:00:11
827500 -- (-1256.882) [-1249.592] (-1254.377) (-1254.064) * (-1250.664) (-1252.815) [-1251.011] (-1255.371) -- 0:00:11
828000 -- (-1251.418) [-1252.674] (-1253.311) (-1250.080) * (-1253.017) (-1249.930) [-1253.189] (-1251.186) -- 0:00:11
828500 -- [-1251.913] (-1253.789) (-1252.749) (-1252.782) * [-1252.763] (-1251.693) (-1250.808) (-1251.227) -- 0:00:11
829000 -- (-1260.468) [-1252.155] (-1253.564) (-1252.452) * (-1257.257) (-1252.540) [-1251.540] (-1251.519) -- 0:00:11
829500 -- [-1250.918] (-1254.414) (-1254.694) (-1256.050) * (-1252.742) (-1253.593) (-1251.771) [-1252.718] -- 0:00:11
830000 -- [-1249.695] (-1252.645) (-1255.528) (-1252.400) * (-1252.477) (-1254.426) (-1251.836) [-1254.250] -- 0:00:11
Average standard deviation of split frequencies: 0.006053
830500 -- [-1252.943] (-1255.499) (-1253.437) (-1250.825) * [-1254.155] (-1253.822) (-1255.193) (-1255.246) -- 0:00:11
831000 -- (-1253.814) (-1252.232) [-1256.412] (-1251.374) * [-1252.083] (-1256.627) (-1252.635) (-1252.433) -- 0:00:11
831500 -- [-1255.310] (-1254.143) (-1254.991) (-1253.731) * (-1251.944) (-1252.994) (-1251.552) [-1253.309] -- 0:00:11
832000 -- [-1252.903] (-1251.818) (-1254.399) (-1255.976) * (-1250.747) (-1255.141) (-1252.183) [-1253.100] -- 0:00:11
832500 -- (-1252.456) [-1252.981] (-1252.764) (-1254.480) * (-1251.805) [-1250.283] (-1253.664) (-1252.361) -- 0:00:11
833000 -- (-1254.212) (-1253.202) (-1253.041) [-1252.474] * (-1253.018) (-1255.427) [-1251.850] (-1253.221) -- 0:00:11
833500 -- (-1259.263) [-1251.625] (-1253.236) (-1258.549) * (-1254.481) (-1252.954) [-1252.513] (-1251.763) -- 0:00:11
834000 -- (-1250.910) (-1251.952) (-1252.456) [-1251.157] * (-1252.455) (-1252.886) [-1252.506] (-1254.127) -- 0:00:11
834500 -- (-1253.352) (-1252.794) (-1254.759) [-1250.111] * (-1255.993) [-1253.343] (-1253.192) (-1255.438) -- 0:00:11
835000 -- (-1250.534) [-1251.914] (-1254.086) (-1249.555) * (-1253.866) (-1252.124) [-1252.172] (-1253.438) -- 0:00:11
Average standard deviation of split frequencies: 0.006203
835500 -- [-1252.018] (-1252.365) (-1251.148) (-1251.518) * (-1253.625) (-1252.048) (-1252.015) [-1252.808] -- 0:00:11
836000 -- [-1252.141] (-1252.209) (-1251.882) (-1253.396) * [-1251.396] (-1250.702) (-1251.769) (-1251.936) -- 0:00:10
836500 -- (-1249.922) (-1253.520) (-1251.491) [-1251.813] * (-1251.762) [-1250.751] (-1251.712) (-1254.277) -- 0:00:10
837000 -- [-1250.983] (-1253.820) (-1253.257) (-1253.611) * (-1252.871) (-1250.212) (-1253.810) [-1252.801] -- 0:00:10
837500 -- (-1253.196) [-1254.106] (-1255.518) (-1251.971) * (-1254.498) [-1254.767] (-1255.649) (-1254.045) -- 0:00:11
838000 -- (-1256.143) [-1253.787] (-1253.798) (-1250.721) * (-1254.642) [-1255.484] (-1253.319) (-1251.999) -- 0:00:11
838500 -- (-1256.839) (-1253.519) [-1251.746] (-1253.245) * (-1254.336) (-1251.401) [-1254.463] (-1253.496) -- 0:00:10
839000 -- [-1253.723] (-1254.802) (-1252.777) (-1257.159) * (-1250.199) (-1254.046) (-1252.925) [-1250.594] -- 0:00:10
839500 -- [-1253.122] (-1252.078) (-1252.330) (-1259.384) * (-1251.378) (-1252.016) (-1251.294) [-1250.477] -- 0:00:10
840000 -- (-1252.377) (-1252.206) (-1253.437) [-1253.208] * (-1252.562) (-1255.927) [-1251.010] (-1255.795) -- 0:00:10
Average standard deviation of split frequencies: 0.006953
840500 -- (-1253.086) (-1253.503) (-1252.808) [-1253.096] * [-1252.280] (-1252.810) (-1252.517) (-1253.499) -- 0:00:10
841000 -- (-1250.732) (-1252.180) [-1252.562] (-1257.662) * [-1251.699] (-1254.704) (-1257.920) (-1255.197) -- 0:00:10
841500 -- (-1249.937) [-1251.749] (-1259.649) (-1253.553) * [-1250.465] (-1252.303) (-1257.001) (-1254.147) -- 0:00:10
842000 -- [-1252.463] (-1253.976) (-1254.531) (-1260.820) * [-1252.014] (-1253.181) (-1253.886) (-1254.608) -- 0:00:10
842500 -- [-1252.447] (-1256.076) (-1251.140) (-1252.709) * (-1252.107) (-1251.402) [-1253.451] (-1259.392) -- 0:00:10
843000 -- (-1253.940) [-1253.089] (-1252.444) (-1255.013) * (-1252.177) [-1250.199] (-1256.615) (-1251.458) -- 0:00:10
843500 -- (-1254.068) [-1252.130] (-1254.370) (-1252.792) * (-1251.474) (-1253.230) (-1254.761) [-1252.980] -- 0:00:10
844000 -- (-1258.267) (-1251.620) (-1252.746) [-1253.087] * (-1252.147) (-1252.928) (-1255.962) [-1251.689] -- 0:00:10
844500 -- (-1253.591) (-1253.388) (-1254.500) [-1252.332] * [-1250.558] (-1251.677) (-1252.953) (-1252.763) -- 0:00:10
845000 -- (-1256.272) [-1251.668] (-1252.356) (-1252.548) * (-1252.471) [-1251.422] (-1253.477) (-1252.753) -- 0:00:10
Average standard deviation of split frequencies: 0.006965
845500 -- (-1252.292) (-1251.769) (-1251.221) [-1254.575] * [-1252.012] (-1251.713) (-1253.647) (-1252.627) -- 0:00:10
846000 -- (-1252.875) (-1252.149) [-1250.882] (-1255.893) * (-1251.957) (-1254.069) (-1254.463) [-1251.611] -- 0:00:10
846500 -- (-1250.979) [-1252.115] (-1252.466) (-1252.862) * (-1253.226) (-1253.712) (-1253.809) [-1254.661] -- 0:00:10
847000 -- (-1252.424) [-1254.207] (-1251.472) (-1250.925) * (-1252.438) [-1253.177] (-1254.501) (-1251.612) -- 0:00:10
847500 -- (-1254.312) (-1252.714) [-1253.041] (-1251.493) * [-1252.292] (-1251.765) (-1254.393) (-1254.208) -- 0:00:10
848000 -- (-1251.155) (-1253.785) [-1251.076] (-1252.434) * (-1250.852) [-1252.940] (-1252.504) (-1252.469) -- 0:00:10
848500 -- [-1251.144] (-1251.790) (-1252.178) (-1253.725) * (-1250.174) (-1254.943) [-1257.170] (-1253.574) -- 0:00:10
849000 -- (-1253.279) (-1252.143) (-1251.998) [-1251.537] * [-1250.057] (-1253.715) (-1250.776) (-1251.968) -- 0:00:10
849500 -- (-1256.613) (-1252.782) [-1250.598] (-1254.166) * [-1249.558] (-1252.557) (-1253.239) (-1252.595) -- 0:00:10
850000 -- (-1256.750) [-1256.166] (-1255.809) (-1253.620) * (-1250.642) (-1251.883) (-1251.614) [-1253.903] -- 0:00:10
Average standard deviation of split frequencies: 0.006858
850500 -- (-1256.628) (-1255.903) (-1251.704) [-1250.750] * (-1251.473) (-1252.121) [-1252.877] (-1252.888) -- 0:00:10
851000 -- (-1252.543) (-1254.133) (-1252.978) [-1251.381] * [-1252.792] (-1252.416) (-1255.094) (-1252.973) -- 0:00:09
851500 -- (-1253.622) (-1252.262) (-1252.387) [-1252.031] * (-1254.021) (-1252.369) [-1254.470] (-1253.472) -- 0:00:09
852000 -- (-1255.833) (-1251.022) [-1253.585] (-1251.457) * (-1252.325) (-1254.960) (-1253.381) [-1256.230] -- 0:00:09
852500 -- (-1255.985) (-1254.421) (-1252.428) [-1253.309] * (-1250.438) (-1251.882) (-1254.420) [-1252.458] -- 0:00:10
853000 -- (-1254.934) [-1253.845] (-1251.390) (-1254.173) * (-1252.823) (-1250.307) (-1252.663) [-1253.691] -- 0:00:09
853500 -- [-1251.645] (-1252.849) (-1249.927) (-1254.516) * (-1253.851) (-1253.873) [-1252.158] (-1252.504) -- 0:00:09
854000 -- (-1257.113) [-1250.182] (-1252.680) (-1251.764) * [-1252.657] (-1251.051) (-1253.944) (-1258.425) -- 0:00:09
854500 -- (-1249.904) (-1253.037) (-1254.444) [-1252.434] * (-1251.879) (-1254.532) (-1253.988) [-1254.796] -- 0:00:09
855000 -- (-1254.186) (-1250.489) (-1256.399) [-1250.557] * [-1252.281] (-1252.258) (-1253.190) (-1252.947) -- 0:00:09
Average standard deviation of split frequencies: 0.006677
855500 -- (-1253.402) (-1250.970) (-1254.220) [-1252.453] * [-1252.711] (-1252.600) (-1253.985) (-1251.794) -- 0:00:09
856000 -- (-1254.415) (-1252.550) (-1253.833) [-1250.858] * (-1249.709) (-1251.510) [-1254.800] (-1253.543) -- 0:00:09
856500 -- [-1252.478] (-1253.285) (-1256.235) (-1252.725) * (-1251.854) (-1253.826) [-1253.806] (-1250.765) -- 0:00:09
857000 -- (-1251.836) (-1254.982) (-1254.366) [-1252.411] * (-1252.714) [-1254.544] (-1251.960) (-1252.389) -- 0:00:09
857500 -- [-1252.771] (-1253.404) (-1250.396) (-1251.909) * (-1253.929) (-1254.702) (-1253.469) [-1251.630] -- 0:00:09
858000 -- (-1252.473) (-1251.525) [-1252.282] (-1253.601) * (-1253.307) (-1251.085) (-1253.707) [-1256.130] -- 0:00:09
858500 -- (-1254.094) (-1254.040) [-1252.629] (-1253.529) * (-1253.667) (-1254.260) [-1255.830] (-1257.124) -- 0:00:09
859000 -- (-1255.638) [-1252.900] (-1250.810) (-1251.234) * (-1256.979) (-1250.488) (-1254.093) [-1250.993] -- 0:00:09
859500 -- [-1253.526] (-1257.541) (-1251.888) (-1250.661) * (-1254.260) (-1250.655) (-1253.325) [-1250.809] -- 0:00:09
860000 -- (-1250.965) (-1253.313) (-1251.523) [-1251.955] * (-1254.885) (-1255.567) (-1252.771) [-1252.378] -- 0:00:09
Average standard deviation of split frequencies: 0.006710
860500 -- [-1257.675] (-1251.474) (-1252.542) (-1253.448) * (-1257.601) [-1252.081] (-1253.553) (-1252.411) -- 0:00:09
861000 -- [-1252.691] (-1251.448) (-1253.026) (-1253.922) * (-1250.640) (-1252.272) (-1253.660) [-1251.374] -- 0:00:09
861500 -- (-1253.350) (-1251.575) (-1251.439) [-1251.364] * (-1253.825) (-1252.578) [-1256.048] (-1252.996) -- 0:00:09
862000 -- [-1251.513] (-1251.950) (-1248.014) (-1254.083) * [-1251.379] (-1253.497) (-1252.218) (-1254.012) -- 0:00:09
862500 -- (-1252.467) (-1250.425) [-1251.971] (-1252.238) * (-1251.645) (-1253.287) [-1253.738] (-1252.942) -- 0:00:09
863000 -- (-1251.615) (-1251.319) (-1252.031) [-1253.350] * [-1253.255] (-1252.182) (-1256.192) (-1251.000) -- 0:00:09
863500 -- (-1252.351) (-1251.858) [-1256.338] (-1252.633) * (-1251.675) (-1254.531) [-1256.101] (-1251.569) -- 0:00:09
864000 -- [-1251.971] (-1254.566) (-1253.721) (-1255.402) * [-1251.352] (-1253.887) (-1255.489) (-1253.147) -- 0:00:09
864500 -- (-1253.836) [-1251.358] (-1250.597) (-1253.154) * (-1252.938) (-1255.711) [-1256.505] (-1252.385) -- 0:00:09
865000 -- (-1251.663) (-1251.735) (-1251.968) [-1251.007] * (-1254.307) [-1254.077] (-1252.333) (-1251.911) -- 0:00:09
Average standard deviation of split frequencies: 0.006940
865500 -- (-1254.437) [-1252.016] (-1252.524) (-1253.315) * (-1255.592) [-1254.719] (-1254.665) (-1253.380) -- 0:00:09
866000 -- [-1253.061] (-1252.764) (-1252.361) (-1254.840) * (-1253.657) [-1257.451] (-1250.606) (-1253.332) -- 0:00:08
866500 -- (-1254.403) (-1253.730) [-1257.905] (-1251.792) * (-1255.195) (-1254.053) (-1252.834) [-1251.460] -- 0:00:08
867000 -- (-1251.293) (-1250.700) (-1253.831) [-1254.170] * (-1255.528) [-1251.418] (-1251.765) (-1252.283) -- 0:00:08
867500 -- [-1252.879] (-1252.120) (-1254.329) (-1256.620) * (-1253.654) (-1253.869) (-1251.972) [-1253.160] -- 0:00:09
868000 -- (-1252.267) [-1254.617] (-1253.226) (-1252.117) * [-1249.923] (-1252.290) (-1257.023) (-1251.646) -- 0:00:08
868500 -- (-1253.480) (-1251.813) [-1252.686] (-1253.896) * (-1252.397) (-1254.487) [-1251.422] (-1251.732) -- 0:00:08
869000 -- (-1251.489) [-1251.796] (-1252.935) (-1255.445) * (-1251.378) (-1252.844) (-1252.229) [-1250.343] -- 0:00:08
869500 -- (-1253.954) [-1252.091] (-1255.097) (-1253.572) * [-1250.916] (-1253.401) (-1253.464) (-1250.913) -- 0:00:08
870000 -- (-1250.859) (-1251.863) [-1257.515] (-1255.813) * (-1251.189) (-1252.056) (-1251.921) [-1251.346] -- 0:00:08
Average standard deviation of split frequencies: 0.006903
870500 -- (-1252.229) (-1250.733) [-1252.393] (-1256.975) * (-1253.753) (-1251.275) (-1252.533) [-1249.872] -- 0:00:08
871000 -- (-1251.293) (-1254.884) (-1253.384) [-1256.691] * (-1253.907) (-1253.050) (-1255.380) [-1250.576] -- 0:00:08
871500 -- [-1251.425] (-1252.375) (-1255.491) (-1254.560) * [-1253.405] (-1254.910) (-1253.351) (-1250.830) -- 0:00:08
872000 -- [-1256.753] (-1249.681) (-1253.006) (-1253.331) * (-1251.538) (-1255.749) [-1253.265] (-1251.849) -- 0:00:08
872500 -- (-1254.076) [-1254.742] (-1253.375) (-1252.042) * [-1254.489] (-1254.619) (-1252.492) (-1250.199) -- 0:00:08
873000 -- (-1252.393) (-1253.152) [-1252.659] (-1251.035) * (-1250.494) [-1251.645] (-1251.862) (-1253.612) -- 0:00:08
873500 -- (-1252.710) (-1252.408) (-1252.179) [-1251.611] * (-1251.708) (-1252.378) (-1252.391) [-1254.737] -- 0:00:08
874000 -- (-1253.086) [-1252.822] (-1252.202) (-1254.166) * (-1253.195) (-1254.401) [-1251.347] (-1252.125) -- 0:00:08
874500 -- (-1253.257) (-1252.014) (-1252.508) [-1250.765] * (-1252.749) (-1253.990) (-1252.517) [-1252.127] -- 0:00:08
875000 -- (-1250.182) (-1251.950) [-1252.560] (-1250.798) * (-1257.315) [-1252.256] (-1253.839) (-1252.989) -- 0:00:08
Average standard deviation of split frequencies: 0.006861
875500 -- (-1252.448) (-1254.619) [-1250.065] (-1252.046) * [-1253.166] (-1251.634) (-1253.219) (-1253.882) -- 0:00:08
876000 -- [-1254.049] (-1254.988) (-1250.068) (-1252.278) * (-1250.495) (-1250.710) [-1252.333] (-1249.415) -- 0:00:08
876500 -- [-1254.349] (-1255.845) (-1250.829) (-1257.156) * (-1251.982) [-1250.721] (-1254.536) (-1254.918) -- 0:00:08
877000 -- (-1251.231) (-1252.146) (-1252.576) [-1252.495] * (-1253.539) (-1251.776) [-1254.559] (-1253.063) -- 0:00:08
877500 -- (-1252.701) (-1251.881) (-1253.322) [-1253.155] * (-1253.623) (-1251.253) [-1254.272] (-1251.326) -- 0:00:08
878000 -- (-1254.823) (-1250.322) [-1252.641] (-1254.323) * (-1256.172) [-1253.641] (-1251.072) (-1254.851) -- 0:00:08
878500 -- (-1251.362) (-1253.152) (-1253.183) [-1251.647] * (-1254.051) (-1253.926) (-1251.750) [-1251.497] -- 0:00:08
879000 -- (-1250.839) [-1250.705] (-1254.677) (-1251.684) * (-1253.637) (-1254.552) [-1256.011] (-1257.573) -- 0:00:08
879500 -- [-1249.881] (-1252.446) (-1252.731) (-1251.470) * (-1252.665) [-1253.694] (-1251.674) (-1258.195) -- 0:00:08
880000 -- (-1256.547) (-1251.682) (-1251.031) [-1251.258] * (-1254.210) (-1254.232) (-1251.922) [-1255.428] -- 0:00:08
Average standard deviation of split frequencies: 0.006390
880500 -- (-1251.348) [-1250.941] (-1252.723) (-1252.275) * (-1251.968) (-1254.882) (-1251.318) [-1252.419] -- 0:00:08
881000 -- [-1251.141] (-1252.328) (-1251.496) (-1256.054) * (-1251.412) [-1250.981] (-1252.261) (-1252.405) -- 0:00:07
881500 -- (-1252.681) (-1253.775) [-1251.207] (-1265.419) * (-1255.266) (-1252.499) (-1253.351) [-1251.549] -- 0:00:07
882000 -- (-1250.621) (-1252.614) (-1251.483) [-1253.900] * (-1250.317) [-1252.401] (-1255.858) (-1251.605) -- 0:00:07
882500 -- (-1253.572) [-1252.630] (-1249.615) (-1251.916) * (-1251.846) (-1252.776) (-1255.684) [-1252.028] -- 0:00:07
883000 -- (-1252.201) (-1251.806) [-1249.721] (-1253.328) * (-1255.141) (-1252.036) [-1251.658] (-1253.999) -- 0:00:07
883500 -- (-1260.571) (-1257.938) [-1253.914] (-1254.828) * (-1257.100) (-1252.377) [-1252.724] (-1252.720) -- 0:00:07
884000 -- (-1251.763) [-1256.929] (-1250.829) (-1253.788) * [-1252.019] (-1251.855) (-1252.076) (-1252.872) -- 0:00:07
884500 -- (-1251.327) [-1255.018] (-1252.144) (-1253.789) * [-1252.769] (-1252.705) (-1252.548) (-1256.492) -- 0:00:07
885000 -- [-1251.329] (-1252.713) (-1254.251) (-1251.060) * (-1255.426) (-1252.149) [-1251.051] (-1254.368) -- 0:00:07
Average standard deviation of split frequencies: 0.006052
885500 -- (-1251.379) (-1256.172) (-1252.669) [-1251.586] * (-1255.414) (-1251.679) [-1251.849] (-1255.300) -- 0:00:07
886000 -- [-1251.170] (-1258.810) (-1251.863) (-1251.636) * (-1255.357) (-1252.555) (-1252.027) [-1253.283] -- 0:00:07
886500 -- (-1252.436) (-1256.720) (-1254.884) [-1252.238] * (-1258.588) (-1254.423) (-1252.080) [-1251.764] -- 0:00:07
887000 -- (-1252.545) (-1256.372) [-1251.138] (-1253.987) * (-1252.940) (-1257.457) (-1253.756) [-1253.004] -- 0:00:07
887500 -- [-1252.802] (-1255.658) (-1256.181) (-1254.731) * (-1255.164) (-1258.821) [-1251.402] (-1254.555) -- 0:00:07
888000 -- (-1253.533) (-1254.893) (-1252.590) [-1253.907] * [-1255.120] (-1254.516) (-1257.638) (-1250.274) -- 0:00:07
888500 -- (-1251.912) (-1253.668) [-1251.904] (-1253.737) * (-1254.140) (-1253.862) [-1254.649] (-1252.189) -- 0:00:07
889000 -- (-1253.885) (-1251.525) [-1251.446] (-1250.192) * (-1254.723) [-1254.222] (-1252.589) (-1252.533) -- 0:00:07
889500 -- (-1251.617) (-1252.323) [-1252.031] (-1251.539) * [-1252.445] (-1256.625) (-1255.048) (-1250.431) -- 0:00:07
890000 -- (-1251.425) [-1253.770] (-1254.196) (-1252.664) * (-1252.637) (-1254.384) [-1255.363] (-1254.387) -- 0:00:07
Average standard deviation of split frequencies: 0.006384
890500 -- (-1253.797) (-1252.666) [-1250.589] (-1253.438) * (-1252.605) (-1252.293) [-1251.283] (-1253.664) -- 0:00:07
891000 -- (-1250.254) (-1253.231) (-1252.133) [-1253.807] * (-1254.078) [-1252.187] (-1252.047) (-1259.821) -- 0:00:07
891500 -- [-1254.864] (-1249.539) (-1251.456) (-1252.295) * (-1253.169) (-1252.546) [-1252.222] (-1252.465) -- 0:00:07
892000 -- (-1251.150) [-1250.327] (-1252.516) (-1252.509) * (-1255.192) (-1255.247) (-1253.512) [-1252.431] -- 0:00:07
892500 -- (-1251.884) (-1252.754) (-1250.986) [-1253.245] * (-1250.600) (-1255.754) [-1252.776] (-1254.959) -- 0:00:07
893000 -- (-1251.310) (-1253.357) [-1251.917] (-1252.478) * [-1251.929] (-1251.463) (-1255.194) (-1252.165) -- 0:00:07
893500 -- (-1253.559) (-1251.235) (-1253.140) [-1252.148] * (-1252.635) (-1252.996) (-1252.367) [-1251.077] -- 0:00:07
894000 -- (-1257.091) (-1253.131) (-1254.236) [-1252.138] * (-1253.411) [-1252.340] (-1251.044) (-1251.991) -- 0:00:07
894500 -- (-1252.618) (-1252.695) [-1253.445] (-1251.108) * [-1250.767] (-1256.670) (-1254.420) (-1255.274) -- 0:00:07
895000 -- [-1252.566] (-1250.253) (-1254.517) (-1253.324) * [-1248.937] (-1254.344) (-1256.014) (-1253.154) -- 0:00:07
Average standard deviation of split frequencies: 0.006313
895500 -- [-1252.900] (-1252.476) (-1251.831) (-1252.841) * [-1251.862] (-1253.495) (-1252.689) (-1252.492) -- 0:00:07
896000 -- [-1251.392] (-1253.738) (-1254.290) (-1251.967) * (-1251.857) (-1254.979) [-1252.810] (-1256.643) -- 0:00:06
896500 -- (-1251.524) (-1253.721) (-1253.952) [-1254.033] * [-1250.791] (-1253.609) (-1252.171) (-1254.490) -- 0:00:06
897000 -- [-1252.604] (-1252.469) (-1257.814) (-1254.766) * (-1250.995) [-1254.141] (-1251.956) (-1252.357) -- 0:00:06
897500 -- (-1257.600) (-1253.094) [-1249.178] (-1253.094) * (-1255.241) (-1256.519) (-1252.407) [-1255.085] -- 0:00:06
898000 -- (-1252.281) (-1254.280) (-1254.285) [-1254.985] * (-1257.055) [-1252.407] (-1253.728) (-1253.628) -- 0:00:06
898500 -- (-1251.555) [-1252.425] (-1252.672) (-1254.221) * [-1249.960] (-1255.181) (-1253.916) (-1252.794) -- 0:00:06
899000 -- (-1252.729) [-1252.282] (-1250.273) (-1258.304) * (-1256.348) (-1253.947) [-1253.432] (-1256.084) -- 0:00:06
899500 -- (-1253.399) (-1251.537) [-1251.965] (-1251.656) * [-1259.299] (-1253.037) (-1252.919) (-1260.265) -- 0:00:06
900000 -- (-1252.644) (-1251.596) (-1255.320) [-1251.871] * (-1250.736) [-1251.601] (-1252.566) (-1253.926) -- 0:00:06
Average standard deviation of split frequencies: 0.006281
900500 -- (-1253.649) [-1252.378] (-1252.092) (-1252.781) * [-1252.247] (-1255.864) (-1250.813) (-1254.097) -- 0:00:06
901000 -- (-1253.894) (-1252.622) (-1256.013) [-1251.448] * (-1253.613) (-1257.318) (-1252.073) [-1253.403] -- 0:00:06
901500 -- (-1255.988) [-1254.800] (-1255.264) (-1254.109) * (-1253.400) (-1256.377) [-1251.866] (-1251.013) -- 0:00:06
902000 -- (-1253.989) (-1250.816) (-1254.720) [-1252.550] * (-1252.196) (-1251.849) [-1253.186] (-1252.421) -- 0:00:06
902500 -- (-1252.183) [-1252.000] (-1251.001) (-1256.525) * (-1253.240) [-1254.838] (-1250.909) (-1252.474) -- 0:00:06
903000 -- (-1251.661) (-1251.171) (-1252.111) [-1251.823] * (-1251.485) (-1252.377) (-1254.448) [-1252.158] -- 0:00:06
903500 -- [-1252.017] (-1254.604) (-1253.862) (-1253.139) * (-1250.404) (-1251.411) (-1256.427) [-1251.667] -- 0:00:06
904000 -- (-1251.438) (-1254.978) [-1253.779] (-1251.890) * (-1252.038) (-1251.318) [-1253.806] (-1251.643) -- 0:00:06
904500 -- (-1257.104) [-1254.217] (-1255.524) (-1253.469) * (-1253.031) [-1253.770] (-1253.634) (-1253.900) -- 0:00:06
905000 -- (-1254.540) [-1252.359] (-1254.147) (-1252.982) * (-1251.837) (-1250.404) (-1253.257) [-1258.616] -- 0:00:06
Average standard deviation of split frequencies: 0.006341
905500 -- (-1259.352) [-1255.316] (-1251.486) (-1254.109) * (-1252.021) [-1253.158] (-1254.484) (-1252.964) -- 0:00:06
906000 -- (-1254.163) (-1255.399) [-1250.974] (-1252.328) * (-1253.986) (-1251.286) (-1253.314) [-1252.453] -- 0:00:06
906500 -- (-1251.987) (-1255.372) (-1251.759) [-1252.467] * [-1252.616] (-1253.081) (-1253.161) (-1251.624) -- 0:00:06
907000 -- [-1251.871] (-1257.721) (-1252.773) (-1255.065) * [-1253.188] (-1254.190) (-1253.673) (-1254.943) -- 0:00:06
907500 -- (-1251.591) [-1251.063] (-1259.088) (-1252.750) * [-1254.176] (-1250.652) (-1254.094) (-1252.719) -- 0:00:06
908000 -- (-1251.958) (-1251.530) (-1251.292) [-1253.188] * (-1255.794) (-1257.039) (-1254.576) [-1252.013] -- 0:00:06
908500 -- (-1251.784) [-1254.243] (-1252.903) (-1254.749) * (-1253.847) [-1257.252] (-1251.565) (-1252.123) -- 0:00:06
909000 -- (-1253.784) [-1252.192] (-1253.741) (-1253.810) * (-1253.736) (-1255.180) [-1252.303] (-1252.495) -- 0:00:06
909500 -- (-1258.649) [-1251.894] (-1251.334) (-1254.655) * (-1252.499) [-1251.672] (-1252.334) (-1257.449) -- 0:00:06
910000 -- (-1255.138) (-1250.834) (-1250.297) [-1250.613] * (-1252.478) (-1252.761) [-1249.701] (-1251.630) -- 0:00:06
Average standard deviation of split frequencies: 0.006309
910500 -- [-1251.059] (-1251.539) (-1256.503) (-1252.638) * (-1255.754) (-1254.675) [-1252.527] (-1251.733) -- 0:00:05
911000 -- (-1255.825) [-1252.323] (-1252.541) (-1251.796) * (-1252.441) [-1252.040] (-1256.483) (-1251.439) -- 0:00:05
911500 -- (-1252.199) (-1260.324) (-1258.801) [-1252.247] * (-1253.045) (-1251.862) [-1253.165] (-1255.013) -- 0:00:05
912000 -- (-1252.640) (-1253.742) [-1252.529] (-1251.778) * (-1254.121) (-1250.126) (-1259.936) [-1253.551] -- 0:00:05
912500 -- (-1252.166) (-1252.567) (-1252.837) [-1250.142] * (-1254.341) (-1253.675) [-1254.547] (-1253.660) -- 0:00:05
913000 -- [-1254.427] (-1251.836) (-1250.813) (-1256.256) * [-1254.044] (-1249.752) (-1253.850) (-1251.572) -- 0:00:05
913500 -- (-1252.891) [-1253.843] (-1251.286) (-1252.640) * (-1255.392) [-1251.218] (-1254.907) (-1257.347) -- 0:00:05
914000 -- (-1252.032) [-1252.853] (-1252.109) (-1255.784) * [-1252.011] (-1254.388) (-1259.331) (-1253.364) -- 0:00:05
914500 -- (-1252.210) (-1255.066) [-1251.832] (-1254.006) * (-1251.008) (-1254.758) (-1259.643) [-1252.871] -- 0:00:05
915000 -- (-1255.662) (-1255.880) (-1252.947) [-1254.092] * (-1256.272) [-1253.406] (-1255.677) (-1253.417) -- 0:00:05
Average standard deviation of split frequencies: 0.006401
915500 -- (-1252.403) (-1251.815) [-1252.379] (-1254.145) * (-1256.979) [-1251.756] (-1250.275) (-1251.145) -- 0:00:05
916000 -- (-1254.462) (-1257.442) (-1251.086) [-1253.101] * (-1250.949) (-1251.985) (-1253.948) [-1252.307] -- 0:00:05
916500 -- [-1253.422] (-1258.460) (-1251.973) (-1252.400) * (-1253.056) (-1252.676) [-1252.264] (-1251.735) -- 0:00:05
917000 -- (-1254.983) (-1254.873) [-1252.384] (-1250.466) * (-1251.694) (-1253.932) (-1254.583) [-1255.133] -- 0:00:05
917500 -- [-1252.669] (-1252.442) (-1252.211) (-1252.497) * [-1254.280] (-1251.359) (-1252.001) (-1252.812) -- 0:00:05
918000 -- (-1255.356) (-1254.047) (-1252.823) [-1254.277] * (-1252.908) (-1252.289) (-1252.647) [-1252.867] -- 0:00:05
918500 -- (-1254.221) (-1253.143) (-1251.946) [-1252.368] * [-1253.480] (-1252.192) (-1253.458) (-1255.843) -- 0:00:05
919000 -- (-1254.687) [-1251.315] (-1262.014) (-1252.445) * [-1254.835] (-1256.649) (-1250.776) (-1256.451) -- 0:00:05
919500 -- (-1252.083) [-1252.284] (-1252.226) (-1249.189) * (-1255.355) (-1251.945) (-1255.380) [-1257.472] -- 0:00:05
920000 -- (-1251.538) (-1252.884) [-1253.690] (-1251.685) * [-1252.807] (-1255.753) (-1254.558) (-1252.035) -- 0:00:05
Average standard deviation of split frequencies: 0.006304
920500 -- [-1252.291] (-1253.095) (-1252.598) (-1254.290) * (-1256.099) (-1253.471) [-1251.083] (-1251.992) -- 0:00:05
921000 -- (-1255.625) (-1250.707) (-1255.052) [-1252.700] * (-1256.414) (-1253.731) [-1252.985] (-1255.652) -- 0:00:05
921500 -- (-1255.625) (-1250.259) [-1254.168] (-1252.656) * (-1254.536) [-1257.212] (-1251.670) (-1253.234) -- 0:00:05
922000 -- (-1252.265) [-1253.710] (-1252.488) (-1254.147) * (-1252.799) (-1252.005) (-1255.055) [-1252.261] -- 0:00:05
922500 -- (-1253.942) [-1251.072] (-1253.420) (-1255.048) * (-1252.410) (-1253.794) [-1250.393] (-1256.197) -- 0:00:05
923000 -- (-1249.915) (-1254.646) (-1252.010) [-1252.700] * (-1253.408) (-1252.419) [-1250.001] (-1252.027) -- 0:00:05
923500 -- (-1252.662) (-1252.450) [-1251.850] (-1252.120) * [-1252.085] (-1251.425) (-1252.692) (-1252.244) -- 0:00:05
924000 -- (-1252.292) [-1252.430] (-1253.965) (-1251.163) * [-1251.209] (-1253.178) (-1253.356) (-1250.910) -- 0:00:05
924500 -- (-1253.169) (-1254.411) [-1251.528] (-1251.734) * (-1255.497) (-1252.968) [-1256.330] (-1251.731) -- 0:00:05
925000 -- (-1252.516) [-1250.998] (-1250.119) (-1255.311) * (-1256.198) (-1253.207) [-1250.766] (-1253.435) -- 0:00:05
Average standard deviation of split frequencies: 0.006523
925500 -- (-1255.643) [-1252.996] (-1251.215) (-1255.487) * (-1253.731) (-1251.536) [-1254.372] (-1254.502) -- 0:00:04
926000 -- (-1254.344) (-1251.583) (-1249.505) [-1252.547] * (-1252.464) (-1252.054) [-1254.630] (-1251.161) -- 0:00:04
926500 -- (-1253.379) (-1254.435) (-1253.072) [-1254.644] * [-1251.807] (-1251.957) (-1257.355) (-1255.415) -- 0:00:04
927000 -- (-1254.006) (-1252.950) (-1252.606) [-1251.846] * [-1250.419] (-1252.041) (-1257.108) (-1251.273) -- 0:00:04
927500 -- (-1251.730) [-1255.296] (-1251.256) (-1256.354) * (-1252.290) (-1251.247) [-1251.474] (-1254.263) -- 0:00:04
928000 -- (-1251.109) [-1255.052] (-1255.153) (-1253.622) * [-1251.272] (-1250.960) (-1251.348) (-1251.331) -- 0:00:04
928500 -- (-1251.552) (-1252.464) (-1251.221) [-1250.377] * [-1249.428] (-1251.865) (-1251.165) (-1251.497) -- 0:00:04
929000 -- (-1251.678) [-1252.569] (-1250.838) (-1254.030) * (-1251.805) (-1252.774) (-1255.012) [-1252.459] -- 0:00:04
929500 -- (-1255.260) (-1253.529) (-1254.137) [-1251.307] * (-1251.455) (-1251.919) (-1257.897) [-1257.519] -- 0:00:04
930000 -- (-1254.364) (-1252.852) [-1251.729] (-1252.156) * (-1252.492) (-1257.351) (-1255.335) [-1251.624] -- 0:00:04
Average standard deviation of split frequencies: 0.006965
930500 -- (-1253.188) (-1251.411) (-1253.223) [-1252.876] * (-1251.781) [-1250.940] (-1252.024) (-1257.686) -- 0:00:04
931000 -- (-1254.294) (-1252.685) (-1253.959) [-1251.738] * (-1251.316) [-1252.083] (-1251.784) (-1256.027) -- 0:00:04
931500 -- (-1252.098) (-1252.395) (-1256.915) [-1252.121] * (-1248.853) (-1252.181) [-1249.456] (-1253.728) -- 0:00:04
932000 -- (-1250.970) (-1255.000) (-1251.936) [-1252.113] * [-1252.308] (-1252.529) (-1252.885) (-1253.683) -- 0:00:04
932500 -- (-1253.367) (-1253.553) [-1251.051] (-1251.208) * (-1252.798) [-1252.950] (-1253.696) (-1251.285) -- 0:00:04
933000 -- [-1254.060] (-1253.956) (-1249.772) (-1249.747) * [-1254.166] (-1254.233) (-1252.646) (-1251.948) -- 0:00:04
933500 -- [-1251.090] (-1252.838) (-1252.496) (-1252.715) * (-1251.521) [-1250.916] (-1253.385) (-1253.788) -- 0:00:04
934000 -- (-1250.916) (-1253.112) (-1254.264) [-1250.850] * (-1253.383) (-1251.731) [-1252.576] (-1252.476) -- 0:00:04
934500 -- (-1252.902) (-1251.181) [-1251.683] (-1254.892) * (-1250.447) (-1251.603) [-1252.086] (-1253.369) -- 0:00:04
935000 -- (-1251.630) (-1252.921) [-1251.248] (-1251.867) * (-1251.987) (-1252.261) [-1250.665] (-1254.883) -- 0:00:04
Average standard deviation of split frequencies: 0.006610
935500 -- (-1253.037) (-1254.239) [-1251.105] (-1251.933) * [-1251.531] (-1252.589) (-1251.692) (-1251.190) -- 0:00:04
936000 -- (-1254.048) [-1252.425] (-1250.983) (-1252.225) * (-1253.523) (-1256.451) [-1250.622] (-1251.716) -- 0:00:04
936500 -- (-1253.966) [-1252.766] (-1252.653) (-1250.093) * (-1251.789) (-1251.653) [-1249.705] (-1253.875) -- 0:00:04
937000 -- (-1255.749) [-1251.729] (-1251.992) (-1254.635) * (-1252.163) (-1249.440) (-1251.772) [-1252.215] -- 0:00:04
937500 -- (-1253.878) (-1253.323) (-1252.780) [-1252.504] * (-1254.760) [-1252.706] (-1252.941) (-1252.174) -- 0:00:04
938000 -- (-1252.210) (-1257.092) (-1250.012) [-1250.863] * (-1253.871) [-1252.898] (-1252.896) (-1254.543) -- 0:00:04
938500 -- [-1256.517] (-1253.842) (-1255.173) (-1253.820) * [-1252.504] (-1252.319) (-1256.964) (-1256.310) -- 0:00:04
939000 -- (-1256.726) (-1250.482) (-1251.894) [-1253.253] * (-1257.662) [-1250.808] (-1258.768) (-1255.538) -- 0:00:04
939500 -- [-1254.116] (-1253.506) (-1253.516) (-1253.152) * (-1252.786) (-1250.242) (-1254.850) [-1257.642] -- 0:00:04
940000 -- (-1253.183) (-1249.858) (-1252.677) [-1253.329] * (-1252.889) [-1253.591] (-1253.762) (-1253.398) -- 0:00:04
Average standard deviation of split frequencies: 0.006546
940500 -- [-1252.359] (-1256.333) (-1251.550) (-1254.071) * (-1255.886) (-1253.374) [-1252.211] (-1253.657) -- 0:00:03
941000 -- (-1256.396) (-1259.115) [-1252.393] (-1252.277) * [-1250.915] (-1254.217) (-1256.523) (-1253.034) -- 0:00:03
941500 -- (-1255.394) [-1252.768] (-1251.406) (-1254.056) * (-1253.057) (-1253.941) (-1253.055) [-1249.600] -- 0:00:03
942000 -- (-1251.789) [-1259.280] (-1250.967) (-1251.554) * (-1255.753) (-1252.329) (-1249.921) [-1250.769] -- 0:00:03
942500 -- (-1254.505) (-1259.651) (-1253.656) [-1251.239] * [-1250.836] (-1250.277) (-1256.489) (-1254.256) -- 0:00:03
943000 -- (-1251.650) [-1250.180] (-1252.233) (-1254.792) * [-1249.719] (-1253.830) (-1255.361) (-1256.024) -- 0:00:03
943500 -- (-1251.779) (-1252.847) (-1251.092) [-1255.087] * (-1252.229) (-1256.409) (-1257.817) [-1254.708] -- 0:00:03
944000 -- [-1250.679] (-1251.244) (-1250.663) (-1255.330) * [-1251.937] (-1257.604) (-1256.734) (-1255.157) -- 0:00:03
944500 -- (-1252.170) (-1250.398) (-1256.837) [-1256.287] * (-1252.692) (-1252.418) [-1252.837] (-1253.603) -- 0:00:03
945000 -- (-1255.969) [-1255.340] (-1252.387) (-1255.267) * (-1250.352) (-1252.231) [-1253.145] (-1256.386) -- 0:00:03
Average standard deviation of split frequencies: 0.006634
945500 -- (-1252.487) [-1251.979] (-1252.624) (-1256.020) * (-1252.286) [-1251.385] (-1256.475) (-1260.579) -- 0:00:03
946000 -- [-1251.900] (-1251.346) (-1252.230) (-1253.702) * (-1251.996) [-1250.787] (-1256.279) (-1256.349) -- 0:00:03
946500 -- (-1258.491) (-1252.285) [-1252.876] (-1254.225) * (-1251.653) (-1250.279) (-1253.003) [-1250.222] -- 0:00:03
947000 -- (-1258.569) [-1253.459] (-1253.087) (-1253.326) * (-1252.305) [-1252.750] (-1254.064) (-1252.916) -- 0:00:03
947500 -- (-1257.091) [-1252.616] (-1251.715) (-1252.756) * (-1249.882) (-1253.783) (-1252.224) [-1252.060] -- 0:00:03
948000 -- (-1258.302) (-1251.047) (-1252.285) [-1254.575] * (-1255.026) [-1254.393] (-1255.769) (-1254.257) -- 0:00:03
948500 -- [-1254.601] (-1250.929) (-1252.531) (-1254.648) * [-1249.792] (-1252.431) (-1252.977) (-1250.836) -- 0:00:03
949000 -- (-1252.871) (-1256.252) [-1250.387] (-1253.031) * [-1250.346] (-1250.994) (-1254.458) (-1253.132) -- 0:00:03
949500 -- (-1254.566) (-1255.028) (-1251.381) [-1255.885] * (-1253.533) [-1252.518] (-1252.049) (-1252.152) -- 0:00:03
950000 -- (-1254.925) (-1255.022) [-1252.154] (-1252.341) * [-1252.054] (-1253.432) (-1255.737) (-1252.762) -- 0:00:03
Average standard deviation of split frequencies: 0.006725
950500 -- (-1252.458) (-1252.787) [-1251.642] (-1253.102) * [-1253.728] (-1253.510) (-1254.251) (-1253.562) -- 0:00:03
951000 -- (-1254.506) [-1256.026] (-1253.171) (-1256.274) * (-1255.183) (-1253.710) (-1252.533) [-1252.244] -- 0:00:03
951500 -- [-1252.917] (-1256.253) (-1252.432) (-1253.227) * (-1254.311) (-1254.630) [-1251.325] (-1253.368) -- 0:00:03
952000 -- (-1251.610) (-1258.028) [-1251.421] (-1254.108) * (-1252.884) (-1252.458) (-1252.447) [-1251.589] -- 0:00:03
952500 -- (-1252.498) [-1254.778] (-1254.121) (-1250.323) * (-1254.730) [-1251.485] (-1252.172) (-1253.338) -- 0:00:03
953000 -- (-1253.977) [-1250.556] (-1256.585) (-1251.159) * (-1255.731) [-1251.052] (-1254.828) (-1252.417) -- 0:00:03
953500 -- (-1250.654) (-1252.986) [-1251.859] (-1251.626) * (-1254.789) (-1254.394) (-1254.978) [-1249.979] -- 0:00:03
954000 -- [-1252.359] (-1251.623) (-1252.898) (-1252.910) * (-1252.732) [-1252.610] (-1251.603) (-1252.445) -- 0:00:03
954500 -- (-1254.355) (-1253.567) (-1254.839) [-1252.604] * [-1251.591] (-1252.758) (-1252.969) (-1254.582) -- 0:00:03
955000 -- (-1254.470) (-1252.294) [-1255.638] (-1252.979) * (-1252.562) [-1252.520] (-1250.974) (-1254.893) -- 0:00:03
Average standard deviation of split frequencies: 0.006873
955500 -- (-1253.706) (-1252.783) (-1253.685) [-1253.507] * (-1253.831) (-1250.207) [-1252.288] (-1254.249) -- 0:00:02
956000 -- [-1249.601] (-1251.320) (-1253.081) (-1251.233) * (-1252.818) [-1251.252] (-1252.822) (-1251.167) -- 0:00:02
956500 -- (-1251.359) (-1253.112) [-1255.642] (-1254.397) * (-1252.160) (-1255.933) [-1253.596] (-1255.212) -- 0:00:02
957000 -- (-1252.738) (-1251.212) [-1251.407] (-1252.614) * (-1251.689) (-1254.453) (-1255.908) [-1252.758] -- 0:00:02
957500 -- (-1251.098) (-1253.454) [-1252.199] (-1251.183) * (-1252.692) (-1254.034) (-1260.172) [-1251.751] -- 0:00:02
958000 -- [-1253.323] (-1252.020) (-1251.835) (-1250.860) * (-1254.187) (-1254.697) (-1250.983) [-1254.583] -- 0:00:02
958500 -- (-1250.024) (-1257.396) (-1253.167) [-1255.406] * (-1251.906) [-1250.798] (-1253.958) (-1257.457) -- 0:00:02
959000 -- (-1254.725) [-1250.569] (-1255.329) (-1251.223) * (-1253.816) (-1253.340) [-1250.863] (-1258.596) -- 0:00:02
959500 -- (-1253.165) (-1253.300) (-1249.822) [-1251.863] * (-1252.157) (-1251.795) [-1252.224] (-1256.084) -- 0:00:02
960000 -- (-1252.120) (-1254.018) (-1251.771) [-1250.297] * (-1252.083) (-1250.498) [-1250.889] (-1252.190) -- 0:00:02
Average standard deviation of split frequencies: 0.006379
960500 -- (-1251.356) (-1250.042) [-1252.195] (-1251.961) * (-1250.027) (-1252.453) [-1251.229] (-1255.031) -- 0:00:02
961000 -- [-1250.765] (-1250.417) (-1252.225) (-1253.276) * (-1251.872) (-1253.333) [-1252.855] (-1252.841) -- 0:00:02
961500 -- (-1255.533) (-1252.214) [-1252.439] (-1253.185) * (-1252.269) (-1250.921) (-1254.848) [-1252.696] -- 0:00:02
962000 -- [-1254.143] (-1255.315) (-1255.095) (-1252.189) * (-1253.786) (-1252.561) [-1253.818] (-1253.250) -- 0:00:02
962500 -- (-1252.063) (-1256.845) (-1250.861) [-1252.208] * (-1252.544) [-1252.687] (-1252.961) (-1251.905) -- 0:00:02
963000 -- [-1251.752] (-1253.175) (-1254.875) (-1253.164) * (-1253.625) (-1252.905) (-1253.853) [-1252.421] -- 0:00:02
963500 -- [-1249.751] (-1251.653) (-1255.933) (-1253.021) * (-1253.509) (-1251.833) (-1251.888) [-1252.983] -- 0:00:02
964000 -- (-1252.759) [-1251.860] (-1252.981) (-1252.947) * (-1250.237) (-1252.896) (-1252.285) [-1249.615] -- 0:00:02
964500 -- (-1251.261) (-1255.032) [-1252.206] (-1253.915) * (-1254.224) (-1254.677) (-1253.389) [-1251.995] -- 0:00:02
965000 -- (-1251.057) (-1251.469) (-1254.966) [-1253.375] * [-1253.089] (-1256.939) (-1254.188) (-1251.648) -- 0:00:02
Average standard deviation of split frequencies: 0.006252
965500 -- [-1254.475] (-1250.264) (-1252.031) (-1251.174) * (-1254.218) (-1251.659) (-1252.775) [-1251.361] -- 0:00:02
966000 -- [-1252.774] (-1257.789) (-1252.320) (-1258.417) * (-1251.495) (-1255.642) [-1253.063] (-1252.773) -- 0:00:02
966500 -- [-1253.488] (-1254.057) (-1258.748) (-1258.466) * (-1252.672) [-1252.828] (-1254.291) (-1256.029) -- 0:00:02
967000 -- (-1253.325) (-1250.062) [-1253.284] (-1257.448) * (-1255.004) [-1252.916] (-1252.192) (-1253.934) -- 0:00:02
967500 -- (-1250.602) (-1253.497) (-1255.108) [-1254.189] * (-1254.133) [-1254.456] (-1252.592) (-1253.857) -- 0:00:02
968000 -- [-1253.134] (-1257.475) (-1252.323) (-1254.791) * [-1252.249] (-1253.112) (-1255.331) (-1251.992) -- 0:00:02
968500 -- [-1251.659] (-1251.581) (-1252.378) (-1251.179) * (-1252.566) [-1253.330] (-1252.177) (-1254.450) -- 0:00:02
969000 -- (-1252.581) (-1256.442) (-1255.478) [-1255.622] * (-1254.902) [-1253.873] (-1251.986) (-1252.682) -- 0:00:02
969500 -- (-1251.306) (-1254.992) [-1253.047] (-1254.654) * (-1253.563) [-1252.969] (-1251.577) (-1252.953) -- 0:00:02
970000 -- (-1250.838) (-1254.013) [-1252.507] (-1254.273) * (-1251.119) [-1253.037] (-1253.171) (-1253.837) -- 0:00:02
Average standard deviation of split frequencies: 0.006313
970500 -- (-1251.777) (-1250.960) [-1255.986] (-1252.679) * (-1250.680) (-1253.258) (-1254.384) [-1254.461] -- 0:00:01
971000 -- (-1253.621) (-1250.409) [-1250.937] (-1252.217) * (-1252.083) (-1261.491) (-1253.113) [-1256.235] -- 0:00:01
971500 -- [-1260.312] (-1250.973) (-1252.294) (-1263.456) * (-1261.108) (-1261.903) [-1253.274] (-1254.236) -- 0:00:01
972000 -- (-1252.057) [-1251.319] (-1250.613) (-1256.474) * (-1256.363) (-1254.270) [-1252.624] (-1255.003) -- 0:00:01
972500 -- [-1253.417] (-1251.979) (-1250.739) (-1253.756) * (-1251.162) (-1253.975) [-1254.669] (-1252.449) -- 0:00:01
973000 -- (-1252.423) (-1253.352) (-1252.683) [-1253.235] * [-1254.297] (-1252.755) (-1252.372) (-1252.895) -- 0:00:01
973500 -- (-1254.159) (-1254.984) [-1252.704] (-1253.404) * (-1252.712) [-1254.331] (-1251.657) (-1252.395) -- 0:00:01
974000 -- [-1251.149] (-1251.631) (-1253.305) (-1251.686) * (-1251.815) (-1253.333) [-1251.797] (-1252.345) -- 0:00:01
974500 -- (-1253.145) (-1253.694) [-1252.499] (-1252.262) * (-1252.589) (-1252.185) [-1252.722] (-1252.585) -- 0:00:01
975000 -- (-1250.843) [-1252.894] (-1253.774) (-1253.234) * [-1253.285] (-1254.726) (-1252.971) (-1253.754) -- 0:00:01
Average standard deviation of split frequencies: 0.005947
975500 -- [-1255.180] (-1253.676) (-1250.862) (-1252.272) * [-1250.798] (-1255.227) (-1250.846) (-1254.513) -- 0:00:01
976000 -- (-1251.497) [-1252.215] (-1251.088) (-1250.686) * [-1250.468] (-1254.401) (-1251.565) (-1251.637) -- 0:00:01
976500 -- (-1256.456) [-1250.703] (-1250.180) (-1250.315) * [-1251.288] (-1252.939) (-1255.477) (-1251.983) -- 0:00:01
977000 -- [-1251.987] (-1253.306) (-1251.981) (-1254.036) * (-1253.136) [-1251.266] (-1251.542) (-1251.198) -- 0:00:01
977500 -- [-1252.305] (-1255.613) (-1253.919) (-1253.540) * (-1251.278) (-1251.259) [-1252.464] (-1255.601) -- 0:00:01
978000 -- (-1254.032) (-1254.466) [-1255.581] (-1251.914) * (-1251.638) (-1253.687) [-1252.366] (-1251.821) -- 0:00:01
978500 -- (-1252.023) (-1254.861) [-1255.315] (-1250.110) * [-1252.017] (-1252.709) (-1255.244) (-1255.678) -- 0:00:01
979000 -- (-1254.127) (-1253.062) (-1253.890) [-1252.195] * [-1253.771] (-1254.612) (-1252.590) (-1254.544) -- 0:00:01
979500 -- (-1260.145) [-1249.740] (-1252.770) (-1252.425) * [-1252.975] (-1260.989) (-1253.601) (-1253.213) -- 0:00:01
980000 -- (-1253.482) (-1252.720) (-1252.710) [-1251.341] * (-1251.868) (-1253.617) (-1257.076) [-1252.599] -- 0:00:01
Average standard deviation of split frequencies: 0.005708
980500 -- (-1253.185) (-1252.679) (-1257.573) [-1250.456] * (-1251.731) (-1253.051) (-1252.549) [-1254.840] -- 0:00:01
981000 -- [-1255.421] (-1252.329) (-1253.910) (-1254.017) * [-1251.648] (-1252.111) (-1253.751) (-1252.697) -- 0:00:01
981500 -- (-1253.316) [-1252.653] (-1252.658) (-1251.115) * (-1251.103) (-1254.919) [-1252.479] (-1252.582) -- 0:00:01
982000 -- (-1253.181) (-1253.502) [-1250.840] (-1253.549) * (-1252.832) (-1255.537) (-1251.854) [-1252.042] -- 0:00:01
982500 -- (-1252.796) [-1252.489] (-1255.624) (-1253.274) * (-1250.919) (-1254.960) (-1254.582) [-1253.264] -- 0:00:01
983000 -- (-1252.063) (-1253.105) [-1254.266] (-1251.514) * [-1251.437] (-1253.047) (-1255.078) (-1250.838) -- 0:00:01
983500 -- (-1251.519) (-1255.871) [-1254.234] (-1250.143) * (-1253.114) (-1253.061) (-1253.423) [-1253.507] -- 0:00:01
984000 -- (-1250.805) [-1253.731] (-1253.546) (-1253.036) * (-1252.010) (-1259.998) (-1254.658) [-1255.644] -- 0:00:01
984500 -- [-1253.281] (-1253.368) (-1251.365) (-1255.649) * (-1251.760) [-1252.718] (-1253.667) (-1252.070) -- 0:00:01
985000 -- [-1253.217] (-1251.022) (-1250.781) (-1251.773) * [-1251.444] (-1253.111) (-1252.537) (-1253.941) -- 0:00:01
Average standard deviation of split frequencies: 0.005767
985500 -- (-1253.995) [-1252.759] (-1251.742) (-1249.841) * (-1252.194) (-1254.243) [-1252.602] (-1252.789) -- 0:00:00
986000 -- (-1252.635) (-1252.302) [-1253.041] (-1250.406) * (-1254.160) [-1254.465] (-1251.183) (-1252.082) -- 0:00:00
986500 -- [-1253.234] (-1250.777) (-1251.803) (-1252.093) * (-1252.113) [-1254.373] (-1252.191) (-1253.433) -- 0:00:00
987000 -- (-1251.704) (-1257.194) [-1251.735] (-1251.862) * (-1252.304) [-1251.867] (-1252.737) (-1251.852) -- 0:00:00
987500 -- (-1255.303) (-1252.212) (-1249.759) [-1257.853] * (-1255.886) (-1252.813) [-1250.767] (-1251.644) -- 0:00:00
988000 -- (-1252.909) (-1251.680) (-1251.492) [-1252.222] * (-1252.573) (-1256.214) [-1253.677] (-1251.295) -- 0:00:00
988500 -- (-1253.304) [-1253.616] (-1252.152) (-1252.135) * (-1255.732) (-1254.028) [-1254.409] (-1258.181) -- 0:00:00
989000 -- (-1250.418) (-1255.861) [-1251.811] (-1252.114) * (-1256.093) (-1255.521) (-1253.842) [-1251.210] -- 0:00:00
989500 -- (-1251.652) (-1253.556) [-1251.879] (-1251.515) * (-1252.114) (-1255.889) [-1252.131] (-1252.213) -- 0:00:00
990000 -- (-1253.516) (-1254.134) (-1253.596) [-1252.934] * (-1252.339) (-1254.554) (-1252.078) [-1253.108] -- 0:00:00
Average standard deviation of split frequencies: 0.005859
990500 -- [-1253.567] (-1251.904) (-1253.246) (-1255.061) * (-1251.931) (-1254.475) (-1253.388) [-1253.903] -- 0:00:00
991000 -- [-1253.171] (-1252.153) (-1255.504) (-1253.429) * (-1251.990) (-1253.493) [-1252.397] (-1253.636) -- 0:00:00
991500 -- (-1255.907) (-1252.542) [-1251.809] (-1255.502) * (-1251.758) (-1253.395) (-1253.325) [-1251.791] -- 0:00:00
992000 -- (-1255.483) (-1254.105) (-1253.473) [-1251.226] * (-1253.574) (-1254.466) [-1255.359] (-1254.556) -- 0:00:00
992500 -- (-1256.585) (-1250.771) [-1252.517] (-1254.336) * (-1251.020) (-1255.378) [-1250.808] (-1257.189) -- 0:00:00
993000 -- (-1254.764) (-1251.701) (-1255.349) [-1255.243] * [-1251.289] (-1257.203) (-1253.298) (-1257.659) -- 0:00:00
993500 -- (-1253.820) (-1251.959) (-1251.728) [-1252.036] * [-1256.818] (-1262.176) (-1252.814) (-1256.429) -- 0:00:00
994000 -- [-1254.603] (-1254.347) (-1251.967) (-1253.443) * [-1251.539] (-1264.042) (-1253.168) (-1256.012) -- 0:00:00
994500 -- (-1253.193) (-1251.114) (-1254.961) [-1252.958] * (-1252.413) [-1254.384] (-1253.705) (-1251.975) -- 0:00:00
995000 -- [-1255.663] (-1253.570) (-1250.828) (-1254.947) * (-1252.973) (-1253.201) (-1251.775) [-1250.181] -- 0:00:00
Average standard deviation of split frequencies: 0.005798
995500 -- (-1258.002) (-1250.760) [-1254.073] (-1252.433) * (-1251.533) (-1252.552) [-1250.795] (-1252.376) -- 0:00:00
996000 -- [-1253.878] (-1250.148) (-1252.073) (-1254.331) * (-1253.491) (-1251.450) (-1251.894) [-1251.575] -- 0:00:00
996500 -- (-1253.645) (-1250.745) [-1253.214] (-1250.921) * [-1251.154] (-1253.694) (-1252.448) (-1252.717) -- 0:00:00
997000 -- (-1254.027) (-1251.992) (-1252.529) [-1251.160] * (-1251.446) (-1252.749) (-1252.937) [-1255.142] -- 0:00:00
997500 -- [-1255.854] (-1252.362) (-1251.565) (-1253.845) * (-1249.589) (-1254.662) (-1250.192) [-1251.383] -- 0:00:00
998000 -- [-1252.489] (-1251.869) (-1251.197) (-1253.404) * (-1251.583) (-1253.440) (-1251.528) [-1249.916] -- 0:00:00
998500 -- [-1252.074] (-1253.171) (-1251.226) (-1252.880) * (-1253.428) (-1254.434) (-1256.082) [-1251.654] -- 0:00:00
999000 -- (-1251.385) [-1250.805] (-1251.634) (-1253.531) * (-1251.404) (-1253.637) [-1250.865] (-1257.768) -- 0:00:00
999500 -- [-1252.635] (-1253.094) (-1250.468) (-1252.970) * [-1253.515] (-1255.047) (-1253.119) (-1252.042) -- 0:00:00
1000000 -- [-1254.073] (-1251.285) (-1253.538) (-1251.732) * [-1251.685] (-1250.470) (-1253.816) (-1251.748) -- 0:00:00
Average standard deviation of split frequencies: 0.006095
Analysis completed in 1 mins 7 seconds
Analysis used 65.92 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1247.54
Likelihood of best state for "cold" chain of run 2 was -1247.76
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.4 % ( 63 %) Dirichlet(Revmat{all})
98.5 % ( 96 %) Slider(Revmat{all})
26.1 % ( 27 %) Dirichlet(Pi{all})
28.0 % ( 22 %) Slider(Pi{all})
79.8 % ( 53 %) Multiplier(Alpha{1,2})
69.1 % ( 33 %) Multiplier(Alpha{3})
25.2 % ( 28 %) Slider(Pinvar{all})
97.2 % ( 95 %) ExtSPR(Tau{all},V{all})
69.0 % ( 71 %) ExtTBR(Tau{all},V{all})
98.1 % ( 98 %) NNI(Tau{all},V{all})
87.8 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
95.3 % ( 93 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 69 %) Dirichlet(Revmat{all})
98.7 % ( 99 %) Slider(Revmat{all})
26.1 % ( 21 %) Dirichlet(Pi{all})
28.4 % ( 26 %) Slider(Pi{all})
80.1 % ( 62 %) Multiplier(Alpha{1,2})
68.9 % ( 44 %) Multiplier(Alpha{3})
24.5 % ( 29 %) Slider(Pinvar{all})
97.3 % ( 97 %) ExtSPR(Tau{all},V{all})
69.0 % ( 70 %) ExtTBR(Tau{all},V{all})
98.1 % ( 98 %) NNI(Tau{all},V{all})
87.9 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
95.2 % ( 94 %) Nodeslider(V{all})
30.2 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166303 0.82 0.66
3 | 167070 166456 0.83
4 | 166992 167017 166162
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166333 0.82 0.66
3 | 166697 166367 0.83
4 | 167375 165682 167546
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1251.69
| 2 |
| 2 |
| 1 1 1 2 |
| 2 1 22 |
|1 11 11 1 1 1 |
| 11 22 2 2 1 2 1 2 2|
| 2 2 11 2 1 1 1 1 1 22 1 |
| 2 1 1 21 2 1 12 2 22 1 11 1 |
| 2 1 1 2 2122 1 1 2 121 2 1 1 2 |
| 2*1 22 1 2 2 2 1 2 * 2 2 2 2 1 |
|21 2 |
| 1 1 2 * 1 |
| 1 2 2 2 22 * |
| 1 1|
| * 2 21 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1253.41
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1251.54 -1254.87
2 -1251.60 -1255.19
--------------------------------------
TOTAL -1251.57 -1255.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.880184 0.092094 0.342908 1.461215 0.850067 1238.64 1368.73 1.000
r(A<->C){all} 0.158753 0.019363 0.000097 0.440332 0.118725 158.71 197.42 1.006
r(A<->G){all} 0.154432 0.018473 0.000077 0.435663 0.115063 148.61 235.91 1.008
r(A<->T){all} 0.173773 0.021920 0.000017 0.474147 0.133502 243.90 250.03 1.000
r(C<->G){all} 0.190752 0.022641 0.000019 0.486873 0.153099 283.76 292.65 1.000
r(C<->T){all} 0.177529 0.022198 0.000093 0.476947 0.138681 120.43 177.35 1.000
r(G<->T){all} 0.144762 0.017892 0.000003 0.424037 0.099601 252.01 266.27 1.000
pi(A){all} 0.193293 0.000179 0.168713 0.220736 0.193031 1219.72 1333.58 1.001
pi(C){all} 0.274626 0.000227 0.246515 0.305084 0.274199 1369.86 1421.23 1.000
pi(G){all} 0.309401 0.000236 0.280596 0.340768 0.309216 1221.74 1277.19 1.000
pi(T){all} 0.222681 0.000193 0.198314 0.252930 0.222509 1145.65 1182.45 1.000
alpha{1,2} 0.314495 0.197747 0.000236 1.209470 0.133957 1024.68 1222.83 1.002
alpha{3} 0.386383 0.167834 0.000662 1.261279 0.261036 1090.04 1208.37 1.000
pinvar{all} 0.995822 0.000013 0.988479 0.999908 0.996833 1199.51 1300.67 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- .*...*
9 -- ..*.*.
10 -- .*.***
11 -- ..**..
12 -- .*.*..
13 -- .**...
14 -- .****.
15 -- ...*.*
16 -- ..****
17 -- ...**.
18 -- ....**
19 -- ..*..*
20 -- .*..*.
21 -- .**.**
22 -- .*.*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 464 0.154564 0.001884 0.153231 0.155896 2
8 447 0.148901 0.004240 0.145903 0.151899 2
9 445 0.148235 0.002355 0.146569 0.149900 2
10 444 0.147901 0.004711 0.144570 0.151233 2
11 439 0.146236 0.006124 0.141905 0.150566 2
12 437 0.145570 0.015546 0.134577 0.156562 2
13 430 0.143238 0.008480 0.137242 0.149234 2
14 429 0.142905 0.004240 0.139907 0.145903 2
15 423 0.140906 0.004240 0.137908 0.143904 2
16 422 0.140573 0.004711 0.137242 0.143904 2
17 418 0.139241 0.005653 0.135243 0.143238 2
18 416 0.138574 0.003769 0.135909 0.141239 2
19 400 0.133245 0.011306 0.125250 0.141239 2
20 399 0.132911 0.008009 0.127249 0.138574 2
21 393 0.130913 0.002355 0.129247 0.132578 2
22 293 0.097602 0.009893 0.090606 0.104597 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0466/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.092160 0.009024 0.000022 0.287512 0.064052 1.000 2
length{all}[2] 0.094654 0.009470 0.000023 0.293416 0.064350 1.000 2
length{all}[3] 0.091636 0.008662 0.000115 0.276110 0.062041 1.000 2
length{all}[4] 0.092690 0.009277 0.000026 0.282749 0.062515 1.000 2
length{all}[5] 0.094701 0.008707 0.000016 0.275682 0.068051 1.000 2
length{all}[6] 0.133400 0.013975 0.000012 0.359389 0.102675 1.000 2
length{all}[7] 0.096537 0.010069 0.000414 0.315340 0.063589 0.998 2
length{all}[8] 0.098843 0.010759 0.000136 0.326614 0.064346 1.006 2
length{all}[9] 0.089881 0.007985 0.000249 0.263881 0.058529 0.998 2
length{all}[10] 0.096254 0.009103 0.000183 0.295255 0.066493 1.000 2
length{all}[11] 0.092324 0.008573 0.000157 0.263866 0.067081 0.998 2
length{all}[12] 0.096379 0.010776 0.000043 0.298428 0.066656 0.999 2
length{all}[13] 0.094688 0.010225 0.000046 0.319119 0.059683 1.004 2
length{all}[14] 0.096839 0.011045 0.000179 0.308277 0.058459 1.002 2
length{all}[15] 0.094631 0.008115 0.000285 0.270265 0.067520 0.999 2
length{all}[16] 0.090827 0.010305 0.000061 0.275300 0.056908 0.998 2
length{all}[17] 0.096645 0.010139 0.000164 0.291411 0.065536 0.998 2
length{all}[18] 0.091491 0.007827 0.000022 0.257903 0.064233 0.998 2
length{all}[19] 0.102335 0.009362 0.000895 0.324747 0.071828 1.005 2
length{all}[20] 0.084220 0.008440 0.000349 0.264826 0.052521 0.998 2
length{all}[21] 0.083799 0.005935 0.000378 0.240728 0.056724 0.998 2
length{all}[22] 0.095599 0.009860 0.000325 0.273085 0.065391 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006095
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------- C1 (1)
|
|--------------------------------------------- C2 (2)
|
|-------------------------------------------- C3 (3)
+
|-------------------------------------------- C4 (4)
|
|------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|-------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 903
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 59 patterns at 301 / 301 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 59 patterns at 301 / 301 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
57584 bytes for conP
5192 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.103654 0.094731 0.066720 0.100187 0.012147 0.014562 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1332.309429
Iterating by ming2
Initial: fx= 1332.309429
x= 0.10365 0.09473 0.06672 0.10019 0.01215 0.01456 0.30000 1.30000
1 h-m-p 0.0000 0.0000 697.7180 ++ 1312.825325 m 0.0000 13 | 1/8
2 h-m-p 0.0000 0.0000 4710.1556 ++ 1248.282759 m 0.0000 24 | 2/8
3 h-m-p 0.0014 0.0069 41.8019 -----------.. | 2/8
4 h-m-p 0.0000 0.0001 517.4090 ++ 1235.126649 m 0.0001 55 | 2/8
5 h-m-p -0.0000 -0.0000 40225.1082
h-m-p: -2.25251205e-19 -1.12625603e-18 4.02251082e+04 1235.126649
.. | 2/8
6 h-m-p 0.0000 0.0000 236612.6449 --CYCYCCCC 1229.390600 7 0.0000 89 | 2/8
7 h-m-p 0.0000 0.0000 515.8752 ++ 1223.001015 m 0.0000 100 | 3/8
8 h-m-p 0.0003 0.0388 38.2426 ----------.. | 3/8
9 h-m-p 0.0000 0.0000 421.5333 ++ 1219.696544 m 0.0000 130 | 4/8
10 h-m-p 0.0000 0.0000 16652.4821 ++ 1218.657012 m 0.0000 141 | 5/8
11 h-m-p 0.0014 0.7198 0.4427 +++++ 1218.496649 m 0.7198 155 | 6/8
12 h-m-p 0.3631 8.0000 0.2974 +YCCC 1218.442790 3 2.9874 175 | 6/8
13 h-m-p 1.6000 8.0000 0.1865 +YCCC 1218.393555 3 4.6256 194 | 6/8
14 h-m-p 1.6000 8.0000 0.4830 +YCCC 1218.359729 3 4.7122 213 | 6/8
15 h-m-p 1.6000 8.0000 0.8693 CCC 1218.339992 2 2.1913 230 | 6/8
16 h-m-p 1.6000 8.0000 1.0348 +YCC 1218.324388 2 5.1803 247 | 6/8
17 h-m-p 1.6000 8.0000 1.9024 CCC 1218.316060 2 2.2184 262 | 6/8
18 h-m-p 1.6000 8.0000 2.3462 +CC 1218.309030 1 5.4117 276 | 6/8
19 h-m-p 1.6000 8.0000 4.2613 CC 1218.305509 1 2.1687 289 | 6/8
20 h-m-p 1.6000 8.0000 5.3646 +CC 1218.302305 1 5.8348 303 | 6/8
21 h-m-p 1.6000 8.0000 9.7315 CC 1218.300844 1 2.0757 316 | 6/8
22 h-m-p 1.6000 8.0000 12.1466 +C 1218.299426 0 6.4000 328 | 6/8
23 h-m-p 1.6000 8.0000 22.3966 CC 1218.298820 1 1.9686 341 | 6/8
24 h-m-p 1.5886 8.0000 27.7536 +Y 1218.298194 0 7.0965 353 | 6/8
25 h-m-p 1.6000 8.0000 53.1292 C 1218.297948 0 1.8804 364 | 6/8
26 h-m-p 1.5037 7.5183 65.1684 ++ 1218.297676 m 7.5183 375 | 7/8
27 h-m-p 1.6000 8.0000 0.0000 YC 1218.297634 1 0.9977 387 | 7/8
28 h-m-p 1.6000 8.0000 0.0000 -----Y 1218.297634 0 0.0001 404
Out..
lnL = -1218.297634
405 lfun, 405 eigenQcodon, 2430 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.071858 0.098245 0.029662 0.042932 0.089001 0.010354 0.000100 0.704938 0.187736
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 16.262625
np = 9
lnL0 = -1312.200316
Iterating by ming2
Initial: fx= 1312.200316
x= 0.07186 0.09825 0.02966 0.04293 0.08900 0.01035 0.00011 0.70494 0.18774
1 h-m-p 0.0000 0.0000 617.9277 ++ 1311.674138 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 38828.3473 ++ 1278.439075 m 0.0000 26 | 1/9
3 h-m-p 0.0000 0.0000 489.4123 ++ 1277.388114 m 0.0000 38 | 2/9
4 h-m-p 0.0000 0.0000 33135.8988 ++ 1276.919760 m 0.0000 50 | 2/9
5 h-m-p -0.0000 -0.0000 58978.1180
h-m-p: -0.00000000e+00 -0.00000000e+00 5.89781180e+04 1276.919760
.. | 2/9
6 h-m-p 0.0000 0.0000 236630.1181 ---YYCCYC 1271.122087 5 0.0000 83 | 2/9
7 h-m-p 0.0000 0.0000 553.3475 ++ 1256.805490 m 0.0000 95 | 3/9
8 h-m-p 0.0001 0.0007 203.8169 ++ 1231.646086 m 0.0007 107 | 4/9
9 h-m-p 0.0000 0.0000 1695.3991 ++ 1221.960734 m 0.0000 119 | 5/9
10 h-m-p 0.0000 0.0000 1278.9560 ++ 1221.799165 m 0.0000 131 | 5/9
11 h-m-p 0.0000 0.0000 227.8355
h-m-p: 5.18413661e-22 2.59206831e-21 2.27835467e+02 1221.799165
.. | 5/9
12 h-m-p 0.0000 0.0000 290.9537 ++ 1219.077548 m 0.0000 152 | 6/9
13 h-m-p 0.0006 0.3161 2.5399 ++++YC 1218.831700 1 0.1012 169 | 6/9
14 h-m-p 1.3898 6.9491 0.1234 CYC 1218.685740 2 1.0471 184 | 6/9
15 h-m-p 1.1221 5.6107 0.0802 ++ 1218.566548 m 5.6107 199 | 7/9
16 h-m-p 0.5417 8.0000 0.0283 CC 1218.565860 1 0.4344 216 | 7/9
17 h-m-p 1.6000 8.0000 0.0000 -------Y 1218.565860 0 0.0000 237
Out..
lnL = -1218.565860
238 lfun, 714 eigenQcodon, 2856 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.071715 0.034969 0.102292 0.043077 0.015741 0.033337 0.000100 1.286915 0.474262 0.394650 1002.227642
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.080100
np = 11
lnL0 = -1260.111949
Iterating by ming2
Initial: fx= 1260.111949
x= 0.07172 0.03497 0.10229 0.04308 0.01574 0.03334 0.00011 1.28692 0.47426 0.39465 951.42857
1 h-m-p 0.0000 0.0000 145.9871 ++ 1260.028284 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0074 30.2666 +++++ 1254.231046 m 0.0074 33 | 2/11
3 h-m-p 0.0003 0.0016 122.9337 ++ 1244.823118 m 0.0016 47 | 3/11
4 h-m-p 0.0000 0.0002 1185.5143 +YYYYCYCCC 1241.630877 8 0.0001 73 | 3/11
5 h-m-p 0.0001 0.0007 46.8412 ++ 1240.836019 m 0.0007 87 | 4/11
6 h-m-p 0.0000 0.0004 836.0387 ++ 1235.793830 m 0.0004 101 | 5/11
7 h-m-p 0.0002 0.0009 740.0488 ++ 1218.852836 m 0.0009 115 | 6/11
8 h-m-p 0.0202 0.1012 3.5390 +YCYCCC 1218.327300 5 0.0600 138 | 6/11
9 h-m-p 1.6000 8.0000 0.0029 ------------Y 1218.327300 0 0.0000 164 | 6/11
10 h-m-p 0.0080 4.0102 1.2584 +++YC 1218.321213 1 0.7981 187 | 6/11
11 h-m-p 1.6000 8.0000 0.0101 ++ 1218.320459 m 8.0000 201 | 6/11
12 h-m-p 0.1094 8.0000 0.7407 ++++ 1218.302590 m 8.0000 222 | 6/11
13 h-m-p 0.7400 3.7000 0.2940 ++ 1218.300032 m 3.7000 241 | 7/11
14 h-m-p 1.1207 8.0000 0.9604 +YY 1218.298048 1 4.4828 262 | 7/11
15 h-m-p 1.6000 8.0000 0.0184 ++ 1218.298048 m 8.0000 280 | 7/11
16 h-m-p 1.6000 8.0000 0.0138 +Y 1218.298048 0 4.4087 299 | 7/11
17 h-m-p 1.6000 8.0000 0.0164 ++ 1218.298045 m 8.0000 317 | 7/11
18 h-m-p 0.0269 8.0000 4.8663 ++Y 1218.298018 0 0.4303 337 | 7/11
19 h-m-p 0.9498 8.0000 2.2048 C 1218.298015 0 0.2553 351 | 7/11
20 h-m-p 1.6000 8.0000 0.2707 Y 1218.298014 0 0.9264 365 | 7/11
21 h-m-p 1.6000 8.0000 0.0604 C 1218.298014 0 1.6000 383 | 7/11
22 h-m-p 1.6000 8.0000 0.0074 ++ 1218.298013 m 8.0000 401 | 7/11
23 h-m-p 0.2186 8.0000 0.2693 +Y 1218.298008 0 2.0434 420 | 7/11
24 h-m-p 1.6000 8.0000 0.0887 ++ 1218.297966 m 8.0000 438 | 7/11
25 h-m-p 0.7394 8.0000 0.9601 ++ 1218.297696 m 8.0000 456 | 7/11
26 h-m-p 1.6000 8.0000 1.3880 Y 1218.297651 0 1.1962 474 | 7/11
27 h-m-p 1.6000 8.0000 0.0765 Y 1218.297651 0 1.2350 488 | 7/11
28 h-m-p 1.6000 8.0000 0.0262 C 1218.297651 0 1.3533 506 | 7/11
29 h-m-p 0.3315 8.0000 0.1071 ++C 1218.297651 0 5.0078 526 | 7/11
30 h-m-p 1.3713 8.0000 0.3913 ++ 1218.297650 m 8.0000 544 | 7/11
31 h-m-p 1.6000 8.0000 0.2644 Y 1218.297650 0 1.1652 562 | 7/11
32 h-m-p 0.6321 8.0000 0.4875 +Y 1218.297650 0 1.7386 581 | 7/11
33 h-m-p 0.9811 8.0000 0.8639 ++ 1218.297650 m 8.0000 599 | 7/11
34 h-m-p 1.6000 8.0000 0.5530 Y 1218.297650 0 3.6920 617 | 7/11
35 h-m-p 1.6000 8.0000 0.5281 -C 1218.297650 0 0.0854 636 | 7/11
36 h-m-p 0.2600 8.0000 0.1734 Y 1218.297650 0 0.0442 654 | 7/11
37 h-m-p 0.0160 8.0000 1.0436 -C 1218.297650 0 0.0010 673 | 7/11
38 h-m-p 0.0160 8.0000 0.1764 +++++ 1218.297650 m 8.0000 690 | 7/11
39 h-m-p 0.4452 8.0000 3.1693 +++ 1218.297650 m 8.0000 709 | 7/11
40 h-m-p 0.1587 0.7936 72.7027 Y 1218.297650 0 0.1076 723 | 7/11
41 h-m-p 0.4260 2.7149 18.3707 ----Y 1218.297650 0 0.0004 741 | 7/11
42 h-m-p 0.0187 8.0000 0.4094 Y 1218.297650 0 0.0047 755 | 7/11
43 h-m-p 0.0755 8.0000 0.0253 Y 1218.297650 0 0.0189 773 | 7/11
44 h-m-p 0.0160 8.0000 0.5558 -----Y 1218.297650 0 0.0000 796 | 7/11
45 h-m-p 0.0160 8.0000 0.0331 -----------Y 1218.297650 0 0.0000 825 | 7/11
46 h-m-p 0.0160 8.0000 0.0649 -----C 1218.297650 0 0.0000 848 | 7/11
47 h-m-p 0.8442 8.0000 0.0000 ----N 1218.297650 0 0.0008 870 | 7/11
48 h-m-p 0.0160 8.0000 0.0000 Y 1218.297650 0 0.0160 888
Out..
lnL = -1218.297650
889 lfun, 3556 eigenQcodon, 16002 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1223.237135 S = -1221.798280 -2.367413
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 59 patterns 0:05
did 20 / 59 patterns 0:05
did 30 / 59 patterns 0:05
did 40 / 59 patterns 0:05
did 50 / 59 patterns 0:05
did 59 / 59 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.086580 0.101523 0.092382 0.050557 0.056769 0.027621 0.000100 0.655671 1.711855
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.370906
np = 9
lnL0 = -1331.702967
Iterating by ming2
Initial: fx= 1331.702967
x= 0.08658 0.10152 0.09238 0.05056 0.05677 0.02762 0.00011 0.65567 1.71186
1 h-m-p 0.0000 0.0000 637.8653 ++ 1331.338217 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 4336.9708 +CCYYYCYCCC 1310.529760 9 0.0000 41 | 1/9
3 h-m-p 0.0005 0.0079 82.9983 ++YYYCYYYCC 1266.148685 8 0.0076 65 | 1/9
4 h-m-p 0.0001 0.0005 9.7324 ---------.. | 1/9
5 h-m-p 0.0000 0.0000 869.9383 ++ 1262.874758 m 0.0000 96 | 2/9
6 h-m-p 0.0000 0.0000 1014.8292 ++ 1255.470073 m 0.0000 108 | 3/9
7 h-m-p 0.0000 0.0000 6823.2701 ++ 1227.661764 m 0.0000 120 | 4/9
8 h-m-p 0.0000 0.0000 954.3815 ++ 1223.930771 m 0.0000 132 | 5/9
9 h-m-p 0.0000 0.0002 104.0263 ++ 1220.822215 m 0.0002 144 | 6/9
10 h-m-p 0.0217 3.0248 0.5523 ++++ 1218.566187 m 3.0248 158 | 7/9
11 h-m-p 1.6000 8.0000 0.0004 YC 1218.566042 1 1.1950 174 | 7/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 1218.566041 m 8.0000 188 | 7/9
13 h-m-p 0.0830 8.0000 0.0028 ++Y 1218.566024 0 2.1623 204 | 7/9
14 h-m-p 1.6000 8.0000 0.0026 ++ 1218.565942 m 8.0000 218 | 7/9
15 h-m-p 1.2996 8.0000 0.0161 ++ 1218.565872 m 8.0000 232 | 7/9
16 h-m-p 1.6000 8.0000 0.0066 Y 1218.565868 0 1.2393 246 | 7/9
17 h-m-p 1.1553 8.0000 0.0071 ++ 1218.565865 m 8.0000 260 | 7/9
18 h-m-p 1.1422 8.0000 0.0497 +Y 1218.565861 0 3.5398 275 | 7/9
19 h-m-p 1.6000 8.0000 0.0288 C 1218.565860 0 1.5822 289 | 7/9
20 h-m-p 1.1000 8.0000 0.0414 ++ 1218.565859 m 8.0000 303 | 7/9
21 h-m-p 1.6000 8.0000 0.0976 Y 1218.565859 0 3.2925 317 | 7/9
22 h-m-p 1.6000 8.0000 0.0916 C 1218.565859 0 2.0097 331 | 7/9
23 h-m-p 0.9771 8.0000 0.1884
QuantileBeta(0.85, 2.19014, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
+ 1218.565858 m 8.0000 345
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.96105, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
24 h-m-p 1.6000 8.0000 0.2975
QuantileBeta(0.85, 3.43708, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.86517, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
Y 1218.565858 0 2.7741 359
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78655, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78623, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.78639, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
25 h-m-p 1.6000 8.0000 0.1793
QuantileBeta(0.85, 4.07322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.93370, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
C 1218.565858 0 1.3872 373
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03524, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03491, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.03507, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
26 h-m-p 0.3714 8.0000 0.6695
QuantileBeta(0.85, 4.28376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.02981, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 8.01403, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
C 1218.565858 0 2.1344 388
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46434, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46395, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46415, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
27 h-m-p 1.3781 8.0000 1.0370
QuantileBeta(0.85, 6.89322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.18044, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
+ 1218.565858 m 8.0000 402
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.76017, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
28 h-m-p 1.6000 8.0000 0.1813
QuantileBeta(0.85, 13.47012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.59998, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
Y 1218.565858 0 2.7824 414
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25610, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25544, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
29 h-m-p 1.6000 8.0000 0.1509
QuantileBeta(0.85, 13.49718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.31612, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.27086, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25954, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25671, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25601, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25583, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25579, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
Y 1218.565858 0 0.0000 438
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25610, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25544, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
30 h-m-p 0.0160 8.0000 0.0003
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
C 1218.565858 0 0.0015 453
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25610, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25544, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
31 h-m-p 0.2181 8.0000 0.0000
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
C 1218.565858 0 0.0034 469
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1218.565858
470 lfun, 5170 eigenQcodon, 28200 P(t)
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.25577, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:13
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.023310 0.051963 0.048270 0.079906 0.050951 0.032830 0.000100 0.900000 0.459005 1.214890 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.128516
np = 11
lnL0 = -1248.383546
Iterating by ming2
Initial: fx= 1248.383546
x= 0.02331 0.05196 0.04827 0.07991 0.05095 0.03283 0.00011 0.90000 0.45900 1.21489 951.42857
1 h-m-p 0.0000 0.0000 218.6495 ++ 1248.093758 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0000 4311.2016 ++ 1227.551571 m 0.0000 30 | 2/11
3 h-m-p 0.0000 0.0002 188.4158 +YYCYCCC 1224.723148 6 0.0001 54 | 2/11
4 h-m-p 0.0001 0.0005 72.7513 CYCCC 1223.994086 4 0.0002 75 | 2/11
5 h-m-p 0.0080 0.0401 1.5890 ++ 1223.746706 m 0.0401 89 | 3/11
6 h-m-p 0.0001 0.0005 152.0069 ++ 1220.975931 m 0.0005 103 | 4/11
7 h-m-p 0.0006 0.0029 5.7637 ++ 1220.371717 m 0.0029 117 | 5/11
8 h-m-p 0.0000 0.0002 257.7293 ++ 1220.096827 m 0.0002 131 | 6/11
9 h-m-p 0.0500 0.5807 0.9588 +YCYYYYCYYC 1219.108966 10 0.5268 160 | 6/11
10 h-m-p 0.0763 0.3816 0.4330 YYC 1219.103513 2 0.0497 181 | 6/11
11 h-m-p 0.0201 1.5147 1.0680 +++
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
+ 1218.683070 m 1.5147 202
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.24103, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
12 h-m-p 1.6000 8.0000 0.3392
QuantileBeta(0.85, 2.78367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.41160, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
+ 1218.495547 m 8.0000 216
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95442, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95405, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95424, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
13 h-m-p 1.6000 8.0000 1.0559
QuantileBeta(0.85, 6.64373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.71220, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
+ 1218.392316 m 8.0000 234
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.40169, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
14 h-m-p 1.6000 8.0000 1.7080
QuantileBeta(0.85, 16.13443, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.33264, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.85620, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 14.62894, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.37187, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
C 1218.361812 2 1.1492 251
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36445, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.36444, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
15 h-m-p 1.5285 8.0000 1.2841
QuantileBeta(0.85, 17.32720, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.21547, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
+ 1218.334327 m 8.0000 265
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.63705, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
16 h-m-p 1.6000 8.0000 5.7282
QuantileBeta(0.85, 34.80216, 0.00500) = 1.000000e+00 2000 rounds
++ 1218.309043 m 8.0000 279 | 7/11
17 h-m-p 0.8658 4.3292 6.3610 +YC 1218.306163 1 2.4650 295 | 7/11
18 h-m-p 0.2577 1.2885 9.2027 ++ 1218.304436 m 1.2885 309 | 7/11
19 h-m-p 0.0000 0.0000 40.8523
h-m-p: 0.00000000e+00 0.00000000e+00 4.08522672e+01 1218.304436
.. | 7/11
20 h-m-p 0.0160 8.0000 5.7579 ----YC 1218.304257 1 0.0000 339 | 7/11
21 h-m-p 0.0160 8.0000 0.0281 +++++ 1218.300298 m 8.0000 356 | 7/11
22 h-m-p 0.5539 2.7697 0.1448 ++ 1218.297652 m 2.7697 374 | 8/11
23 h-m-p 0.4477 2.2384 0.0000 Y 1218.297650 0 0.7412 392 | 8/11
24 h-m-p 1.6000 8.0000 0.0000 ------C 1218.297650 0 0.0001 415
Out..
lnL = -1218.297650
416 lfun, 4992 eigenQcodon, 27456 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1222.975787 S = -1221.798025 -1.981229
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 59 patterns 0:24
did 20 / 59 patterns 0:24
did 30 / 59 patterns 0:24
did 40 / 59 patterns 0:24
did 50 / 59 patterns 0:24
did 59 / 59 patterns 0:24
Time used: 0:24
CodeML output code: -1