--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:46:10 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0473/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -372.81 -376.95
2 -372.84 -375.99
--------------------------------------
TOTAL -372.83 -376.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895957 0.092503 0.338742 1.476517 0.857004 1327.57 1414.28 1.000
r(A<->C){all} 0.173871 0.021054 0.000027 0.462687 0.137751 149.26 203.09 1.000
r(A<->G){all} 0.164072 0.020249 0.000261 0.455768 0.126516 233.56 271.23 1.000
r(A<->T){all} 0.177513 0.023605 0.000002 0.491932 0.132407 168.19 172.16 1.001
r(C<->G){all} 0.155663 0.018058 0.000130 0.438825 0.115392 121.76 140.21 1.000
r(C<->T){all} 0.163454 0.017786 0.000020 0.423166 0.129169 340.80 379.15 1.003
r(G<->T){all} 0.165427 0.020690 0.000001 0.459965 0.124908 257.38 258.48 1.000
pi(A){all} 0.203480 0.000580 0.154751 0.247598 0.202454 1155.82 1319.94 1.001
pi(C){all} 0.248597 0.000687 0.200354 0.299649 0.247946 1277.05 1297.37 1.000
pi(G){all} 0.310479 0.000752 0.256960 0.365068 0.310482 1190.46 1211.35 1.000
pi(T){all} 0.237444 0.000647 0.189649 0.286948 0.236637 1171.36 1194.10 1.000
alpha{1,2} 0.402204 0.213306 0.000143 1.349383 0.240238 976.82 1183.97 1.000
alpha{3} 0.444157 0.220129 0.000156 1.394500 0.289813 1356.72 1428.86 1.000
pinvar{all} 0.993885 0.000053 0.979517 0.999996 0.996260 1434.96 1467.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -357.614031
Model 2: PositiveSelection -357.613978
Model 0: one-ratio -357.614045
Model 7: beta -357.613978
Model 8: beta&w>1 -357.613978
Model 0 vs 1 2.7999999929306796E-5
Model 2 vs 1 1.0600000007343624E-4
Model 8 vs 7 0.0
>C1
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C2
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C3
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C4
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C5
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C6
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=90
C1 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C2 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C3 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C4 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C5 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C6 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
**************************************************
C1 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C2 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C3 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C4 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C5 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C6 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2700]--->[2700]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.451 Mb, Max= 30.613 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C2 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C3 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C4 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C5 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C6 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
**************************************************
C1 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C2 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C3 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C4 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C5 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C6 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C2 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C3 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C4 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C5 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C6 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
**************************************************
C1 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C2 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C3 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C4 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C5 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C6 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
**************************************************
C1 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C2 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C3 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C4 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C5 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C6 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
**************************************************
C1 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C2 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C3 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C4 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C5 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C6 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
**************************************************
C1 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C2 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C3 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C4 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C5 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C6 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
**************************************************
C1 GTTCGGATGTCTGGTACTTG
C2 GTTCGGATGTCTGGTACTTG
C3 GTTCGGATGTCTGGTACTTG
C4 GTTCGGATGTCTGGTACTTG
C5 GTTCGGATGTCTGGTACTTG
C6 GTTCGGATGTCTGGTACTTG
********************
>C1
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C2
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C3
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C4
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C5
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C6
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C1
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C2
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C3
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C4
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C5
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C6
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 270 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579801485
Setting output file names to "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 148623613
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1005875860
Seed = 2028431682
Swapseed = 1579801485
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -604.272943 -- -24.965149
Chain 2 -- -604.272851 -- -24.965149
Chain 3 -- -604.272851 -- -24.965149
Chain 4 -- -604.272908 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -604.272943 -- -24.965149
Chain 2 -- -604.272943 -- -24.965149
Chain 3 -- -604.272943 -- -24.965149
Chain 4 -- -604.272943 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-604.273] (-604.273) (-604.273) (-604.273) * [-604.273] (-604.273) (-604.273) (-604.273)
500 -- [-383.799] (-382.583) (-379.538) (-376.944) * (-388.435) (-392.313) [-380.227] (-383.558) -- 0:00:00
1000 -- (-382.731) (-387.530) [-377.295] (-385.570) * (-380.046) (-379.338) [-380.704] (-377.095) -- 0:00:00
1500 -- (-380.237) (-386.547) (-384.553) [-377.618] * [-377.833] (-393.433) (-383.972) (-378.440) -- 0:00:00
2000 -- (-381.245) (-382.999) (-380.998) [-380.706] * (-381.092) (-382.619) [-381.941] (-383.193) -- 0:00:00
2500 -- (-379.578) [-381.921] (-382.490) (-382.811) * (-384.844) (-380.622) (-393.513) [-383.260] -- 0:00:00
3000 -- (-379.798) (-387.687) (-387.952) [-379.548] * (-376.729) (-391.469) [-377.065] (-382.493) -- 0:00:00
3500 -- (-387.208) (-389.808) (-380.626) [-387.777] * (-385.412) (-380.817) [-385.438] (-380.952) -- 0:00:00
4000 -- [-383.519] (-391.718) (-380.544) (-388.761) * [-380.608] (-383.223) (-380.880) (-384.166) -- 0:00:00
4500 -- (-377.772) [-382.613] (-381.448) (-377.777) * (-384.307) [-376.831] (-390.622) (-380.575) -- 0:00:00
5000 -- [-378.681] (-380.426) (-388.714) (-383.566) * [-389.048] (-378.785) (-381.416) (-379.007) -- 0:00:00
Average standard deviation of split frequencies: 0.099995
5500 -- (-385.738) [-375.577] (-380.842) (-380.312) * (-376.108) (-389.091) (-387.800) [-382.676] -- 0:00:00
6000 -- (-382.749) (-381.985) (-387.242) [-385.681] * (-382.391) (-381.664) (-387.241) [-377.847] -- 0:00:00
6500 -- (-384.870) [-377.472] (-382.404) (-379.196) * (-388.846) (-387.818) [-394.222] (-382.546) -- 0:00:00
7000 -- (-388.360) (-388.709) (-385.821) [-378.777] * [-380.873] (-379.652) (-384.092) (-377.036) -- 0:00:00
7500 -- (-386.283) (-380.259) (-386.315) [-376.916] * (-381.747) (-398.470) [-376.419] (-379.192) -- 0:00:00
8000 -- (-383.414) (-378.734) [-379.576] (-386.572) * [-378.300] (-392.121) (-379.076) (-389.643) -- 0:00:00
8500 -- (-387.437) [-380.697] (-383.251) (-391.766) * (-390.569) [-373.141] (-389.414) (-383.232) -- 0:00:00
9000 -- (-380.850) (-383.578) [-381.453] (-388.017) * (-393.680) (-372.513) [-388.547] (-388.624) -- 0:00:00
9500 -- (-374.097) [-381.272] (-381.699) (-381.542) * (-388.293) (-373.124) (-383.234) [-380.104] -- 0:00:00
10000 -- (-375.033) [-380.271] (-387.411) (-379.477) * [-372.345] (-376.024) (-392.699) (-378.510) -- 0:00:00
Average standard deviation of split frequencies: 0.072106
10500 -- (-372.439) (-378.489) [-384.345] (-392.441) * (-374.328) (-371.464) (-388.785) [-385.529] -- 0:00:00
11000 -- [-372.856] (-378.594) (-390.013) (-377.346) * (-372.815) (-373.744) (-389.431) [-384.784] -- 0:00:00
11500 -- [-376.379] (-382.193) (-384.316) (-376.436) * (-372.126) (-373.144) [-381.858] (-387.780) -- 0:00:00
12000 -- (-373.358) (-379.422) [-382.229] (-373.202) * [-371.678] (-374.116) (-385.519) (-390.448) -- 0:00:00
12500 -- (-374.460) [-382.359] (-385.143) (-374.977) * (-372.992) (-373.942) (-383.612) [-379.922] -- 0:01:19
13000 -- (-375.380) [-384.706] (-379.320) (-374.137) * (-372.538) (-372.652) [-380.311] (-386.673) -- 0:01:15
13500 -- (-375.617) (-381.441) [-382.819] (-373.897) * (-373.772) (-373.110) (-386.994) [-379.376] -- 0:01:13
14000 -- (-373.995) (-386.359) [-382.881] (-372.426) * [-371.966] (-377.317) (-384.063) (-383.660) -- 0:01:10
14500 -- (-375.100) (-383.183) [-386.494] (-372.069) * (-372.419) [-371.490] (-385.974) (-394.621) -- 0:01:07
15000 -- (-372.105) (-378.137) [-384.353] (-372.719) * (-376.466) (-372.828) [-390.215] (-383.145) -- 0:01:05
Average standard deviation of split frequencies: 0.066291
15500 -- (-373.100) (-389.933) [-383.630] (-373.246) * (-372.041) [-373.114] (-382.581) (-383.734) -- 0:01:03
16000 -- (-373.184) (-374.925) (-380.749) [-372.461] * (-372.820) [-374.507] (-388.401) (-384.786) -- 0:01:01
16500 -- (-373.329) (-374.665) [-380.967] (-373.253) * (-373.426) (-374.290) (-388.613) [-383.304] -- 0:00:59
17000 -- (-373.256) (-374.640) [-382.875] (-373.056) * (-372.629) (-373.676) (-379.056) [-386.232] -- 0:00:57
17500 -- (-372.649) (-374.792) (-396.360) [-374.307] * (-373.267) [-373.635] (-389.360) (-380.287) -- 0:00:56
18000 -- (-373.445) (-375.291) [-387.885] (-380.194) * (-375.617) (-373.000) [-398.191] (-381.747) -- 0:00:54
18500 -- [-374.232] (-376.068) (-380.224) (-372.050) * [-373.405] (-374.468) (-378.729) (-387.853) -- 0:00:53
19000 -- (-375.329) (-375.782) (-386.942) [-375.943] * (-373.667) (-375.158) (-387.028) [-380.498] -- 0:00:51
19500 -- (-373.219) (-378.926) [-378.049] (-373.482) * (-371.904) [-375.213] (-383.986) (-382.823) -- 0:00:50
20000 -- [-372.825] (-372.650) (-383.975) (-372.138) * (-375.079) (-373.548) (-375.797) [-379.067] -- 0:00:49
Average standard deviation of split frequencies: 0.053603
20500 -- [-373.336] (-373.667) (-385.625) (-372.837) * [-371.963] (-373.258) (-383.559) (-387.423) -- 0:00:47
21000 -- [-371.992] (-374.388) (-384.090) (-371.742) * (-374.803) (-372.725) (-381.017) [-384.319] -- 0:00:46
21500 -- (-372.749) [-371.850] (-386.568) (-373.597) * (-373.185) (-373.035) (-381.011) [-379.654] -- 0:00:45
22000 -- (-373.795) (-371.612) (-389.770) [-374.049] * [-371.696] (-375.801) (-381.677) (-384.220) -- 0:00:44
22500 -- (-372.131) (-371.987) [-381.703] (-371.732) * (-377.522) [-373.782] (-380.257) (-395.381) -- 0:00:43
23000 -- (-372.992) (-374.852) (-381.194) [-372.700] * (-377.138) (-375.433) (-398.041) [-382.006] -- 0:00:42
23500 -- [-373.491] (-373.472) (-381.602) (-371.320) * (-373.958) (-373.958) (-397.555) [-381.698] -- 0:00:41
24000 -- (-373.595) (-372.623) (-389.663) [-372.828] * [-373.993] (-373.693) (-388.150) (-381.490) -- 0:00:40
24500 -- [-373.163] (-373.806) (-380.707) (-371.930) * (-376.112) (-373.682) (-387.465) [-385.288] -- 0:00:39
25000 -- (-375.413) [-374.411] (-385.837) (-375.504) * (-374.326) [-374.396] (-372.755) (-378.594) -- 0:00:39
Average standard deviation of split frequencies: 0.051803
25500 -- (-375.337) (-374.860) (-375.133) [-378.014] * (-372.783) (-374.571) [-371.914] (-383.514) -- 0:00:38
26000 -- (-373.023) [-374.824] (-375.519) (-377.229) * (-373.704) (-374.593) (-374.838) [-379.217] -- 0:00:37
26500 -- (-372.257) (-377.053) (-377.569) [-374.193] * [-371.342] (-373.328) (-373.520) (-390.616) -- 0:00:36
27000 -- (-372.388) (-377.775) (-382.018) [-373.437] * [-374.288] (-376.147) (-376.192) (-380.252) -- 0:00:36
27500 -- (-374.800) (-373.769) [-379.249] (-374.960) * (-371.392) (-373.702) (-373.926) [-384.439] -- 0:00:35
28000 -- (-372.870) [-373.047] (-383.990) (-374.179) * (-374.993) (-372.549) (-373.724) [-377.327] -- 0:00:34
28500 -- [-372.552] (-372.885) (-379.559) (-379.181) * (-374.413) (-372.119) [-372.668] (-384.312) -- 0:00:34
29000 -- [-373.975] (-372.236) (-387.875) (-378.301) * [-371.732] (-374.362) (-373.521) (-379.904) -- 0:00:33
29500 -- (-375.917) (-372.582) [-377.086] (-378.116) * (-372.204) [-372.818] (-376.202) (-387.066) -- 0:01:05
30000 -- [-374.753] (-372.059) (-385.879) (-372.287) * [-374.962] (-372.272) (-373.391) (-388.336) -- 0:01:04
Average standard deviation of split frequencies: 0.052704
30500 -- (-376.284) (-375.894) (-386.544) [-372.828] * (-372.138) (-372.053) (-372.368) [-389.991] -- 0:01:03
31000 -- (-374.636) (-375.752) [-385.687] (-374.046) * (-372.049) [-373.831] (-373.251) (-383.817) -- 0:01:02
31500 -- (-372.274) (-373.716) [-394.537] (-373.543) * (-372.605) (-373.820) [-371.684] (-387.080) -- 0:01:01
32000 -- (-372.195) [-377.703] (-389.430) (-373.129) * (-374.007) [-372.001] (-375.698) (-377.711) -- 0:01:00
32500 -- [-373.311] (-375.169) (-389.288) (-374.066) * [-373.045] (-371.918) (-377.249) (-386.459) -- 0:00:59
33000 -- (-377.902) (-375.206) (-385.395) [-372.499] * [-372.353] (-374.278) (-372.260) (-379.667) -- 0:00:58
33500 -- (-372.585) (-373.900) [-373.293] (-373.113) * (-373.646) (-373.864) (-375.032) [-384.764] -- 0:00:57
34000 -- (-372.830) (-376.175) [-372.613] (-372.877) * (-374.616) (-373.791) (-374.823) [-378.639] -- 0:00:56
34500 -- [-372.317] (-377.647) (-377.813) (-372.255) * (-373.931) (-375.386) (-378.525) [-391.218] -- 0:00:55
35000 -- (-374.391) (-373.076) [-371.475] (-377.441) * (-376.410) [-372.700] (-373.185) (-391.186) -- 0:00:55
Average standard deviation of split frequencies: 0.043450
35500 -- (-374.059) [-377.860] (-372.990) (-372.026) * [-372.269] (-374.062) (-372.960) (-385.916) -- 0:00:54
36000 -- (-375.217) (-375.345) (-373.902) [-373.628] * (-373.022) [-373.328] (-373.573) (-377.685) -- 0:00:53
36500 -- (-378.742) (-377.233) [-374.565] (-374.415) * [-372.603] (-374.588) (-373.082) (-388.281) -- 0:00:52
37000 -- (-376.932) [-372.381] (-374.309) (-372.913) * (-377.513) (-374.845) [-372.751] (-381.494) -- 0:00:52
37500 -- (-375.932) (-374.185) (-374.314) [-372.703] * (-372.809) [-374.004] (-373.168) (-389.768) -- 0:00:51
38000 -- (-373.406) [-374.196] (-372.747) (-374.045) * (-374.212) (-371.295) [-374.580] (-390.453) -- 0:00:50
38500 -- (-373.540) (-373.521) (-373.889) [-373.356] * (-372.787) (-373.818) (-373.846) [-376.328] -- 0:00:49
39000 -- (-375.029) (-373.070) [-372.076] (-374.529) * (-371.861) (-377.270) (-375.800) [-383.234] -- 0:00:49
39500 -- (-375.754) [-373.090] (-373.940) (-374.014) * [-376.603] (-372.987) (-375.352) (-379.628) -- 0:00:48
40000 -- (-379.058) (-371.878) [-374.223] (-373.618) * (-372.750) [-373.753] (-377.706) (-382.544) -- 0:00:48
Average standard deviation of split frequencies: 0.045788
40500 -- [-373.477] (-374.512) (-373.434) (-374.880) * (-375.890) (-374.165) (-374.478) [-383.107] -- 0:00:47
41000 -- (-373.698) (-372.870) [-373.267] (-374.787) * (-372.111) (-372.070) [-373.415] (-384.346) -- 0:00:46
41500 -- (-374.445) (-375.465) (-375.307) [-375.168] * (-374.049) (-378.088) [-373.955] (-383.212) -- 0:00:46
42000 -- (-371.372) (-374.787) [-373.995] (-372.762) * (-372.630) (-376.041) [-373.435] (-387.251) -- 0:00:45
42500 -- (-371.993) (-373.299) (-373.532) [-371.545] * (-373.287) (-372.036) (-379.013) [-381.166] -- 0:00:45
43000 -- [-372.714] (-377.462) (-371.897) (-371.880) * (-373.410) (-372.508) (-377.918) [-387.199] -- 0:00:44
43500 -- (-372.283) [-372.497] (-372.740) (-372.246) * (-374.083) [-373.011] (-373.823) (-371.502) -- 0:00:43
44000 -- (-372.361) [-374.400] (-372.927) (-372.498) * (-377.280) (-374.482) (-373.543) [-371.481] -- 0:00:43
44500 -- (-372.608) [-372.570] (-372.404) (-373.090) * (-372.636) (-375.684) (-373.266) [-372.700] -- 0:00:42
45000 -- [-371.735] (-374.314) (-373.410) (-374.153) * (-372.702) (-371.693) (-378.850) [-375.451] -- 0:01:03
Average standard deviation of split frequencies: 0.042774
45500 -- (-371.981) (-372.165) [-373.691] (-373.143) * (-373.971) (-378.189) (-375.842) [-373.433] -- 0:01:02
46000 -- [-372.822] (-371.321) (-371.701) (-372.512) * (-375.048) (-377.969) (-371.438) [-372.696] -- 0:01:02
46500 -- (-376.422) (-371.866) [-374.041] (-371.871) * (-374.812) [-376.452] (-376.489) (-374.001) -- 0:01:01
47000 -- (-378.452) [-373.177] (-376.977) (-371.454) * (-372.072) [-374.021] (-378.618) (-376.277) -- 0:01:00
47500 -- (-375.658) [-375.117] (-374.219) (-374.459) * (-372.561) [-374.787] (-376.908) (-374.754) -- 0:01:00
48000 -- (-371.298) [-373.001] (-379.548) (-374.268) * (-375.051) (-372.762) (-373.436) [-374.486] -- 0:00:59
48500 -- (-373.202) (-373.623) (-373.053) [-372.244] * (-374.259) (-372.277) (-373.715) [-375.675] -- 0:00:58
49000 -- (-372.212) (-374.475) (-373.178) [-372.715] * [-372.421] (-374.478) (-372.083) (-372.029) -- 0:00:58
49500 -- (-375.251) (-376.999) (-373.876) [-373.602] * (-373.970) (-375.555) (-372.769) [-372.653] -- 0:00:57
50000 -- [-376.000] (-374.648) (-374.051) (-373.550) * (-376.075) [-372.434] (-372.491) (-377.620) -- 0:00:57
Average standard deviation of split frequencies: 0.037216
50500 -- (-375.222) (-373.626) (-375.178) [-372.996] * (-371.506) [-372.874] (-371.602) (-372.633) -- 0:00:56
51000 -- (-373.481) (-372.896) (-373.534) [-373.362] * (-374.261) [-371.989] (-373.644) (-376.063) -- 0:00:55
51500 -- (-373.041) (-373.760) [-373.776] (-374.381) * (-372.173) (-374.688) (-373.781) [-373.480] -- 0:00:55
52000 -- (-371.959) (-373.310) (-371.536) [-376.558] * (-373.752) [-375.091] (-372.299) (-372.941) -- 0:00:54
52500 -- (-373.034) (-375.066) (-371.965) [-377.331] * (-374.843) [-373.298] (-372.792) (-374.002) -- 0:00:54
53000 -- (-373.606) (-372.821) (-375.556) [-372.067] * (-374.812) (-374.472) (-372.672) [-372.022] -- 0:00:53
53500 -- (-377.700) (-373.040) [-373.410] (-372.984) * [-371.688] (-371.853) (-374.569) (-376.914) -- 0:00:53
54000 -- [-372.245] (-375.484) (-375.457) (-373.886) * (-372.318) (-375.796) [-373.756] (-374.255) -- 0:00:52
54500 -- (-374.444) (-374.462) (-374.271) [-375.468] * (-373.852) [-373.085] (-376.677) (-371.527) -- 0:00:52
55000 -- (-373.533) (-372.026) (-374.829) [-372.736] * (-373.786) (-374.963) [-373.707] (-372.296) -- 0:00:51
Average standard deviation of split frequencies: 0.032830
55500 -- (-373.506) [-371.970] (-374.604) (-373.993) * (-372.974) (-376.811) [-374.522] (-372.585) -- 0:00:51
56000 -- (-371.913) [-374.313] (-374.801) (-376.681) * (-372.939) (-375.779) [-375.940] (-377.264) -- 0:00:50
56500 -- (-374.269) (-373.101) [-373.609] (-373.756) * [-371.745] (-372.192) (-371.965) (-376.550) -- 0:00:50
57000 -- (-375.223) [-374.497] (-374.330) (-372.363) * (-373.091) [-373.709] (-372.163) (-374.332) -- 0:00:49
57500 -- (-373.584) (-374.900) (-372.585) [-373.985] * (-372.575) [-373.060] (-371.861) (-374.309) -- 0:00:49
58000 -- (-373.536) (-377.428) (-374.932) [-373.807] * [-374.901] (-374.073) (-374.477) (-375.893) -- 0:00:48
58500 -- (-374.315) (-376.098) [-373.303] (-376.985) * (-376.645) [-372.437] (-375.016) (-373.097) -- 0:00:48
59000 -- (-372.182) [-374.878] (-372.387) (-375.232) * (-373.046) (-373.089) (-372.798) [-372.476] -- 0:00:47
59500 -- [-372.761] (-371.811) (-374.489) (-372.265) * (-372.568) [-373.340] (-374.082) (-373.636) -- 0:00:47
60000 -- (-373.351) (-373.648) [-372.997] (-374.902) * (-373.217) (-372.426) [-373.561] (-371.743) -- 0:00:47
Average standard deviation of split frequencies: 0.028219
60500 -- (-372.017) (-373.430) [-376.370] (-373.029) * (-373.062) (-372.694) (-375.771) [-371.852] -- 0:01:02
61000 -- (-371.999) (-372.338) (-373.020) [-374.797] * (-375.596) (-374.968) [-373.630] (-373.392) -- 0:01:01
61500 -- (-373.316) (-373.665) [-375.627] (-372.237) * [-371.524] (-372.789) (-378.793) (-375.827) -- 0:01:01
62000 -- (-379.627) [-374.396] (-376.099) (-372.762) * (-375.051) (-371.355) (-374.434) [-372.448] -- 0:01:00
62500 -- (-375.485) [-374.529] (-374.518) (-372.434) * (-372.893) (-381.294) [-375.936] (-371.770) -- 0:01:00
63000 -- (-373.838) [-373.500] (-371.982) (-372.921) * (-382.332) (-374.288) (-373.291) [-372.644] -- 0:00:59
63500 -- (-371.886) [-374.187] (-374.044) (-374.905) * (-375.567) (-374.963) [-373.912] (-373.710) -- 0:00:58
64000 -- [-372.544] (-374.715) (-372.206) (-373.215) * (-372.553) [-374.213] (-374.284) (-374.700) -- 0:00:58
64500 -- (-374.337) (-374.083) (-372.646) [-374.420] * (-372.919) (-375.082) (-377.154) [-374.835] -- 0:00:58
65000 -- (-379.054) [-374.805] (-373.124) (-372.144) * [-373.344] (-373.046) (-372.292) (-376.618) -- 0:00:57
Average standard deviation of split frequencies: 0.025154
65500 -- (-374.011) (-373.079) (-371.583) [-373.582] * (-373.822) (-372.135) [-372.475] (-375.656) -- 0:00:57
66000 -- (-373.635) (-374.138) [-372.306] (-374.395) * (-376.483) (-371.583) [-372.872] (-373.349) -- 0:00:56
66500 -- (-376.018) [-373.718] (-372.408) (-371.268) * (-373.974) (-373.948) (-375.053) [-377.216] -- 0:00:56
67000 -- (-375.104) [-372.102] (-371.721) (-372.282) * (-372.321) (-372.283) [-372.528] (-379.986) -- 0:00:55
67500 -- (-374.939) (-373.935) (-372.086) [-372.363] * (-372.564) [-373.508] (-373.209) (-374.199) -- 0:00:55
68000 -- (-371.737) (-377.973) [-372.485] (-372.953) * [-372.414] (-372.976) (-376.202) (-376.909) -- 0:00:54
68500 -- (-372.798) (-374.816) [-373.658] (-373.371) * (-377.667) (-373.827) [-373.001] (-372.983) -- 0:00:54
69000 -- (-374.006) (-374.947) (-373.356) [-372.037] * [-372.959] (-373.890) (-371.654) (-373.813) -- 0:00:53
69500 -- [-374.512] (-372.135) (-376.870) (-372.339) * (-372.404) (-372.552) [-374.745] (-372.850) -- 0:00:53
70000 -- [-373.302] (-372.197) (-373.235) (-379.101) * (-374.236) [-372.790] (-376.452) (-382.347) -- 0:00:53
Average standard deviation of split frequencies: 0.025294
70500 -- [-374.258] (-375.394) (-374.028) (-374.351) * (-371.485) (-373.905) [-372.979] (-388.541) -- 0:00:52
71000 -- (-375.034) (-373.369) (-375.124) [-375.071] * (-378.504) [-373.748] (-372.152) (-374.548) -- 0:00:52
71500 -- (-373.604) (-373.195) [-377.784] (-374.056) * (-371.984) (-373.255) [-371.222] (-375.160) -- 0:00:51
72000 -- [-374.415] (-377.087) (-373.589) (-373.962) * (-373.576) (-372.567) [-371.794] (-372.046) -- 0:00:51
72500 -- [-374.787] (-376.600) (-372.783) (-372.062) * (-372.241) (-373.172) (-373.752) [-372.894] -- 0:00:51
73000 -- [-377.354] (-373.747) (-372.332) (-372.932) * (-371.722) (-372.088) (-375.273) [-374.137] -- 0:00:50
73500 -- (-374.833) [-371.901] (-377.103) (-372.474) * (-374.144) (-373.258) [-374.786] (-374.472) -- 0:00:50
74000 -- (-376.786) [-374.769] (-373.530) (-374.635) * (-373.136) (-374.305) [-374.885] (-374.595) -- 0:00:50
74500 -- (-373.569) (-372.883) [-372.465] (-374.943) * (-376.979) (-373.142) (-372.626) [-375.706] -- 0:00:49
75000 -- (-372.824) (-373.918) (-375.706) [-374.589] * (-376.682) (-373.718) [-373.035] (-375.821) -- 0:00:49
Average standard deviation of split frequencies: 0.023570
75500 -- (-373.990) (-379.687) (-377.381) [-379.368] * [-373.946] (-372.782) (-373.369) (-379.894) -- 0:00:48
76000 -- (-372.842) [-372.828] (-372.684) (-373.592) * [-374.555] (-374.570) (-372.548) (-373.074) -- 0:00:48
76500 -- (-376.159) (-375.929) (-372.427) [-371.752] * (-372.478) (-373.096) [-374.415] (-374.196) -- 0:00:48
77000 -- (-372.863) [-372.749] (-373.057) (-376.598) * (-371.618) [-372.231] (-375.041) (-373.202) -- 0:00:47
77500 -- (-372.118) (-373.826) [-372.838] (-376.490) * (-372.539) [-371.868] (-375.210) (-373.109) -- 0:00:59
78000 -- (-371.639) [-374.396] (-371.781) (-373.014) * (-372.787) (-373.745) (-374.220) [-373.377] -- 0:00:59
78500 -- (-377.201) (-373.659) [-371.567] (-374.358) * (-373.088) [-372.366] (-376.820) (-373.498) -- 0:00:58
79000 -- (-371.589) [-372.122] (-380.951) (-375.894) * [-377.662] (-373.457) (-375.993) (-377.011) -- 0:00:58
79500 -- [-375.872] (-374.787) (-372.813) (-376.093) * [-372.772] (-372.776) (-374.089) (-371.864) -- 0:00:57
80000 -- (-373.753) (-372.661) (-371.899) [-373.419] * (-374.974) [-371.626] (-373.954) (-372.939) -- 0:00:57
Average standard deviation of split frequencies: 0.024767
80500 -- (-371.975) (-375.337) (-372.437) [-372.629] * [-375.544] (-374.499) (-374.592) (-372.676) -- 0:00:57
81000 -- (-371.299) [-376.651] (-372.683) (-374.025) * (-374.660) [-374.034] (-375.949) (-372.937) -- 0:00:56
81500 -- (-374.004) (-375.637) (-375.394) [-372.271] * (-372.534) [-371.302] (-378.216) (-373.135) -- 0:00:56
82000 -- [-372.657] (-375.624) (-374.522) (-372.355) * (-373.121) (-371.701) [-375.185] (-372.505) -- 0:00:55
82500 -- [-373.403] (-372.994) (-377.265) (-373.164) * (-372.841) [-372.396] (-372.900) (-373.209) -- 0:00:55
83000 -- (-372.122) [-376.823] (-374.314) (-377.705) * (-374.624) [-372.761] (-373.456) (-372.472) -- 0:00:55
83500 -- (-372.308) [-371.841] (-373.715) (-374.733) * [-374.683] (-371.523) (-377.113) (-372.159) -- 0:00:54
84000 -- (-373.851) (-371.797) (-373.491) [-371.559] * [-373.959] (-372.252) (-375.081) (-372.159) -- 0:00:54
84500 -- (-374.083) (-378.307) (-374.691) [-374.995] * (-373.706) (-371.911) [-377.768] (-373.286) -- 0:00:54
85000 -- (-372.864) [-372.866] (-374.681) (-373.523) * (-373.207) (-372.185) (-374.702) [-374.660] -- 0:00:53
Average standard deviation of split frequencies: 0.027407
85500 -- (-373.490) (-372.524) [-375.129] (-374.018) * (-373.417) (-373.410) [-371.740] (-377.791) -- 0:00:53
86000 -- [-372.926] (-372.353) (-372.315) (-374.214) * (-372.551) (-375.732) (-371.625) [-375.442] -- 0:00:53
86500 -- (-374.192) (-375.313) [-371.202] (-377.508) * (-374.265) [-376.901] (-372.289) (-377.500) -- 0:00:52
87000 -- (-373.499) (-376.218) [-371.398] (-374.107) * [-371.988] (-377.979) (-371.651) (-372.689) -- 0:00:52
87500 -- (-374.911) (-372.448) (-371.751) [-374.817] * (-373.128) (-373.879) (-372.404) [-373.443] -- 0:00:52
88000 -- (-374.310) [-374.200] (-373.306) (-374.995) * (-371.852) [-375.506] (-373.588) (-374.012) -- 0:00:51
88500 -- [-372.737] (-372.364) (-371.938) (-372.784) * (-371.404) (-374.825) [-373.610] (-377.847) -- 0:00:51
89000 -- [-375.554] (-371.886) (-374.466) (-375.456) * [-372.021] (-375.145) (-371.690) (-372.429) -- 0:00:51
89500 -- (-374.112) (-377.308) (-373.751) [-373.233] * (-371.841) (-371.922) [-372.022] (-374.311) -- 0:00:50
90000 -- (-377.948) (-377.633) (-371.488) [-376.694] * (-372.517) (-374.570) (-373.126) [-374.070] -- 0:00:50
Average standard deviation of split frequencies: 0.025760
90500 -- [-374.273] (-375.058) (-373.585) (-372.807) * (-372.524) (-374.512) [-375.181] (-373.164) -- 0:00:50
91000 -- (-373.379) [-373.819] (-374.331) (-371.929) * (-380.070) [-374.229] (-374.893) (-374.461) -- 0:00:49
91500 -- [-374.170] (-374.503) (-373.623) (-373.221) * (-376.340) (-374.053) [-375.565] (-372.233) -- 0:00:49
92000 -- (-372.400) (-373.111) [-374.989] (-374.727) * (-372.707) [-373.349] (-372.515) (-372.445) -- 0:00:49
92500 -- (-373.245) [-375.109] (-373.729) (-374.718) * (-373.113) (-372.042) (-373.229) [-375.090] -- 0:00:49
93000 -- [-376.218] (-374.420) (-373.972) (-375.671) * (-375.736) (-373.002) (-372.261) [-371.544] -- 0:00:48
93500 -- (-374.359) (-373.946) (-375.755) [-373.761] * (-376.963) (-376.693) (-374.330) [-373.677] -- 0:00:48
94000 -- [-372.274] (-373.750) (-376.464) (-373.297) * [-376.293] (-378.685) (-374.363) (-376.049) -- 0:00:48
94500 -- [-373.416] (-374.338) (-373.362) (-374.640) * (-373.964) (-375.273) (-374.930) [-373.738] -- 0:00:57
95000 -- [-373.027] (-375.737) (-374.758) (-377.545) * (-375.689) (-376.449) (-371.690) [-373.695] -- 0:00:57
Average standard deviation of split frequencies: 0.028527
95500 -- (-376.802) [-375.713] (-376.075) (-372.624) * [-374.561] (-373.923) (-372.521) (-376.867) -- 0:00:56
96000 -- (-373.612) [-372.055] (-376.379) (-372.221) * (-377.178) (-372.008) (-375.976) [-372.977] -- 0:00:56
96500 -- [-372.011] (-373.523) (-373.299) (-373.281) * (-372.291) [-372.982] (-374.590) (-375.260) -- 0:00:56
97000 -- (-373.944) [-375.268] (-372.136) (-372.711) * (-373.318) (-373.781) [-373.094] (-379.314) -- 0:00:55
97500 -- (-373.503) (-375.188) [-372.471] (-371.999) * [-371.917] (-376.486) (-375.648) (-372.109) -- 0:00:55
98000 -- [-374.208] (-373.899) (-373.976) (-373.799) * [-372.373] (-372.296) (-371.698) (-374.291) -- 0:00:55
98500 -- (-374.979) [-373.290] (-375.344) (-379.269) * (-371.598) (-373.790) [-373.997] (-372.789) -- 0:00:54
99000 -- (-379.057) (-375.157) [-374.677] (-375.093) * (-372.745) (-372.610) (-373.839) [-373.751] -- 0:00:54
99500 -- (-374.135) (-374.130) [-381.075] (-372.653) * (-373.614) (-372.328) (-375.166) [-372.125] -- 0:00:54
100000 -- (-376.188) (-372.946) [-381.294] (-373.179) * (-373.254) (-373.798) [-371.920] (-373.251) -- 0:00:54
Average standard deviation of split frequencies: 0.030226
100500 -- (-378.788) (-374.389) (-377.210) [-375.393] * (-374.814) (-371.923) [-372.026] (-371.691) -- 0:00:53
101000 -- (-375.170) (-373.417) [-372.601] (-374.343) * (-375.103) (-373.173) (-372.388) [-378.085] -- 0:00:53
101500 -- [-372.890] (-371.186) (-374.481) (-373.104) * [-374.519] (-372.122) (-373.500) (-372.621) -- 0:00:53
102000 -- (-375.333) [-373.055] (-372.790) (-377.908) * (-373.842) (-373.762) [-371.470] (-372.396) -- 0:00:52
102500 -- (-376.122) [-372.481] (-372.867) (-374.328) * (-371.692) [-377.260] (-372.981) (-374.518) -- 0:00:52
103000 -- (-375.731) (-376.403) (-372.269) [-375.249] * (-373.263) (-373.611) (-374.847) [-372.213] -- 0:00:52
103500 -- (-372.127) [-374.079] (-373.328) (-374.316) * (-372.175) [-375.334] (-373.858) (-372.035) -- 0:00:51
104000 -- [-371.475] (-373.186) (-373.354) (-376.599) * (-374.224) (-372.327) (-373.539) [-375.158] -- 0:00:51
104500 -- (-371.708) (-373.615) [-372.984] (-373.932) * (-374.933) (-372.765) [-373.856] (-373.279) -- 0:00:51
105000 -- [-372.559] (-374.110) (-374.824) (-372.527) * (-372.793) (-372.495) [-372.142] (-378.251) -- 0:00:51
Average standard deviation of split frequencies: 0.030524
105500 -- (-376.638) [-373.256] (-375.248) (-372.333) * (-374.174) [-374.805] (-379.842) (-371.829) -- 0:00:50
106000 -- (-378.459) (-373.131) (-374.953) [-372.452] * (-374.006) (-374.732) (-373.172) [-373.465] -- 0:00:50
106500 -- (-373.915) (-372.454) [-371.443] (-375.461) * (-377.227) [-371.938] (-374.201) (-371.843) -- 0:00:50
107000 -- (-373.158) [-375.326] (-375.137) (-373.075) * (-372.244) [-372.807] (-375.463) (-375.019) -- 0:00:50
107500 -- [-372.026] (-374.692) (-375.744) (-373.354) * (-373.918) (-374.444) (-373.469) [-374.328] -- 0:00:49
108000 -- (-373.642) [-372.729] (-373.327) (-372.992) * (-374.116) (-377.110) (-371.711) [-376.394] -- 0:00:49
108500 -- (-374.228) [-372.470] (-372.485) (-375.375) * [-372.190] (-373.548) (-374.288) (-376.005) -- 0:00:49
109000 -- (-373.353) [-372.168] (-376.154) (-372.873) * (-372.649) [-374.726] (-374.555) (-372.732) -- 0:00:49
109500 -- (-373.103) (-374.423) [-373.796] (-373.870) * (-374.558) (-374.147) (-373.550) [-373.849] -- 0:00:48
110000 -- (-373.035) (-373.732) [-373.019] (-372.866) * (-374.108) (-374.441) (-374.751) [-372.579] -- 0:00:48
Average standard deviation of split frequencies: 0.026572
110500 -- [-371.903] (-372.183) (-372.443) (-372.625) * (-373.382) [-373.262] (-372.629) (-373.871) -- 0:00:48
111000 -- (-372.027) [-375.111] (-375.286) (-374.303) * (-372.795) [-372.680] (-374.704) (-379.012) -- 0:00:56
111500 -- (-372.551) [-374.778] (-372.240) (-371.857) * (-374.582) [-372.626] (-374.413) (-376.323) -- 0:00:55
112000 -- [-372.494] (-375.221) (-372.835) (-371.608) * (-373.031) (-374.552) (-372.414) [-381.033] -- 0:00:55
112500 -- [-372.999] (-374.222) (-373.809) (-373.086) * [-374.745] (-374.328) (-372.966) (-376.316) -- 0:00:55
113000 -- (-374.158) (-372.682) [-372.090] (-374.209) * (-372.965) (-372.302) (-371.540) [-376.136] -- 0:00:54
113500 -- [-371.448] (-373.487) (-373.310) (-373.147) * (-375.393) (-371.751) (-372.685) [-373.422] -- 0:00:54
114000 -- [-371.908] (-375.115) (-372.985) (-377.282) * [-375.633] (-373.676) (-373.757) (-372.152) -- 0:00:54
114500 -- (-375.997) (-374.379) (-373.131) [-377.315] * (-373.386) (-373.360) (-372.317) [-375.992] -- 0:00:54
115000 -- (-371.405) (-380.555) (-374.431) [-372.214] * [-372.542] (-371.619) (-372.518) (-373.546) -- 0:00:53
Average standard deviation of split frequencies: 0.026512
115500 -- [-373.242] (-378.545) (-371.596) (-373.513) * (-373.053) (-374.663) (-374.155) [-372.385] -- 0:00:53
116000 -- (-371.998) (-379.874) [-371.850] (-372.448) * (-373.626) (-376.223) [-373.268] (-371.688) -- 0:00:53
116500 -- [-377.715] (-373.062) (-371.898) (-373.481) * (-371.923) [-372.625] (-373.391) (-373.098) -- 0:00:53
117000 -- (-381.887) [-373.082] (-376.633) (-374.234) * [-372.321] (-373.772) (-374.267) (-373.863) -- 0:00:52
117500 -- (-373.794) [-372.413] (-374.140) (-371.608) * [-374.373] (-372.869) (-375.028) (-371.418) -- 0:00:52
118000 -- (-373.549) [-371.869] (-372.323) (-372.777) * (-376.897) (-373.314) [-372.551] (-371.940) -- 0:00:52
118500 -- [-372.294] (-373.621) (-374.891) (-376.896) * [-371.738] (-374.948) (-372.563) (-372.189) -- 0:00:52
119000 -- (-372.468) (-373.709) [-373.515] (-375.219) * (-372.468) (-375.672) (-372.785) [-373.999] -- 0:00:51
119500 -- (-375.494) (-373.626) (-374.246) [-375.512] * [-374.726] (-373.437) (-372.891) (-373.510) -- 0:00:51
120000 -- (-372.632) (-373.330) (-374.618) [-373.464] * (-372.976) [-372.131] (-375.559) (-375.001) -- 0:00:51
Average standard deviation of split frequencies: 0.028323
120500 -- (-374.072) (-372.094) [-377.410] (-372.742) * (-373.922) [-372.303] (-373.508) (-372.736) -- 0:00:51
121000 -- (-374.207) [-371.689] (-373.531) (-374.207) * (-374.269) (-374.162) (-372.904) [-373.410] -- 0:00:50
121500 -- (-372.553) (-374.638) [-374.079] (-373.981) * (-373.526) [-372.449] (-374.252) (-379.772) -- 0:00:50
122000 -- (-374.004) (-373.084) (-376.304) [-371.713] * (-371.759) [-371.985] (-373.501) (-374.587) -- 0:00:50
122500 -- (-372.431) (-372.314) (-371.531) [-376.178] * (-378.972) (-372.157) (-372.923) [-374.781] -- 0:00:50
123000 -- (-375.024) [-371.947] (-373.800) (-373.484) * [-372.295] (-372.384) (-373.299) (-372.248) -- 0:00:49
123500 -- (-372.435) (-372.068) [-374.534] (-372.986) * [-378.058] (-371.839) (-373.717) (-377.526) -- 0:00:49
124000 -- (-371.941) (-372.594) (-373.379) [-372.240] * (-373.497) (-374.064) [-373.452] (-373.297) -- 0:00:49
124500 -- (-377.031) (-371.776) (-376.614) [-371.956] * (-376.149) [-374.058] (-377.044) (-372.806) -- 0:00:49
125000 -- (-372.977) [-371.914] (-373.452) (-373.842) * (-374.355) (-372.557) [-373.925] (-374.406) -- 0:00:49
Average standard deviation of split frequencies: 0.024764
125500 -- [-373.674] (-371.698) (-376.296) (-376.068) * [-374.917] (-376.297) (-373.475) (-374.983) -- 0:00:48
126000 -- (-375.622) (-374.205) (-374.916) [-374.425] * (-375.440) (-371.894) (-373.602) [-373.377] -- 0:00:48
126500 -- (-374.243) (-372.898) (-374.342) [-373.674] * [-373.685] (-379.391) (-372.938) (-373.187) -- 0:00:48
127000 -- (-372.073) (-373.627) (-378.329) [-377.191] * (-373.216) [-372.496] (-372.643) (-371.463) -- 0:00:48
127500 -- (-377.952) (-372.874) [-376.764] (-373.529) * [-371.745] (-372.646) (-372.190) (-372.970) -- 0:00:47
128000 -- (-377.365) (-372.499) (-376.939) [-374.696] * (-372.269) (-375.252) (-373.703) [-373.691] -- 0:00:54
128500 -- (-374.983) (-374.463) (-371.748) [-374.229] * (-372.481) [-373.110] (-373.928) (-372.630) -- 0:00:54
129000 -- [-373.598] (-374.328) (-373.500) (-372.067) * (-372.659) (-373.892) (-374.849) [-374.217] -- 0:00:54
129500 -- [-376.963] (-374.112) (-372.893) (-372.863) * (-371.500) (-374.621) (-374.614) [-373.724] -- 0:00:53
130000 -- [-372.968] (-374.560) (-372.485) (-373.569) * (-376.696) [-376.896] (-374.296) (-373.429) -- 0:00:53
Average standard deviation of split frequencies: 0.023020
130500 -- (-372.823) (-375.173) (-373.380) [-372.286] * (-376.950) [-379.392] (-373.667) (-374.063) -- 0:00:53
131000 -- (-372.612) (-373.394) [-374.838] (-372.303) * (-374.448) (-373.083) (-377.499) [-372.184] -- 0:00:53
131500 -- [-374.095] (-374.860) (-373.522) (-371.458) * (-371.749) (-372.353) (-376.041) [-373.636] -- 0:00:52
132000 -- (-376.131) [-373.438] (-371.902) (-373.607) * (-371.489) (-371.662) (-375.691) [-373.669] -- 0:00:52
132500 -- (-374.661) (-373.527) [-377.924] (-375.367) * [-375.133] (-373.112) (-375.165) (-372.803) -- 0:00:52
133000 -- (-374.985) (-372.574) [-374.993] (-373.679) * (-372.452) (-373.303) (-376.385) [-373.985] -- 0:00:52
133500 -- (-375.603) [-376.692] (-372.369) (-371.371) * (-373.141) (-372.195) (-372.688) [-374.781] -- 0:00:51
134000 -- (-376.536) (-371.790) [-376.219] (-374.388) * (-373.338) (-377.360) (-373.820) [-373.499] -- 0:00:51
134500 -- (-373.726) [-372.654] (-374.365) (-371.741) * [-371.579] (-374.788) (-373.260) (-375.096) -- 0:00:51
135000 -- (-375.391) (-373.836) (-376.670) [-372.283] * (-374.475) [-375.318] (-372.618) (-374.182) -- 0:00:51
Average standard deviation of split frequencies: 0.023273
135500 -- (-373.912) (-371.935) (-373.391) [-371.841] * [-372.426] (-378.691) (-372.928) (-371.277) -- 0:00:51
136000 -- (-373.402) (-373.872) [-373.160] (-374.410) * (-371.975) (-374.045) [-373.282] (-372.713) -- 0:00:50
136500 -- (-378.497) [-372.713] (-372.496) (-374.739) * (-373.432) [-371.960] (-374.156) (-373.207) -- 0:00:50
137000 -- (-381.010) (-374.301) [-372.101] (-375.775) * (-375.017) [-374.591] (-372.237) (-373.235) -- 0:00:50
137500 -- (-377.136) (-375.403) (-374.882) [-372.220] * [-372.458] (-372.439) (-375.929) (-373.149) -- 0:00:50
138000 -- [-376.542] (-371.937) (-373.943) (-372.141) * [-371.639] (-372.409) (-372.396) (-376.074) -- 0:00:49
138500 -- (-373.965) (-376.019) (-373.142) [-373.588] * (-372.554) [-374.520] (-376.042) (-373.170) -- 0:00:49
139000 -- (-375.840) (-373.458) (-373.738) [-373.155] * [-375.417] (-375.958) (-375.487) (-372.651) -- 0:00:49
139500 -- [-371.725] (-372.099) (-374.247) (-373.501) * (-371.544) (-372.540) [-375.394] (-373.378) -- 0:00:49
140000 -- (-373.280) (-373.771) (-373.287) [-373.001] * [-374.136] (-374.644) (-379.083) (-374.832) -- 0:00:49
Average standard deviation of split frequencies: 0.022956
140500 -- (-375.584) (-374.824) (-371.297) [-374.651] * (-378.553) [-374.236] (-375.079) (-373.277) -- 0:00:48
141000 -- (-373.280) (-372.167) (-372.200) [-374.907] * (-374.624) [-372.975] (-375.169) (-375.369) -- 0:00:48
141500 -- (-374.606) [-371.601] (-371.805) (-373.083) * (-371.388) (-374.306) [-372.945] (-375.031) -- 0:00:48
142000 -- (-380.717) (-375.315) [-373.331] (-372.946) * [-373.636] (-373.983) (-374.342) (-373.375) -- 0:00:48
142500 -- (-377.710) (-373.398) [-375.844] (-373.210) * [-374.906] (-373.464) (-373.378) (-376.317) -- 0:00:48
143000 -- (-374.374) [-373.241] (-374.808) (-373.557) * [-372.310] (-376.780) (-377.039) (-375.364) -- 0:00:47
143500 -- (-376.213) [-376.140] (-377.600) (-372.591) * (-375.461) (-374.866) [-373.174] (-374.517) -- 0:00:47
144000 -- [-373.218] (-377.580) (-375.859) (-372.436) * (-376.116) [-375.185] (-374.627) (-372.530) -- 0:00:47
144500 -- [-375.223] (-373.026) (-371.902) (-377.147) * [-372.578] (-373.014) (-375.397) (-372.633) -- 0:00:47
145000 -- (-371.765) [-374.115] (-372.083) (-372.465) * (-373.319) [-372.604] (-374.832) (-373.671) -- 0:00:53
Average standard deviation of split frequencies: 0.024539
145500 -- [-373.312] (-374.480) (-372.659) (-372.495) * (-376.472) [-377.241] (-373.050) (-374.105) -- 0:00:52
146000 -- (-376.546) (-371.492) (-373.356) [-373.235] * (-376.283) (-373.271) [-371.534] (-373.428) -- 0:00:52
146500 -- (-374.307) (-373.728) [-371.915] (-374.812) * (-372.319) [-372.636] (-374.943) (-372.980) -- 0:00:52
147000 -- [-374.453] (-373.850) (-373.816) (-372.492) * [-374.175] (-374.044) (-373.682) (-372.318) -- 0:00:52
147500 -- [-373.209] (-376.070) (-373.060) (-371.784) * [-373.713] (-373.690) (-373.577) (-378.085) -- 0:00:52
148000 -- (-373.351) [-373.864] (-372.423) (-373.966) * (-373.445) [-371.954] (-375.098) (-372.460) -- 0:00:51
148500 -- (-372.681) [-372.903] (-372.756) (-375.921) * (-373.527) [-371.919] (-373.614) (-377.073) -- 0:00:51
149000 -- (-372.477) (-371.920) [-373.841] (-374.098) * (-373.522) (-373.923) [-373.975] (-374.429) -- 0:00:51
149500 -- [-372.434] (-372.663) (-375.092) (-373.802) * (-374.537) [-371.899] (-375.475) (-375.881) -- 0:00:51
150000 -- (-373.953) (-373.795) [-374.978] (-375.147) * [-371.885] (-374.568) (-377.514) (-372.868) -- 0:00:51
Average standard deviation of split frequencies: 0.023054
150500 -- [-372.135] (-372.313) (-375.521) (-371.958) * (-374.128) (-373.685) [-374.961] (-373.027) -- 0:00:50
151000 -- (-372.020) (-374.846) (-373.096) [-373.480] * (-373.474) [-373.136] (-372.288) (-374.663) -- 0:00:50
151500 -- (-372.294) (-372.601) (-372.855) [-374.093] * [-372.879] (-371.610) (-373.830) (-373.216) -- 0:00:50
152000 -- [-372.613] (-371.706) (-376.586) (-374.086) * (-374.417) (-371.953) [-377.213] (-377.318) -- 0:00:50
152500 -- [-372.643] (-376.356) (-373.336) (-373.945) * (-373.406) (-371.552) [-372.881] (-377.165) -- 0:00:50
153000 -- (-373.827) (-376.281) [-374.566] (-372.211) * (-374.124) [-376.261] (-375.164) (-372.552) -- 0:00:49
153500 -- [-372.378] (-371.538) (-374.373) (-372.830) * [-371.872] (-376.269) (-374.267) (-380.881) -- 0:00:49
154000 -- (-371.975) (-372.207) (-376.632) [-372.675] * (-373.330) (-374.071) [-372.564] (-373.246) -- 0:00:49
154500 -- [-373.441] (-372.922) (-372.153) (-371.944) * (-372.071) (-375.893) (-373.768) [-372.545] -- 0:00:49
155000 -- (-372.818) (-372.092) (-372.498) [-372.740] * [-376.444] (-378.224) (-371.768) (-371.662) -- 0:00:49
Average standard deviation of split frequencies: 0.022930
155500 -- [-372.888] (-378.657) (-372.263) (-375.513) * [-371.513] (-373.417) (-372.612) (-373.286) -- 0:00:48
156000 -- [-372.013] (-375.400) (-373.690) (-371.470) * [-372.167] (-374.073) (-373.761) (-375.084) -- 0:00:48
156500 -- [-382.481] (-373.428) (-372.245) (-374.709) * (-372.374) (-373.962) [-372.132] (-381.307) -- 0:00:48
157000 -- (-375.126) (-373.663) (-379.363) [-371.944] * (-374.248) [-376.241] (-375.888) (-375.011) -- 0:00:48
157500 -- (-376.222) (-372.640) (-373.773) [-373.496] * (-372.810) [-372.798] (-371.734) (-373.895) -- 0:00:48
158000 -- (-374.346) (-372.371) [-372.736] (-372.351) * (-373.025) (-373.935) (-373.903) [-374.478] -- 0:00:47
158500 -- (-374.987) (-371.615) [-373.139] (-376.088) * [-372.894] (-373.496) (-374.173) (-380.587) -- 0:00:47
159000 -- (-372.462) [-376.801] (-373.356) (-371.579) * (-373.865) (-376.135) [-373.681] (-378.462) -- 0:00:47
159500 -- [-372.398] (-373.554) (-375.590) (-374.119) * (-374.238) (-372.141) [-375.459] (-372.383) -- 0:00:47
160000 -- (-373.868) (-374.929) [-373.087] (-375.612) * (-372.216) (-372.491) (-372.300) [-371.599] -- 0:00:47
Average standard deviation of split frequencies: 0.022855
160500 -- (-373.455) [-372.288] (-372.720) (-372.555) * (-371.895) (-372.805) (-371.527) [-372.640] -- 0:00:47
161000 -- (-374.237) (-377.400) (-374.334) [-375.999] * (-372.016) (-373.426) (-372.860) [-374.727] -- 0:00:46
161500 -- [-372.093] (-376.803) (-374.256) (-371.559) * (-371.711) (-372.978) (-374.824) [-373.479] -- 0:00:46
162000 -- (-372.483) (-377.064) (-379.804) [-372.610] * [-373.337] (-371.562) (-373.454) (-374.504) -- 0:00:51
162500 -- (-371.797) (-376.160) (-374.554) [-373.366] * (-371.995) [-374.010] (-372.464) (-376.951) -- 0:00:51
163000 -- [-373.129] (-380.850) (-378.118) (-377.580) * (-372.894) (-373.823) (-373.598) [-375.305] -- 0:00:51
163500 -- (-372.497) (-372.053) (-373.342) [-375.474] * (-373.423) (-375.232) [-375.503] (-373.788) -- 0:00:51
164000 -- (-373.341) [-374.959] (-374.656) (-372.796) * [-374.652] (-373.942) (-375.956) (-371.462) -- 0:00:50
164500 -- (-372.847) (-373.636) (-375.392) [-374.182] * (-372.741) [-373.568] (-371.432) (-372.736) -- 0:00:50
165000 -- (-371.579) (-376.625) (-376.423) [-373.249] * (-372.377) (-375.064) (-371.932) [-372.493] -- 0:00:50
Average standard deviation of split frequencies: 0.024362
165500 -- (-376.280) [-373.216] (-375.077) (-373.126) * (-372.884) (-372.223) [-374.108] (-372.625) -- 0:00:50
166000 -- (-374.112) [-374.043] (-373.658) (-373.560) * (-372.739) (-373.278) [-372.904] (-373.512) -- 0:00:50
166500 -- (-373.903) [-371.526] (-375.471) (-374.359) * (-372.943) (-373.085) [-372.238] (-373.164) -- 0:00:50
167000 -- [-378.698] (-373.037) (-372.507) (-373.702) * (-373.468) (-376.119) (-375.175) [-371.733] -- 0:00:49
167500 -- (-374.848) [-372.604] (-374.594) (-372.581) * (-372.258) (-379.769) [-373.977] (-374.568) -- 0:00:49
168000 -- (-373.697) [-373.441] (-378.070) (-374.894) * (-373.137) [-373.210] (-371.372) (-375.947) -- 0:00:49
168500 -- (-373.666) (-372.460) [-374.889] (-376.412) * (-372.497) [-374.479] (-372.805) (-375.791) -- 0:00:49
169000 -- (-372.492) (-372.373) (-372.101) [-376.490] * [-372.866] (-375.161) (-372.080) (-377.957) -- 0:00:49
169500 -- (-373.202) [-373.108] (-371.601) (-377.618) * (-372.453) (-375.005) [-375.309] (-373.364) -- 0:00:48
170000 -- (-373.459) (-372.228) [-371.372] (-376.125) * (-375.194) (-371.769) (-372.747) [-372.117] -- 0:00:48
Average standard deviation of split frequencies: 0.021952
170500 -- [-375.364] (-372.913) (-372.830) (-374.700) * (-376.648) [-371.736] (-377.339) (-374.544) -- 0:00:48
171000 -- (-372.829) [-374.519] (-372.246) (-373.758) * [-374.572] (-376.520) (-372.217) (-374.317) -- 0:00:48
171500 -- [-372.336] (-373.317) (-374.473) (-372.746) * (-375.570) (-374.378) [-373.650] (-372.129) -- 0:00:48
172000 -- (-372.710) (-372.572) [-372.296] (-373.072) * (-375.599) (-372.830) [-373.272] (-373.434) -- 0:00:48
172500 -- (-380.448) [-373.679] (-373.218) (-372.395) * (-377.421) (-372.227) (-372.349) [-372.760] -- 0:00:47
173000 -- (-375.280) (-372.271) (-372.108) [-372.745] * (-374.741) (-372.863) [-373.236] (-373.373) -- 0:00:47
173500 -- [-375.238] (-374.057) (-374.874) (-371.742) * (-378.923) (-380.287) [-373.477] (-373.864) -- 0:00:47
174000 -- (-373.284) [-373.276] (-373.425) (-373.181) * (-374.809) (-382.968) (-374.732) [-373.509] -- 0:00:47
174500 -- (-373.111) [-375.327] (-372.291) (-372.025) * [-373.757] (-374.267) (-376.440) (-374.785) -- 0:00:47
175000 -- [-371.965] (-372.265) (-374.143) (-372.954) * [-374.365] (-371.421) (-372.284) (-373.948) -- 0:00:47
Average standard deviation of split frequencies: 0.023683
175500 -- (-372.371) [-374.089] (-373.660) (-372.734) * (-375.268) (-373.822) [-373.122] (-373.430) -- 0:00:46
176000 -- (-371.991) [-376.310] (-371.922) (-373.204) * (-375.156) (-373.868) (-375.203) [-372.097] -- 0:00:46
176500 -- (-371.974) (-375.175) [-372.847] (-373.271) * (-375.895) (-372.487) (-376.538) [-373.032] -- 0:00:46
177000 -- [-373.831] (-375.695) (-372.252) (-374.448) * (-381.867) [-373.371] (-378.638) (-374.518) -- 0:00:46
177500 -- (-371.993) (-375.307) [-375.407] (-375.719) * (-374.663) (-373.295) [-372.541] (-376.127) -- 0:00:46
178000 -- (-373.144) [-371.515] (-373.951) (-377.748) * (-373.807) (-374.730) (-374.328) [-374.795] -- 0:00:46
178500 -- (-371.323) (-371.853) [-376.104] (-372.020) * (-373.776) [-372.403] (-373.677) (-372.383) -- 0:00:46
179000 -- (-371.550) (-376.389) (-376.718) [-378.298] * (-377.479) [-372.657] (-376.279) (-373.071) -- 0:00:50
179500 -- (-371.809) (-372.536) (-375.461) [-374.771] * [-374.591] (-378.349) (-372.159) (-373.978) -- 0:00:50
180000 -- (-378.758) (-373.323) [-374.978] (-375.252) * (-375.577) [-375.501] (-373.333) (-372.954) -- 0:00:50
Average standard deviation of split frequencies: 0.024445
180500 -- [-372.851] (-375.840) (-371.688) (-375.085) * [-377.944] (-373.868) (-373.255) (-373.343) -- 0:00:49
181000 -- (-372.170) [-372.829] (-378.298) (-373.593) * (-376.950) [-372.171] (-373.241) (-375.307) -- 0:00:49
181500 -- (-372.361) [-374.391] (-372.247) (-372.378) * [-375.469] (-373.930) (-371.712) (-373.426) -- 0:00:49
182000 -- (-371.867) (-372.875) [-372.161] (-372.403) * [-374.058] (-373.463) (-374.527) (-372.170) -- 0:00:49
182500 -- (-375.095) (-372.658) [-375.881] (-375.563) * (-379.033) (-372.827) [-377.310] (-371.622) -- 0:00:49
183000 -- (-372.265) (-372.313) [-372.947] (-372.426) * (-372.287) (-373.547) [-380.633] (-376.870) -- 0:00:49
183500 -- (-377.249) (-373.450) (-374.756) [-371.816] * (-375.020) [-375.168] (-374.285) (-376.821) -- 0:00:48
184000 -- (-372.650) (-371.633) (-374.780) [-373.768] * (-371.688) [-372.299] (-372.381) (-377.834) -- 0:00:48
184500 -- (-374.484) (-372.911) [-371.597] (-374.162) * (-377.018) [-372.361] (-375.030) (-376.873) -- 0:00:48
185000 -- [-374.026] (-373.140) (-372.747) (-372.115) * (-373.083) (-372.744) [-375.063] (-373.005) -- 0:00:48
Average standard deviation of split frequencies: 0.024411
185500 -- (-372.530) [-372.265] (-372.468) (-374.634) * [-372.879] (-374.794) (-379.350) (-375.311) -- 0:00:48
186000 -- [-376.267] (-371.297) (-374.285) (-372.694) * (-372.895) [-375.664] (-373.903) (-372.523) -- 0:00:48
186500 -- (-375.022) (-378.856) (-371.754) [-374.869] * [-372.539] (-372.233) (-377.094) (-373.851) -- 0:00:47
187000 -- (-372.955) [-373.592] (-372.347) (-372.875) * (-376.428) [-371.526] (-373.220) (-375.762) -- 0:00:47
187500 -- (-373.047) (-373.093) (-373.003) [-373.019] * (-375.442) (-372.865) [-373.037] (-371.764) -- 0:00:47
188000 -- (-372.345) [-372.363] (-373.222) (-373.853) * (-373.475) (-371.891) [-372.126] (-373.577) -- 0:00:47
188500 -- (-374.133) (-372.852) (-375.600) [-373.749] * (-374.283) (-372.950) [-375.345] (-371.943) -- 0:00:47
189000 -- (-372.309) [-375.200] (-372.192) (-372.892) * (-372.098) (-374.131) (-372.895) [-374.649] -- 0:00:47
189500 -- [-372.154] (-373.770) (-375.490) (-372.504) * (-373.672) (-374.091) [-372.369] (-372.945) -- 0:00:47
190000 -- [-373.097] (-374.122) (-375.134) (-373.975) * [-374.318] (-372.240) (-373.578) (-376.340) -- 0:00:46
Average standard deviation of split frequencies: 0.022772
190500 -- [-372.605] (-373.928) (-373.226) (-374.479) * (-373.865) [-374.331] (-377.607) (-374.548) -- 0:00:46
191000 -- (-373.178) (-372.358) (-371.180) [-373.045] * [-373.444] (-372.325) (-375.172) (-373.007) -- 0:00:46
191500 -- (-374.899) (-375.015) (-374.682) [-373.579] * (-380.174) [-373.285] (-374.387) (-373.204) -- 0:00:46
192000 -- (-375.027) [-376.636] (-375.080) (-372.982) * (-388.336) [-372.621] (-372.777) (-378.462) -- 0:00:46
192500 -- (-374.249) (-374.936) (-374.374) [-376.374] * (-373.132) (-373.324) [-374.436] (-373.275) -- 0:00:46
193000 -- (-372.482) (-373.625) (-373.556) [-372.799] * (-372.537) (-373.298) (-373.292) [-374.615] -- 0:00:45
193500 -- (-372.605) [-372.871] (-373.610) (-376.186) * [-371.913] (-372.665) (-372.526) (-374.505) -- 0:00:45
194000 -- (-373.509) [-372.213] (-371.864) (-372.241) * (-375.561) (-373.938) [-371.678] (-376.205) -- 0:00:45
194500 -- (-372.417) [-375.168] (-372.249) (-371.797) * (-372.519) (-372.671) [-372.449] (-376.326) -- 0:00:45
195000 -- (-372.890) (-379.455) [-374.085] (-372.074) * (-373.473) (-374.178) [-371.416] (-371.891) -- 0:00:45
Average standard deviation of split frequencies: 0.023545
195500 -- (-377.172) (-377.363) [-372.019] (-373.604) * (-383.461) (-373.268) (-371.502) [-372.919] -- 0:00:49
196000 -- [-374.750] (-373.455) (-371.703) (-374.591) * (-374.626) (-375.550) [-372.013] (-371.761) -- 0:00:49
196500 -- [-371.768] (-373.698) (-372.123) (-373.563) * [-379.881] (-375.825) (-372.265) (-372.308) -- 0:00:49
197000 -- (-372.966) (-373.973) [-371.952] (-376.101) * (-376.380) [-372.850] (-372.791) (-375.112) -- 0:00:48
197500 -- (-372.102) (-374.305) (-376.567) [-372.543] * (-373.101) [-371.946] (-373.692) (-373.493) -- 0:00:48
198000 -- [-372.607] (-374.179) (-372.122) (-372.128) * (-373.743) [-371.656] (-374.328) (-373.289) -- 0:00:48
198500 -- (-372.260) (-375.224) [-372.903] (-373.223) * [-372.870] (-371.640) (-379.637) (-376.961) -- 0:00:48
199000 -- (-373.229) (-374.852) [-374.858] (-374.985) * (-371.643) [-372.617] (-374.689) (-374.065) -- 0:00:48
199500 -- [-372.099] (-373.943) (-373.439) (-374.565) * [-373.931] (-372.727) (-372.654) (-372.687) -- 0:00:48
200000 -- [-373.399] (-374.390) (-375.314) (-374.421) * [-372.311] (-373.791) (-374.256) (-373.876) -- 0:00:48
Average standard deviation of split frequencies: 0.023492
200500 -- [-373.140] (-373.973) (-374.184) (-372.192) * (-371.463) (-372.365) [-372.816] (-376.276) -- 0:00:47
201000 -- (-371.227) (-373.157) (-374.870) [-371.967] * (-375.321) (-372.792) (-373.047) [-372.968] -- 0:00:47
201500 -- (-372.405) (-374.341) [-372.936] (-374.487) * (-373.622) (-373.548) (-373.446) [-375.335] -- 0:00:47
202000 -- [-372.689] (-378.619) (-375.394) (-372.729) * [-372.679] (-373.199) (-375.821) (-372.181) -- 0:00:47
202500 -- (-375.054) (-371.989) (-375.017) [-375.915] * [-371.966] (-375.748) (-375.041) (-376.582) -- 0:00:47
203000 -- [-373.285] (-372.945) (-373.651) (-376.236) * (-373.694) (-373.424) [-375.099] (-373.851) -- 0:00:47
203500 -- (-374.811) (-374.649) (-375.102) [-373.245] * (-374.563) [-374.314] (-376.322) (-372.771) -- 0:00:46
204000 -- [-373.798] (-375.180) (-374.817) (-374.054) * [-372.167] (-376.517) (-372.767) (-373.663) -- 0:00:46
204500 -- (-372.313) (-377.823) (-374.945) [-374.059] * (-373.699) (-372.022) (-372.929) [-372.619] -- 0:00:46
205000 -- (-375.411) (-372.778) (-374.637) [-374.267] * (-373.099) (-372.777) (-375.557) [-373.681] -- 0:00:46
Average standard deviation of split frequencies: 0.020939
205500 -- (-372.183) [-374.176] (-372.509) (-381.523) * (-376.325) (-373.382) (-372.692) [-373.183] -- 0:00:46
206000 -- [-373.734] (-374.902) (-373.837) (-382.949) * (-373.393) [-374.180] (-374.644) (-374.617) -- 0:00:46
206500 -- [-372.449] (-375.957) (-373.100) (-380.524) * (-372.379) (-376.118) (-375.323) [-375.552] -- 0:00:46
207000 -- (-373.621) [-373.046] (-374.092) (-373.279) * (-373.554) (-376.114) [-374.844] (-374.081) -- 0:00:45
207500 -- (-374.111) [-371.382] (-371.788) (-372.895) * (-373.902) [-374.955] (-373.631) (-371.997) -- 0:00:45
208000 -- (-372.625) (-372.714) [-372.180] (-376.070) * (-372.446) (-375.730) [-371.440] (-378.401) -- 0:00:45
208500 -- [-373.023] (-379.054) (-373.556) (-372.413) * (-374.741) [-375.395] (-372.782) (-373.422) -- 0:00:45
209000 -- [-374.297] (-373.194) (-372.088) (-372.656) * (-371.543) (-376.710) [-372.641] (-372.416) -- 0:00:45
209500 -- [-372.838] (-379.583) (-379.129) (-371.829) * [-371.627] (-375.262) (-375.315) (-373.681) -- 0:00:45
210000 -- (-375.869) (-378.344) (-373.358) [-375.112] * (-374.276) (-377.143) [-371.964] (-374.446) -- 0:00:45
Average standard deviation of split frequencies: 0.019197
210500 -- (-376.105) (-374.038) (-373.466) [-374.286] * [-376.106] (-380.302) (-374.580) (-372.697) -- 0:00:45
211000 -- (-374.479) [-371.992] (-373.131) (-375.571) * (-372.710) [-372.311] (-374.971) (-374.137) -- 0:00:44
211500 -- (-374.748) (-372.180) (-372.254) [-372.053] * (-375.156) (-377.781) [-374.995] (-372.405) -- 0:00:44
212000 -- (-372.036) (-372.644) (-375.333) [-373.349] * (-374.103) [-372.422] (-373.340) (-373.077) -- 0:00:44
212500 -- (-375.491) (-374.287) (-375.290) [-374.618] * [-373.857] (-373.463) (-373.152) (-371.415) -- 0:00:48
213000 -- (-372.500) (-384.438) [-373.066] (-372.116) * (-372.781) (-372.460) (-372.939) [-373.287] -- 0:00:48
213500 -- [-372.401] (-375.820) (-380.078) (-371.772) * (-374.290) (-374.299) [-372.415] (-371.689) -- 0:00:47
214000 -- (-372.733) [-375.441] (-374.574) (-372.993) * (-372.774) (-372.183) (-373.735) [-371.794] -- 0:00:47
214500 -- (-376.679) [-374.735] (-376.234) (-371.851) * (-375.787) (-374.484) [-373.528] (-371.639) -- 0:00:47
215000 -- (-371.789) (-374.050) [-372.189] (-373.869) * [-376.820] (-373.433) (-375.156) (-373.864) -- 0:00:47
Average standard deviation of split frequencies: 0.018793
215500 -- (-376.060) (-373.619) [-372.557] (-374.521) * [-373.204] (-374.556) (-374.639) (-374.637) -- 0:00:47
216000 -- (-373.025) [-371.850] (-374.402) (-374.275) * [-372.015] (-371.613) (-374.563) (-373.872) -- 0:00:47
216500 -- (-371.745) [-372.148] (-372.908) (-373.663) * (-374.640) (-373.746) (-373.702) [-372.121] -- 0:00:47
217000 -- [-372.963] (-372.655) (-377.684) (-372.503) * (-380.251) (-373.206) [-375.184] (-372.660) -- 0:00:46
217500 -- (-375.375) (-373.462) [-374.370] (-374.641) * (-375.001) (-374.300) (-372.113) [-373.937] -- 0:00:46
218000 -- (-377.350) (-375.692) [-375.730] (-375.312) * (-371.760) (-372.753) (-375.242) [-375.422] -- 0:00:46
218500 -- (-374.885) [-372.888] (-377.425) (-376.986) * (-375.827) (-372.792) (-375.138) [-372.376] -- 0:00:46
219000 -- (-374.997) (-373.438) (-372.599) [-375.657] * (-376.507) (-371.510) (-373.195) [-371.348] -- 0:00:46
219500 -- (-375.565) (-374.526) (-373.555) [-374.939] * [-373.527] (-372.442) (-375.222) (-372.884) -- 0:00:46
220000 -- (-374.007) (-372.064) [-373.392] (-373.589) * (-373.988) [-371.531] (-381.342) (-372.974) -- 0:00:46
Average standard deviation of split frequencies: 0.017328
220500 -- (-376.431) (-374.396) (-372.928) [-374.899] * (-372.874) (-374.005) (-380.396) [-373.638] -- 0:00:45
221000 -- (-371.889) (-373.440) [-373.554] (-376.168) * [-373.441] (-373.367) (-374.160) (-372.261) -- 0:00:45
221500 -- (-379.572) [-376.425] (-372.305) (-371.567) * (-373.242) (-374.798) (-373.912) [-373.152] -- 0:00:45
222000 -- (-371.801) [-373.958] (-376.005) (-372.867) * (-373.103) [-373.582] (-373.931) (-372.449) -- 0:00:45
222500 -- (-374.696) (-371.700) [-373.529] (-374.744) * (-375.364) (-372.928) [-374.523] (-373.499) -- 0:00:45
223000 -- [-377.666] (-374.227) (-372.730) (-374.212) * (-374.822) (-372.534) [-373.469] (-372.691) -- 0:00:45
223500 -- [-378.086] (-374.358) (-374.942) (-374.119) * (-372.779) [-372.687] (-373.971) (-376.595) -- 0:00:45
224000 -- (-376.714) (-372.074) (-372.666) [-371.718] * (-375.161) [-373.969] (-372.090) (-378.311) -- 0:00:45
224500 -- (-372.728) [-373.189] (-371.765) (-373.949) * [-375.947] (-373.786) (-373.262) (-373.856) -- 0:00:44
225000 -- (-372.809) (-372.395) (-375.522) [-373.683] * (-376.176) [-383.544] (-376.046) (-371.742) -- 0:00:44
Average standard deviation of split frequencies: 0.017016
225500 -- (-371.515) [-372.989] (-374.639) (-375.397) * (-373.624) [-376.495] (-375.101) (-373.417) -- 0:00:44
226000 -- (-378.302) [-375.332] (-373.885) (-373.746) * (-373.422) (-373.069) [-372.168] (-372.444) -- 0:00:44
226500 -- (-372.930) (-373.043) (-377.684) [-373.302] * [-372.935] (-374.483) (-373.367) (-373.278) -- 0:00:44
227000 -- [-372.532] (-372.836) (-373.433) (-371.833) * (-372.745) (-374.710) [-371.417] (-374.759) -- 0:00:44
227500 -- (-372.304) [-371.921] (-374.556) (-372.100) * [-373.523] (-372.593) (-371.632) (-372.139) -- 0:00:44
228000 -- (-374.819) (-375.523) (-372.805) [-374.167] * [-375.327] (-373.423) (-372.861) (-374.026) -- 0:00:44
228500 -- [-376.173] (-373.557) (-372.639) (-371.864) * (-375.265) (-373.756) (-372.167) [-376.058] -- 0:00:43
229000 -- (-375.903) (-374.384) (-373.213) [-374.201] * [-374.760] (-373.224) (-373.383) (-373.078) -- 0:00:43
229500 -- (-371.723) (-373.027) (-373.781) [-373.888] * [-372.872] (-372.197) (-372.960) (-376.369) -- 0:00:47
230000 -- (-374.689) (-376.404) [-376.402] (-373.000) * (-372.818) (-371.661) (-375.900) [-373.508] -- 0:00:46
Average standard deviation of split frequencies: 0.017371
230500 -- (-374.790) (-373.110) (-374.302) [-372.432] * (-373.185) [-373.434] (-374.263) (-373.858) -- 0:00:46
231000 -- (-374.538) (-374.870) (-373.655) [-373.136] * (-373.403) (-374.487) (-371.691) [-372.615] -- 0:00:46
231500 -- (-372.703) [-371.895] (-371.879) (-373.735) * (-374.272) [-376.883] (-373.134) (-373.499) -- 0:00:46
232000 -- [-371.808] (-374.265) (-376.334) (-374.050) * (-372.597) (-373.235) (-372.230) [-372.445] -- 0:00:46
232500 -- (-372.010) [-371.875] (-375.649) (-378.041) * (-372.294) (-373.238) (-374.072) [-372.318] -- 0:00:46
233000 -- (-372.312) [-373.141] (-372.855) (-373.995) * (-374.366) (-371.878) (-373.663) [-372.471] -- 0:00:46
233500 -- (-372.456) (-372.602) [-374.190] (-371.748) * (-374.622) [-372.387] (-374.272) (-371.775) -- 0:00:45
234000 -- [-372.240] (-373.486) (-376.535) (-372.938) * (-373.499) [-374.119] (-373.150) (-371.175) -- 0:00:45
234500 -- (-376.002) [-373.627] (-375.621) (-376.413) * (-372.221) (-377.209) [-375.485] (-371.770) -- 0:00:45
235000 -- (-374.783) [-372.508] (-373.859) (-374.094) * (-374.886) (-375.086) (-372.832) [-371.610] -- 0:00:45
Average standard deviation of split frequencies: 0.016757
235500 -- (-374.949) [-372.509] (-373.907) (-377.457) * (-379.327) (-375.863) [-373.504] (-371.525) -- 0:00:45
236000 -- (-373.567) (-373.066) [-372.881] (-375.413) * (-377.841) (-375.140) [-374.362] (-372.833) -- 0:00:45
236500 -- (-375.646) (-375.527) (-371.502) [-373.554] * [-374.463] (-372.543) (-372.612) (-372.612) -- 0:00:45
237000 -- (-373.833) [-371.638] (-372.842) (-374.093) * [-371.264] (-374.864) (-372.624) (-371.964) -- 0:00:45
237500 -- (-374.289) (-373.157) (-373.775) [-373.494] * (-372.574) [-372.631] (-374.807) (-376.075) -- 0:00:44
238000 -- [-372.877] (-373.792) (-371.420) (-372.518) * [-375.702] (-375.736) (-374.219) (-372.440) -- 0:00:44
238500 -- (-372.906) (-373.524) [-373.561] (-376.926) * (-372.090) [-374.476] (-372.822) (-372.480) -- 0:00:44
239000 -- [-373.638] (-372.683) (-372.004) (-373.516) * (-374.505) [-374.833] (-373.185) (-372.551) -- 0:00:44
239500 -- (-373.373) [-372.441] (-374.573) (-371.916) * (-374.808) (-371.565) [-374.387] (-371.685) -- 0:00:44
240000 -- (-376.552) (-375.253) (-376.170) [-374.053] * (-372.189) [-373.530] (-375.196) (-372.309) -- 0:00:44
Average standard deviation of split frequencies: 0.015996
240500 -- [-373.695] (-373.219) (-374.226) (-372.678) * (-372.229) [-372.180] (-375.495) (-372.221) -- 0:00:44
241000 -- [-374.660] (-373.312) (-374.702) (-373.239) * (-372.221) (-373.834) (-372.705) [-372.533] -- 0:00:44
241500 -- (-374.353) (-372.928) [-374.670] (-372.438) * [-371.884] (-372.504) (-372.352) (-377.234) -- 0:00:43
242000 -- (-372.943) (-377.699) [-374.903] (-374.156) * [-372.500] (-373.436) (-371.938) (-374.776) -- 0:00:43
242500 -- (-371.512) (-374.670) [-372.968] (-372.171) * (-381.106) (-375.570) (-371.370) [-371.761] -- 0:00:43
243000 -- (-373.588) (-374.908) [-372.256] (-374.883) * [-372.423] (-372.019) (-371.892) (-373.313) -- 0:00:43
243500 -- (-374.906) [-371.755] (-374.306) (-375.433) * (-372.928) (-373.646) [-373.476] (-375.518) -- 0:00:43
244000 -- (-373.610) (-373.102) [-372.112] (-374.881) * [-371.951] (-374.647) (-375.841) (-374.659) -- 0:00:43
244500 -- (-372.516) [-373.177] (-371.992) (-372.468) * (-375.431) [-372.712] (-371.495) (-373.185) -- 0:00:43
245000 -- [-372.930] (-372.779) (-372.954) (-374.996) * (-373.885) [-374.258] (-373.310) (-374.665) -- 0:00:43
Average standard deviation of split frequencies: 0.015756
245500 -- (-372.665) (-372.301) [-372.041] (-375.694) * (-371.460) [-371.989] (-372.171) (-376.333) -- 0:00:46
246000 -- (-374.294) (-373.005) [-373.041] (-372.647) * [-371.666] (-376.547) (-376.592) (-374.465) -- 0:00:45
246500 -- (-374.783) [-371.682] (-373.021) (-378.492) * (-372.804) [-380.153] (-380.079) (-376.018) -- 0:00:45
247000 -- (-373.739) [-372.314] (-377.182) (-377.200) * [-374.268] (-378.871) (-376.474) (-374.672) -- 0:00:45
247500 -- (-372.644) (-373.234) [-374.725] (-374.426) * (-373.547) [-374.525] (-372.805) (-372.265) -- 0:00:45
248000 -- (-373.811) [-372.591] (-373.553) (-374.339) * (-374.033) (-374.491) (-374.119) [-372.776] -- 0:00:45
248500 -- [-373.711] (-378.077) (-376.139) (-373.818) * [-377.265] (-375.076) (-376.105) (-373.040) -- 0:00:45
249000 -- (-372.040) (-373.899) [-373.442] (-374.007) * [-373.684] (-375.518) (-373.443) (-374.198) -- 0:00:45
249500 -- [-371.597] (-378.532) (-372.895) (-373.711) * (-374.431) (-376.596) (-374.029) [-371.954] -- 0:00:45
250000 -- (-371.869) [-373.235] (-373.418) (-374.358) * (-376.341) (-374.465) (-371.851) [-375.424] -- 0:00:45
Average standard deviation of split frequencies: 0.016299
250500 -- (-373.793) (-374.844) [-373.655] (-374.295) * (-373.362) (-373.161) (-373.154) [-376.336] -- 0:00:44
251000 -- (-375.875) (-372.772) (-372.432) [-376.457] * (-375.526) (-371.749) (-373.319) [-374.396] -- 0:00:44
251500 -- [-374.540] (-372.113) (-372.601) (-374.123) * [-375.064] (-373.311) (-372.682) (-374.865) -- 0:00:44
252000 -- (-373.581) (-374.529) [-374.977] (-371.640) * (-372.474) (-380.050) (-372.383) [-372.097] -- 0:00:44
252500 -- (-375.819) [-374.241] (-377.308) (-372.049) * [-373.552] (-379.301) (-372.411) (-372.075) -- 0:00:44
253000 -- (-379.098) [-371.879] (-374.460) (-372.313) * [-374.699] (-372.790) (-373.666) (-376.082) -- 0:00:44
253500 -- [-372.843] (-372.125) (-375.113) (-372.314) * (-374.359) [-373.011] (-375.235) (-372.763) -- 0:00:44
254000 -- (-372.659) [-371.631] (-374.006) (-372.337) * (-372.947) [-372.738] (-376.823) (-372.800) -- 0:00:44
254500 -- [-372.266] (-371.337) (-373.358) (-371.807) * (-371.955) (-372.107) (-375.528) [-371.968] -- 0:00:43
255000 -- (-375.900) [-371.504] (-373.450) (-373.123) * (-374.012) (-372.432) [-372.701] (-373.669) -- 0:00:43
Average standard deviation of split frequencies: 0.016185
255500 -- (-372.400) [-374.458] (-372.830) (-375.424) * (-376.516) (-373.729) [-373.254] (-374.921) -- 0:00:43
256000 -- (-372.912) [-373.463] (-372.335) (-376.871) * (-372.871) (-373.260) [-372.256] (-379.444) -- 0:00:43
256500 -- (-377.710) (-372.802) [-371.277] (-373.113) * (-373.750) (-376.972) [-374.783] (-376.867) -- 0:00:43
257000 -- [-374.984] (-372.507) (-375.858) (-375.078) * (-371.871) (-373.309) (-376.716) [-373.071] -- 0:00:43
257500 -- (-373.765) [-374.080] (-380.657) (-373.492) * (-374.078) (-373.670) (-372.432) [-372.736] -- 0:00:43
258000 -- (-372.775) [-372.541] (-378.035) (-372.679) * (-374.109) [-375.615] (-373.473) (-373.656) -- 0:00:43
258500 -- (-372.007) [-374.080] (-378.427) (-372.921) * [-373.323] (-374.395) (-371.658) (-378.708) -- 0:00:43
259000 -- [-377.520] (-374.783) (-381.349) (-376.028) * (-374.858) [-374.330] (-375.904) (-379.959) -- 0:00:42
259500 -- (-374.395) (-377.971) [-373.756] (-374.098) * [-374.632] (-380.743) (-373.644) (-372.715) -- 0:00:42
260000 -- (-377.020) (-374.929) [-372.225] (-374.071) * [-373.913] (-374.003) (-374.863) (-374.715) -- 0:00:42
Average standard deviation of split frequencies: 0.015673
260500 -- [-371.768] (-375.852) (-374.577) (-372.627) * (-375.626) [-381.161] (-376.364) (-376.245) -- 0:00:42
261000 -- (-372.676) (-375.552) (-373.189) [-372.498] * (-373.699) (-375.040) (-373.838) [-373.723] -- 0:00:42
261500 -- (-375.666) (-374.356) [-376.257] (-373.297) * (-373.135) (-374.483) (-373.608) [-371.924] -- 0:00:42
262000 -- [-373.781] (-373.659) (-372.662) (-372.280) * (-371.826) (-374.303) [-373.318] (-375.701) -- 0:00:45
262500 -- (-378.672) [-374.645] (-371.616) (-373.312) * (-372.936) (-373.164) [-375.896] (-375.076) -- 0:00:44
263000 -- (-372.636) (-373.111) (-372.465) [-371.905] * (-373.914) [-373.063] (-372.111) (-380.326) -- 0:00:44
263500 -- (-372.179) (-372.957) (-373.608) [-376.280] * (-372.948) (-373.666) [-372.612] (-371.746) -- 0:00:44
264000 -- (-375.539) (-377.625) [-374.828] (-373.788) * [-372.018] (-376.272) (-372.626) (-373.321) -- 0:00:44
264500 -- (-376.663) (-380.391) (-374.334) [-374.518] * [-372.341] (-374.744) (-373.423) (-373.751) -- 0:00:44
265000 -- (-371.505) (-373.374) [-374.732] (-374.839) * (-372.261) (-377.295) (-372.612) [-376.407] -- 0:00:44
Average standard deviation of split frequencies: 0.015017
265500 -- (-372.081) (-376.356) (-374.838) [-374.241] * (-374.079) (-376.384) (-376.795) [-373.244] -- 0:00:44
266000 -- (-374.997) (-373.822) (-371.479) [-373.038] * (-373.028) (-375.139) (-372.886) [-373.090] -- 0:00:44
266500 -- [-371.690] (-375.437) (-374.503) (-373.129) * (-374.234) (-377.167) [-374.656] (-375.985) -- 0:00:44
267000 -- (-373.020) (-376.493) (-376.371) [-374.056] * (-372.413) [-373.231] (-373.375) (-375.547) -- 0:00:43
267500 -- [-372.584] (-376.672) (-374.292) (-372.987) * (-373.496) (-380.194) [-373.895] (-373.171) -- 0:00:43
268000 -- (-374.471) (-380.076) [-372.073] (-373.730) * (-374.809) (-375.630) (-373.942) [-371.901] -- 0:00:43
268500 -- (-377.716) (-375.111) (-377.893) [-374.952] * [-374.221] (-375.748) (-372.708) (-372.370) -- 0:00:43
269000 -- (-372.164) (-372.524) (-374.681) [-372.635] * (-374.173) (-375.611) (-373.660) [-371.997] -- 0:00:43
269500 -- (-372.689) (-372.641) [-373.065] (-374.860) * (-374.307) (-376.294) [-372.575] (-375.443) -- 0:00:43
270000 -- (-373.933) [-380.768] (-379.971) (-375.450) * (-372.334) (-379.182) [-374.365] (-372.069) -- 0:00:43
Average standard deviation of split frequencies: 0.013353
270500 -- (-373.521) (-372.532) [-373.666] (-374.780) * [-371.318] (-378.324) (-373.417) (-372.248) -- 0:00:43
271000 -- (-373.708) (-371.905) (-371.443) [-372.813] * (-373.838) (-376.194) [-372.492] (-374.071) -- 0:00:43
271500 -- (-373.762) (-371.504) (-371.741) [-372.615] * (-374.758) [-374.380] (-373.705) (-372.401) -- 0:00:42
272000 -- (-373.029) (-372.652) [-377.139] (-376.223) * (-373.818) (-376.423) [-373.315] (-375.938) -- 0:00:42
272500 -- (-378.661) (-373.461) [-374.940] (-372.619) * (-373.322) [-374.623] (-372.911) (-372.869) -- 0:00:42
273000 -- [-374.082] (-372.730) (-373.261) (-375.383) * (-372.366) (-377.839) [-372.437] (-376.589) -- 0:00:42
273500 -- (-379.931) (-372.375) (-378.206) [-371.743] * (-372.239) (-375.815) [-373.754] (-373.030) -- 0:00:42
274000 -- (-377.947) [-371.465] (-374.255) (-373.502) * (-376.680) (-373.629) [-376.565] (-372.527) -- 0:00:42
274500 -- [-374.554] (-377.354) (-380.073) (-376.594) * (-374.007) [-374.665] (-377.166) (-375.636) -- 0:00:42
275000 -- (-372.694) (-376.072) (-376.391) [-373.625] * [-374.829] (-376.125) (-373.918) (-380.553) -- 0:00:42
Average standard deviation of split frequencies: 0.013764
275500 -- (-375.279) (-375.583) [-374.330] (-374.194) * [-372.132] (-374.027) (-375.728) (-373.183) -- 0:00:42
276000 -- (-372.998) [-372.614] (-371.563) (-373.910) * [-374.366] (-374.036) (-377.699) (-372.748) -- 0:00:41
276500 -- (-373.163) [-372.204] (-376.544) (-372.176) * (-376.644) (-371.978) (-373.611) [-372.412] -- 0:00:41
277000 -- (-375.172) (-372.820) (-374.409) [-375.544] * (-377.006) (-375.052) (-373.852) [-371.281] -- 0:00:41
277500 -- (-374.956) (-373.106) (-373.154) [-374.817] * (-375.500) [-373.555] (-376.001) (-371.755) -- 0:00:41
278000 -- (-376.499) (-372.133) (-373.234) [-375.011] * (-373.850) (-374.034) (-382.345) [-373.929] -- 0:00:41
278500 -- (-377.432) (-376.269) (-372.866) [-373.352] * (-373.775) (-371.816) [-372.578] (-378.170) -- 0:00:41
279000 -- (-373.623) (-373.393) (-372.678) [-374.447] * [-375.920] (-372.736) (-371.899) (-372.645) -- 0:00:43
279500 -- [-372.105] (-380.789) (-371.374) (-373.766) * [-373.440] (-374.080) (-375.229) (-373.470) -- 0:00:43
280000 -- (-373.190) (-372.556) [-374.177] (-372.695) * (-373.251) (-372.798) (-373.195) [-372.269] -- 0:00:43
Average standard deviation of split frequencies: 0.012943
280500 -- [-371.683] (-372.557) (-371.700) (-372.849) * [-372.131] (-371.747) (-378.054) (-372.877) -- 0:00:43
281000 -- (-372.642) (-374.016) [-374.963] (-372.443) * (-374.823) [-375.656] (-373.740) (-373.347) -- 0:00:43
281500 -- (-375.549) [-372.269] (-371.542) (-372.984) * (-375.265) [-375.885] (-373.727) (-372.384) -- 0:00:43
282000 -- [-374.275] (-372.404) (-371.871) (-374.447) * (-373.743) (-371.764) (-372.422) [-372.475] -- 0:00:43
282500 -- (-375.624) (-374.923) (-373.849) [-372.673] * (-376.895) [-376.780] (-374.126) (-375.728) -- 0:00:43
283000 -- (-376.255) (-374.280) [-373.307] (-374.972) * (-372.780) (-372.989) [-374.905] (-375.712) -- 0:00:43
283500 -- [-373.928] (-375.159) (-378.440) (-373.175) * [-374.180] (-376.362) (-374.231) (-373.832) -- 0:00:42
284000 -- (-371.606) (-375.764) [-373.839] (-373.844) * (-372.383) (-374.126) [-378.018] (-372.910) -- 0:00:42
284500 -- (-373.622) (-373.874) (-377.845) [-373.317] * (-372.629) (-372.395) [-377.964] (-374.347) -- 0:00:42
285000 -- [-378.148] (-371.983) (-381.762) (-372.964) * [-373.314] (-371.767) (-374.341) (-375.324) -- 0:00:42
Average standard deviation of split frequencies: 0.012545
285500 -- (-372.824) [-372.945] (-378.345) (-371.846) * [-371.377] (-372.802) (-374.020) (-373.756) -- 0:00:42
286000 -- (-375.080) [-372.788] (-374.122) (-376.289) * (-374.309) (-374.229) (-376.563) [-375.847] -- 0:00:42
286500 -- [-372.399] (-375.137) (-374.063) (-375.834) * [-372.820] (-373.846) (-374.438) (-373.538) -- 0:00:42
287000 -- (-374.175) [-375.831] (-372.893) (-376.954) * (-373.482) (-373.486) (-374.872) [-372.201] -- 0:00:42
287500 -- [-372.958] (-374.731) (-376.197) (-374.543) * [-372.349] (-374.525) (-376.424) (-372.892) -- 0:00:42
288000 -- (-375.680) (-372.865) [-372.464] (-374.054) * [-372.007] (-372.695) (-371.646) (-372.021) -- 0:00:42
288500 -- [-372.128] (-373.848) (-372.184) (-378.402) * [-375.606] (-375.295) (-373.932) (-371.696) -- 0:00:41
289000 -- (-371.428) [-372.084] (-372.668) (-373.794) * (-372.714) [-374.160] (-373.072) (-375.677) -- 0:00:41
289500 -- (-377.306) (-372.489) [-373.869] (-372.715) * (-372.830) [-373.515] (-372.383) (-374.231) -- 0:00:41
290000 -- (-372.446) (-372.393) [-374.381] (-373.125) * (-377.284) [-373.778] (-373.748) (-376.518) -- 0:00:41
Average standard deviation of split frequencies: 0.012497
290500 -- (-373.622) [-375.055] (-373.499) (-379.101) * (-373.050) (-372.942) (-372.674) [-372.157] -- 0:00:41
291000 -- (-372.565) (-378.879) [-375.679] (-376.160) * (-374.053) [-372.388] (-372.446) (-374.177) -- 0:00:41
291500 -- (-373.958) (-374.459) [-374.899] (-377.804) * (-374.424) (-374.812) (-373.123) [-373.723] -- 0:00:41
292000 -- (-372.274) (-377.176) (-371.554) [-375.063] * (-376.686) (-372.302) [-373.078] (-372.986) -- 0:00:41
292500 -- [-373.064] (-375.645) (-371.966) (-371.971) * (-372.082) [-372.734] (-373.059) (-373.711) -- 0:00:41
293000 -- (-374.089) (-372.597) (-373.755) [-372.474] * [-372.509] (-373.372) (-374.562) (-372.437) -- 0:00:41
293500 -- (-375.280) (-375.640) (-373.115) [-373.134] * [-377.840] (-373.784) (-374.369) (-375.983) -- 0:00:40
294000 -- [-372.276] (-373.414) (-372.108) (-374.192) * (-372.240) (-372.820) (-376.478) [-372.200] -- 0:00:40
294500 -- (-373.591) [-374.566] (-372.857) (-374.661) * (-373.341) (-373.107) (-373.588) [-372.918] -- 0:00:40
295000 -- [-372.649] (-373.643) (-374.970) (-375.503) * [-371.988] (-371.463) (-377.585) (-372.178) -- 0:00:40
Average standard deviation of split frequencies: 0.012564
295500 -- (-375.093) (-375.984) [-374.272] (-372.350) * (-374.594) [-372.546] (-376.574) (-373.021) -- 0:00:40
296000 -- (-380.935) (-371.325) (-373.290) [-372.486] * [-373.302] (-374.721) (-376.722) (-371.345) -- 0:00:42
296500 -- [-373.020] (-371.337) (-373.856) (-372.487) * (-372.256) [-372.455] (-372.445) (-372.331) -- 0:00:42
297000 -- (-376.515) [-371.333] (-372.119) (-372.475) * (-374.459) (-371.949) [-374.256] (-373.385) -- 0:00:42
297500 -- (-375.076) (-373.677) (-377.467) [-372.597] * [-373.321] (-372.119) (-373.149) (-371.735) -- 0:00:42
298000 -- (-377.315) [-372.693] (-372.474) (-373.467) * (-375.246) [-374.282] (-375.778) (-373.075) -- 0:00:42
298500 -- (-371.831) (-373.494) (-379.782) [-373.166] * (-372.201) (-371.690) (-374.732) [-372.118] -- 0:00:42
299000 -- [-377.689] (-373.389) (-380.508) (-375.675) * (-377.254) (-371.242) [-374.632] (-373.035) -- 0:00:42
299500 -- (-373.639) (-374.377) [-372.231] (-371.519) * (-375.712) [-377.447] (-371.452) (-372.861) -- 0:00:42
300000 -- (-376.608) (-376.200) [-373.599] (-372.109) * [-374.589] (-379.546) (-373.323) (-373.252) -- 0:00:42
Average standard deviation of split frequencies: 0.012978
300500 -- (-376.782) [-372.892] (-374.817) (-375.472) * (-373.350) (-373.189) (-372.019) [-371.955] -- 0:00:41
301000 -- (-374.564) (-371.639) [-375.461] (-373.939) * (-372.022) (-373.019) [-373.835] (-372.652) -- 0:00:41
301500 -- (-373.324) (-371.672) [-372.327] (-375.315) * [-372.086] (-372.320) (-375.284) (-372.327) -- 0:00:41
302000 -- (-375.991) (-374.614) (-373.584) [-374.840] * (-374.776) [-372.241] (-375.020) (-372.423) -- 0:00:41
302500 -- (-373.880) (-375.508) [-371.722] (-373.872) * (-378.920) (-372.055) (-373.437) [-372.011] -- 0:00:41
303000 -- (-371.881) (-374.611) [-373.439] (-372.996) * (-373.453) (-372.767) (-377.462) [-373.952] -- 0:00:41
303500 -- (-373.168) (-375.678) (-373.130) [-372.582] * (-372.901) [-374.051] (-372.222) (-373.898) -- 0:00:41
304000 -- (-372.543) (-373.920) (-372.611) [-375.423] * (-375.252) (-373.336) [-374.286] (-375.800) -- 0:00:41
304500 -- (-374.533) (-374.003) [-372.029] (-373.048) * (-376.089) [-373.786] (-376.344) (-379.836) -- 0:00:41
305000 -- (-373.105) [-372.906] (-373.407) (-372.654) * [-371.880] (-371.565) (-372.902) (-373.373) -- 0:00:41
Average standard deviation of split frequencies: 0.013095
305500 -- (-372.470) (-373.245) (-375.721) [-372.893] * (-371.659) [-371.686] (-375.958) (-373.407) -- 0:00:40
306000 -- (-373.302) (-375.263) (-376.413) [-371.827] * (-371.673) (-372.198) [-372.941] (-373.856) -- 0:00:40
306500 -- (-371.981) (-372.435) [-372.500] (-373.210) * [-374.559] (-375.594) (-372.117) (-371.877) -- 0:00:40
307000 -- (-371.915) (-375.091) [-373.305] (-376.071) * (-373.245) [-375.140] (-373.327) (-371.281) -- 0:00:40
307500 -- (-372.790) (-374.318) (-372.551) [-377.180] * [-372.561] (-376.225) (-372.898) (-373.575) -- 0:00:40
308000 -- (-371.355) [-372.880] (-372.726) (-378.050) * (-373.031) (-372.869) (-373.282) [-374.949] -- 0:00:40
308500 -- (-371.840) (-375.092) (-374.109) [-372.780] * (-373.518) (-372.597) (-375.248) [-373.689] -- 0:00:40
309000 -- (-373.655) (-374.898) (-375.755) [-373.897] * [-371.583] (-373.344) (-375.421) (-376.579) -- 0:00:40
309500 -- (-375.511) (-375.105) [-373.118] (-377.168) * [-371.581] (-373.338) (-374.621) (-375.575) -- 0:00:40
310000 -- (-376.118) (-372.317) (-373.244) [-372.024] * (-377.244) [-374.071] (-376.036) (-378.813) -- 0:00:40
Average standard deviation of split frequencies: 0.014103
310500 -- (-371.938) [-373.408] (-373.728) (-371.918) * (-373.335) (-379.864) (-373.904) [-374.929] -- 0:00:39
311000 -- [-371.458] (-374.135) (-373.279) (-372.772) * [-372.825] (-374.410) (-376.080) (-372.391) -- 0:00:39
311500 -- [-373.874] (-375.495) (-375.446) (-372.441) * (-371.989) [-372.405] (-371.586) (-373.247) -- 0:00:39
312000 -- [-372.411] (-372.585) (-375.756) (-372.276) * [-373.830] (-373.450) (-372.007) (-375.968) -- 0:00:39
312500 -- (-377.255) (-374.030) (-376.716) [-371.962] * [-371.522] (-372.964) (-377.062) (-373.027) -- 0:00:41
313000 -- (-375.432) (-373.039) [-372.727] (-377.093) * (-375.373) (-371.970) [-375.221] (-373.314) -- 0:00:41
313500 -- [-373.943] (-372.991) (-373.913) (-372.714) * (-376.574) [-371.755] (-377.810) (-375.776) -- 0:00:41
314000 -- (-372.431) (-373.640) (-373.122) [-374.106] * (-377.413) (-372.540) (-377.125) [-374.477] -- 0:00:41
314500 -- (-372.675) (-374.580) (-374.528) [-373.150] * [-373.392] (-372.040) (-377.594) (-372.897) -- 0:00:41
315000 -- (-371.651) (-371.763) (-373.531) [-373.463] * [-374.568] (-372.255) (-372.744) (-372.972) -- 0:00:41
Average standard deviation of split frequencies: 0.013675
315500 -- [-372.002] (-374.047) (-373.408) (-373.312) * (-375.064) (-371.914) (-375.389) [-373.455] -- 0:00:41
316000 -- (-371.322) (-373.411) [-371.836] (-372.428) * (-375.523) [-373.294] (-374.780) (-374.127) -- 0:00:41
316500 -- (-372.088) [-372.601] (-372.172) (-371.849) * (-375.818) (-375.853) [-374.600] (-374.928) -- 0:00:41
317000 -- (-374.225) (-374.537) [-374.259] (-374.226) * (-377.779) (-371.455) (-373.069) [-372.626] -- 0:00:40
317500 -- (-372.176) [-375.436] (-374.720) (-384.238) * (-374.222) [-371.725] (-373.287) (-375.308) -- 0:00:40
318000 -- (-374.447) (-374.867) [-374.078] (-373.776) * [-375.749] (-372.941) (-375.402) (-374.236) -- 0:00:40
318500 -- [-373.206] (-373.576) (-374.129) (-374.984) * [-374.234] (-378.101) (-372.448) (-374.220) -- 0:00:40
319000 -- (-376.631) (-374.009) (-374.133) [-375.070] * (-374.985) (-372.948) [-373.687] (-374.439) -- 0:00:40
319500 -- (-372.914) [-372.062] (-373.617) (-374.146) * (-374.811) (-376.793) (-375.721) [-377.172] -- 0:00:40
320000 -- (-372.607) (-373.201) (-379.120) [-373.621] * (-377.384) (-372.565) (-375.992) [-374.977] -- 0:00:40
Average standard deviation of split frequencies: 0.013404
320500 -- [-374.978] (-373.179) (-374.009) (-372.333) * (-373.864) (-378.944) [-373.807] (-371.903) -- 0:00:40
321000 -- (-374.839) (-376.242) (-374.239) [-371.864] * [-375.001] (-373.513) (-372.852) (-381.331) -- 0:00:40
321500 -- [-372.966] (-374.219) (-372.055) (-377.637) * (-374.766) (-371.394) [-373.176] (-381.706) -- 0:00:40
322000 -- [-372.725] (-372.079) (-372.579) (-375.939) * (-373.521) (-372.236) (-375.589) [-377.170] -- 0:00:40
322500 -- (-375.531) (-376.681) [-372.636] (-374.934) * [-372.987] (-376.305) (-372.762) (-375.392) -- 0:00:39
323000 -- (-375.260) (-376.366) (-371.667) [-371.514] * (-372.471) [-376.121] (-374.799) (-376.439) -- 0:00:39
323500 -- [-373.390] (-378.846) (-372.102) (-372.119) * (-375.595) (-372.461) [-371.609] (-372.965) -- 0:00:39
324000 -- [-373.092] (-376.223) (-372.045) (-377.767) * (-374.076) [-371.602] (-373.079) (-373.794) -- 0:00:39
324500 -- (-373.092) (-379.766) (-371.776) [-373.448] * (-375.008) (-374.583) (-372.135) [-374.922] -- 0:00:39
325000 -- (-372.577) (-373.833) [-372.688] (-371.666) * (-378.225) (-376.722) (-371.838) [-372.334] -- 0:00:39
Average standard deviation of split frequencies: 0.013175
325500 -- (-371.962) (-374.956) (-371.455) [-373.326] * (-374.299) (-375.948) [-372.683] (-378.007) -- 0:00:39
326000 -- [-371.454] (-373.926) (-372.401) (-373.412) * (-371.354) (-377.474) [-373.117] (-379.482) -- 0:00:39
326500 -- (-372.005) (-373.926) [-373.477] (-373.765) * (-371.375) (-378.533) (-372.238) [-371.424] -- 0:00:39
327000 -- (-376.044) (-376.485) [-372.868] (-374.124) * [-371.949] (-373.500) (-372.345) (-373.093) -- 0:00:39
327500 -- [-372.557] (-374.743) (-373.839) (-375.680) * [-373.832] (-373.867) (-374.690) (-374.691) -- 0:00:39
328000 -- (-373.891) [-371.872] (-372.930) (-372.662) * (-373.958) [-374.717] (-374.880) (-376.680) -- 0:00:38
328500 -- (-376.901) (-373.206) (-372.611) [-374.384] * (-374.150) [-372.029] (-375.825) (-372.274) -- 0:00:38
329000 -- [-372.800] (-378.507) (-372.096) (-372.182) * (-374.345) [-375.240] (-374.134) (-371.534) -- 0:00:38
329500 -- (-372.576) [-376.630] (-373.599) (-372.943) * [-375.951] (-374.072) (-374.574) (-371.973) -- 0:00:40
330000 -- (-374.334) (-372.837) [-372.684] (-372.530) * (-373.133) (-372.472) [-374.805] (-371.667) -- 0:00:40
Average standard deviation of split frequencies: 0.013781
330500 -- (-374.582) (-373.455) (-374.177) [-374.921] * [-380.835] (-374.775) (-373.937) (-375.624) -- 0:00:40
331000 -- (-374.450) (-374.306) (-374.687) [-374.299] * (-373.045) [-372.142] (-373.855) (-375.546) -- 0:00:40
331500 -- (-372.793) [-376.744] (-375.253) (-374.962) * [-372.868] (-372.577) (-372.703) (-377.893) -- 0:00:40
332000 -- (-372.464) (-380.580) [-373.497] (-372.926) * (-372.515) (-374.764) [-371.493] (-373.395) -- 0:00:40
332500 -- (-371.872) [-376.329] (-374.830) (-372.339) * (-373.135) (-375.521) (-374.892) [-371.699] -- 0:00:40
333000 -- (-372.283) (-373.640) [-371.922] (-373.892) * (-372.064) (-372.622) [-377.403] (-372.342) -- 0:00:40
333500 -- [-373.064] (-373.591) (-376.007) (-375.550) * (-373.317) (-372.843) (-373.614) [-371.815] -- 0:00:39
334000 -- (-372.873) (-373.831) [-375.335] (-372.333) * (-374.488) (-374.266) [-372.881] (-373.269) -- 0:00:39
334500 -- (-380.577) (-372.342) (-376.457) [-372.114] * (-372.216) (-371.584) (-373.540) [-373.106] -- 0:00:39
335000 -- (-373.744) (-372.694) (-373.170) [-373.250] * (-374.431) (-375.939) [-373.000] (-373.962) -- 0:00:39
Average standard deviation of split frequencies: 0.013796
335500 -- (-372.728) (-374.523) (-375.413) [-372.019] * (-372.211) (-376.417) [-372.933] (-373.345) -- 0:00:39
336000 -- (-372.998) (-371.580) (-373.839) [-373.486] * (-372.351) (-372.545) [-372.337] (-375.866) -- 0:00:39
336500 -- (-373.425) (-375.857) [-372.443] (-372.401) * (-377.377) (-373.286) [-372.363] (-371.621) -- 0:00:39
337000 -- (-371.652) (-372.533) [-373.944] (-372.410) * (-373.554) [-374.298] (-372.169) (-374.011) -- 0:00:39
337500 -- (-375.030) (-372.648) (-374.288) [-373.266] * [-371.790] (-373.054) (-371.878) (-377.133) -- 0:00:39
338000 -- (-373.116) (-374.151) (-374.080) [-373.836] * [-372.592] (-374.216) (-373.212) (-378.630) -- 0:00:39
338500 -- (-372.711) [-373.166] (-375.781) (-373.693) * (-372.610) (-371.275) (-375.413) [-380.684] -- 0:00:39
339000 -- (-371.967) (-372.207) [-372.550] (-376.044) * [-371.889] (-376.060) (-372.503) (-376.375) -- 0:00:38
339500 -- (-373.420) (-372.895) [-375.188] (-372.701) * (-373.322) (-378.493) (-374.030) [-372.694] -- 0:00:38
340000 -- (-374.910) (-377.225) [-374.791] (-371.821) * (-374.172) (-373.594) [-374.824] (-372.884) -- 0:00:38
Average standard deviation of split frequencies: 0.013607
340500 -- (-373.016) (-376.596) [-375.515] (-373.881) * (-374.619) (-374.883) (-374.099) [-374.107] -- 0:00:38
341000 -- (-374.891) (-378.384) [-373.588] (-371.481) * (-377.753) (-374.222) [-373.066] (-377.879) -- 0:00:38
341500 -- [-372.923] (-374.639) (-374.181) (-373.767) * (-371.931) (-372.402) (-376.562) [-374.921] -- 0:00:38
342000 -- (-372.501) (-373.720) [-372.282] (-373.423) * (-372.966) (-372.772) [-372.420] (-374.141) -- 0:00:38
342500 -- (-371.740) (-371.774) [-374.688] (-372.858) * (-371.555) (-376.331) (-372.570) [-375.665] -- 0:00:38
343000 -- (-373.058) (-373.313) [-373.696] (-373.433) * [-375.432] (-374.138) (-374.235) (-378.226) -- 0:00:38
343500 -- (-373.835) [-373.025] (-373.011) (-373.743) * (-373.144) [-372.679] (-374.947) (-374.780) -- 0:00:38
344000 -- (-376.000) (-373.083) [-373.332] (-372.482) * [-373.720] (-371.770) (-373.928) (-373.221) -- 0:00:38
344500 -- (-376.004) (-372.078) (-372.705) [-374.706] * (-373.141) [-374.527] (-373.571) (-373.170) -- 0:00:38
345000 -- [-374.989] (-371.890) (-371.918) (-374.861) * (-373.837) (-373.291) [-372.969] (-374.367) -- 0:00:37
Average standard deviation of split frequencies: 0.012867
345500 -- (-373.780) [-377.252] (-373.652) (-372.216) * (-376.781) (-371.805) [-372.489] (-373.951) -- 0:00:37
346000 -- (-376.225) (-372.604) [-372.925] (-373.773) * [-373.044] (-372.862) (-373.263) (-372.961) -- 0:00:37
346500 -- [-373.341] (-372.205) (-372.048) (-373.576) * (-372.927) [-376.256] (-372.184) (-373.759) -- 0:00:39
347000 -- (-377.379) [-374.048] (-373.077) (-377.091) * [-372.387] (-372.756) (-372.666) (-374.339) -- 0:00:39
347500 -- (-372.653) [-373.512] (-374.917) (-374.712) * (-372.600) (-372.696) [-372.795] (-373.768) -- 0:00:39
348000 -- (-373.898) (-373.742) [-374.199] (-376.210) * (-373.404) (-371.488) [-371.487] (-375.105) -- 0:00:39
348500 -- (-372.544) (-374.134) (-372.584) [-372.668] * (-372.230) (-372.437) [-371.574] (-374.341) -- 0:00:39
349000 -- [-371.962] (-378.020) (-374.138) (-373.552) * (-373.073) (-376.081) (-374.224) [-373.778] -- 0:00:39
349500 -- [-374.771] (-376.236) (-377.764) (-372.492) * (-373.089) (-374.599) (-379.008) [-372.532] -- 0:00:39
350000 -- (-372.222) [-371.763] (-371.779) (-373.970) * (-375.574) (-373.181) [-376.342] (-371.773) -- 0:00:39
Average standard deviation of split frequencies: 0.014009
350500 -- [-371.527] (-373.691) (-372.227) (-372.985) * (-373.344) (-373.158) (-372.058) [-371.491] -- 0:00:38
351000 -- (-372.127) (-374.628) (-372.445) [-372.769] * (-371.835) (-374.633) [-372.836] (-377.171) -- 0:00:38
351500 -- [-371.851] (-372.165) (-374.710) (-372.834) * (-371.393) (-374.109) (-377.693) [-372.390] -- 0:00:38
352000 -- (-371.514) (-372.320) (-373.319) [-372.836] * [-372.043] (-373.598) (-373.089) (-374.676) -- 0:00:38
352500 -- [-372.944] (-373.116) (-371.954) (-373.287) * [-371.939] (-373.929) (-372.704) (-377.922) -- 0:00:38
353000 -- (-374.842) (-373.241) (-374.501) [-373.262] * [-372.874] (-380.037) (-374.998) (-373.796) -- 0:00:38
353500 -- (-372.590) [-373.704] (-378.986) (-374.842) * (-374.417) [-373.493] (-373.294) (-371.861) -- 0:00:38
354000 -- (-373.916) (-376.091) [-372.919] (-374.312) * [-372.736] (-376.478) (-373.317) (-372.699) -- 0:00:38
354500 -- [-374.483] (-374.605) (-372.031) (-373.443) * [-372.921] (-374.120) (-374.481) (-372.705) -- 0:00:38
355000 -- [-374.400] (-374.612) (-373.309) (-372.763) * (-373.090) (-377.151) [-372.683] (-373.748) -- 0:00:38
Average standard deviation of split frequencies: 0.014426
355500 -- (-373.049) (-379.985) (-372.734) [-374.965] * (-379.770) (-374.996) [-373.798] (-375.514) -- 0:00:38
356000 -- [-375.937] (-375.082) (-371.956) (-374.569) * (-375.641) (-376.676) (-373.841) [-374.880] -- 0:00:37
356500 -- (-376.541) (-379.245) [-373.904] (-376.945) * (-372.214) (-374.153) [-372.880] (-375.282) -- 0:00:37
357000 -- (-374.534) (-375.728) (-373.971) [-375.159] * (-373.504) [-372.255] (-373.164) (-374.520) -- 0:00:37
357500 -- [-372.785] (-374.571) (-372.840) (-377.826) * (-373.654) (-372.093) [-373.150] (-372.927) -- 0:00:37
358000 -- (-373.120) (-371.988) (-373.834) [-371.411] * (-372.726) [-374.835] (-373.659) (-371.756) -- 0:00:37
358500 -- (-371.956) (-378.128) [-376.878] (-373.494) * (-375.381) (-373.374) (-372.084) [-372.048] -- 0:00:37
359000 -- (-373.597) [-371.390] (-374.672) (-375.261) * [-374.939] (-377.849) (-375.760) (-372.083) -- 0:00:37
359500 -- [-371.504] (-375.643) (-375.293) (-373.386) * (-376.819) (-373.565) [-374.180] (-372.086) -- 0:00:37
360000 -- (-373.498) [-373.489] (-374.181) (-372.572) * (-374.560) (-372.663) [-372.132] (-375.308) -- 0:00:37
Average standard deviation of split frequencies: 0.014305
360500 -- (-373.475) (-375.100) [-374.541] (-372.085) * (-375.042) (-374.277) (-375.189) [-372.583] -- 0:00:37
361000 -- (-377.623) (-375.411) [-375.752] (-374.721) * (-373.980) (-373.501) [-371.487] (-375.250) -- 0:00:37
361500 -- (-377.303) (-373.939) (-373.432) [-373.523] * [-372.823] (-372.581) (-372.253) (-374.987) -- 0:00:37
362000 -- (-375.641) (-372.834) (-373.913) [-375.313] * [-372.033] (-374.574) (-373.322) (-372.264) -- 0:00:37
362500 -- (-374.970) (-373.709) (-371.663) [-374.657] * (-373.057) [-375.437] (-374.926) (-371.591) -- 0:00:36
363000 -- (-374.106) (-372.166) (-380.733) [-373.909] * [-373.753] (-374.704) (-372.065) (-372.975) -- 0:00:36
363500 -- (-373.027) (-371.581) (-377.866) [-372.042] * (-376.005) [-374.368] (-374.279) (-372.740) -- 0:00:36
364000 -- (-373.614) (-371.576) (-371.868) [-372.666] * (-373.020) (-375.061) (-372.839) [-371.897] -- 0:00:38
364500 -- (-372.814) (-373.078) [-371.647] (-372.485) * [-372.182] (-375.511) (-375.277) (-373.115) -- 0:00:38
365000 -- (-374.816) [-373.007] (-372.695) (-372.782) * [-373.483] (-375.436) (-377.342) (-376.512) -- 0:00:38
Average standard deviation of split frequencies: 0.013739
365500 -- (-374.454) (-373.161) [-373.005] (-373.414) * (-373.912) (-373.924) (-371.878) [-375.285] -- 0:00:38
366000 -- [-373.002] (-374.851) (-373.170) (-372.715) * (-371.862) (-374.292) (-375.082) [-374.457] -- 0:00:38
366500 -- (-379.087) (-380.330) [-373.939] (-372.621) * (-373.835) (-373.941) [-373.277] (-373.025) -- 0:00:38
367000 -- (-375.514) (-376.356) [-378.880] (-375.309) * (-374.392) (-373.025) (-374.279) [-372.981] -- 0:00:37
367500 -- (-372.853) (-372.739) (-374.032) [-374.126] * [-372.046] (-374.595) (-373.805) (-375.129) -- 0:00:37
368000 -- [-373.852] (-372.061) (-374.519) (-373.688) * (-372.084) (-372.210) [-373.564] (-373.341) -- 0:00:37
368500 -- (-372.950) [-376.299] (-373.403) (-375.108) * (-372.290) (-372.632) (-371.981) [-374.502] -- 0:00:37
369000 -- [-376.356] (-374.987) (-375.637) (-373.673) * (-372.539) (-372.417) [-371.500] (-372.462) -- 0:00:37
369500 -- (-372.445) [-374.634] (-372.669) (-375.597) * (-373.713) (-372.913) [-371.265] (-372.535) -- 0:00:37
370000 -- [-376.110] (-372.922) (-372.480) (-374.588) * (-371.961) (-372.925) [-372.622] (-372.493) -- 0:00:37
Average standard deviation of split frequencies: 0.013454
370500 -- [-372.348] (-372.688) (-373.333) (-372.111) * (-373.647) (-372.079) [-372.104] (-375.260) -- 0:00:37
371000 -- [-372.837] (-372.339) (-372.409) (-373.169) * [-375.161] (-373.661) (-372.507) (-374.514) -- 0:00:37
371500 -- (-372.116) [-371.559] (-375.450) (-373.913) * (-373.943) (-376.197) [-371.800] (-371.883) -- 0:00:37
372000 -- [-373.954] (-372.739) (-372.990) (-373.709) * (-374.964) (-375.365) (-372.584) [-377.567] -- 0:00:37
372500 -- (-377.468) [-373.335] (-374.006) (-373.646) * (-371.890) [-371.375] (-372.845) (-379.373) -- 0:00:37
373000 -- (-371.896) (-377.707) (-374.685) [-373.642] * (-372.968) (-372.072) [-371.635] (-377.343) -- 0:00:36
373500 -- [-373.409] (-372.511) (-373.772) (-372.525) * (-374.530) (-374.194) (-373.249) [-373.205] -- 0:00:36
374000 -- (-372.236) (-374.698) [-371.505] (-373.161) * (-373.773) (-373.533) (-372.400) [-371.842] -- 0:00:36
374500 -- (-371.538) (-375.874) [-373.332] (-375.629) * [-373.692] (-373.058) (-373.080) (-372.694) -- 0:00:36
375000 -- (-373.161) (-377.299) (-374.782) [-373.395] * [-372.397] (-372.806) (-372.230) (-374.930) -- 0:00:36
Average standard deviation of split frequencies: 0.013659
375500 -- (-372.194) (-376.890) (-375.126) [-375.901] * (-373.124) (-374.374) (-374.457) [-375.069] -- 0:00:36
376000 -- (-375.570) (-375.537) [-375.764] (-373.737) * [-373.457] (-375.886) (-372.774) (-375.063) -- 0:00:36
376500 -- (-374.519) (-373.297) (-373.722) [-371.940] * [-373.340] (-374.544) (-375.774) (-376.515) -- 0:00:36
377000 -- (-372.121) (-375.225) (-374.648) [-372.360] * (-374.608) [-374.051] (-374.292) (-372.097) -- 0:00:36
377500 -- (-375.234) (-373.884) (-371.520) [-374.034] * (-374.566) [-376.726] (-376.288) (-372.451) -- 0:00:36
378000 -- (-372.892) [-374.342] (-372.076) (-372.515) * (-373.936) (-372.605) (-375.663) [-372.806] -- 0:00:36
378500 -- [-372.031] (-376.254) (-371.706) (-374.090) * (-373.599) (-374.159) (-377.376) [-373.120] -- 0:00:36
379000 -- (-375.144) [-371.601] (-371.566) (-377.143) * (-373.898) (-373.670) [-372.425] (-374.280) -- 0:00:36
379500 -- [-373.386] (-372.258) (-371.924) (-375.740) * (-374.023) [-372.639] (-377.639) (-377.538) -- 0:00:35
380000 -- (-373.720) (-373.424) [-371.856] (-378.507) * (-378.035) (-374.552) [-372.366] (-371.860) -- 0:00:35
Average standard deviation of split frequencies: 0.013948
380500 -- (-373.245) (-374.671) (-372.000) [-374.755] * [-371.588] (-375.236) (-377.595) (-372.339) -- 0:00:35
381000 -- (-374.080) [-373.956] (-373.635) (-374.619) * [-371.921] (-375.169) (-376.254) (-374.778) -- 0:00:37
381500 -- [-374.471] (-376.512) (-379.604) (-371.649) * [-372.608] (-378.061) (-379.521) (-385.401) -- 0:00:37
382000 -- (-375.019) (-373.350) (-373.702) [-372.738] * (-374.531) (-375.986) (-373.685) [-373.756] -- 0:00:37
382500 -- (-378.190) (-373.111) [-375.041] (-373.364) * (-375.380) (-373.018) [-371.306] (-373.003) -- 0:00:37
383000 -- (-373.095) (-379.808) [-372.938] (-373.080) * (-373.125) (-373.584) (-372.554) [-374.906] -- 0:00:37
383500 -- [-375.483] (-374.320) (-372.026) (-375.147) * [-371.857] (-372.337) (-373.824) (-371.328) -- 0:00:36
384000 -- (-374.640) (-375.920) [-372.079] (-372.545) * (-373.504) [-372.683] (-376.127) (-375.771) -- 0:00:36
384500 -- [-372.138] (-375.087) (-372.802) (-376.817) * (-376.827) (-374.877) [-374.410] (-373.150) -- 0:00:36
385000 -- (-372.249) [-372.916] (-374.325) (-374.629) * (-377.769) (-376.947) (-374.049) [-373.817] -- 0:00:36
Average standard deviation of split frequencies: 0.014334
385500 -- (-374.553) [-373.438] (-373.179) (-372.336) * (-374.990) [-375.938] (-374.969) (-373.852) -- 0:00:36
386000 -- [-372.831] (-373.538) (-371.735) (-376.684) * (-378.572) [-371.803] (-374.661) (-372.183) -- 0:00:36
386500 -- (-371.909) (-375.985) [-373.894] (-376.222) * (-374.590) [-373.302] (-372.415) (-372.818) -- 0:00:36
387000 -- (-372.602) (-375.541) [-373.263] (-372.322) * (-374.787) (-375.394) (-371.439) [-375.017] -- 0:00:36
387500 -- (-375.179) (-371.741) (-373.644) [-373.309] * (-375.135) (-375.568) [-371.515] (-372.187) -- 0:00:36
388000 -- [-377.037] (-373.626) (-375.112) (-373.581) * (-375.069) [-375.368] (-372.511) (-374.328) -- 0:00:36
388500 -- (-372.823) [-372.378] (-372.023) (-372.071) * (-379.035) (-373.457) [-372.751] (-374.985) -- 0:00:36
389000 -- (-373.694) (-376.833) (-372.589) [-373.168] * (-377.485) (-374.849) (-372.901) [-371.796] -- 0:00:36
389500 -- (-379.724) (-373.273) [-373.144] (-371.666) * (-375.177) (-374.080) [-374.710] (-372.449) -- 0:00:36
390000 -- (-372.156) [-373.816] (-372.067) (-377.555) * [-375.508] (-376.599) (-373.023) (-375.202) -- 0:00:35
Average standard deviation of split frequencies: 0.013609
390500 -- [-371.983] (-373.246) (-376.008) (-382.410) * (-376.866) (-374.012) [-372.274] (-373.656) -- 0:00:35
391000 -- [-372.593] (-373.135) (-376.811) (-373.692) * (-372.411) (-373.671) (-371.707) [-372.101] -- 0:00:35
391500 -- [-373.213] (-376.736) (-373.026) (-372.193) * (-375.036) (-381.251) (-373.780) [-373.791] -- 0:00:35
392000 -- (-374.238) [-372.334] (-372.615) (-376.784) * (-373.676) (-376.628) [-374.453] (-372.756) -- 0:00:35
392500 -- (-375.378) (-374.026) (-372.239) [-375.357] * [-373.533] (-375.057) (-373.461) (-372.652) -- 0:00:35
393000 -- (-375.613) (-376.967) [-372.780] (-373.285) * (-375.387) (-375.954) [-375.051] (-375.317) -- 0:00:35
393500 -- (-372.480) (-374.818) [-373.741] (-372.181) * (-373.590) [-375.620] (-374.510) (-375.960) -- 0:00:35
394000 -- [-374.932] (-375.801) (-372.051) (-372.917) * [-375.127] (-373.444) (-372.090) (-374.615) -- 0:00:35
394500 -- (-372.105) (-375.766) (-372.800) [-372.824] * (-372.172) [-373.840] (-373.612) (-374.881) -- 0:00:35
395000 -- [-374.014] (-373.295) (-374.550) (-375.910) * (-371.956) (-372.042) [-375.415] (-375.905) -- 0:00:35
Average standard deviation of split frequencies: 0.013293
395500 -- (-377.267) (-376.271) (-375.637) [-375.045] * (-372.843) (-371.525) [-374.716] (-374.886) -- 0:00:35
396000 -- (-373.960) (-379.144) [-375.289] (-373.740) * (-372.123) [-371.882] (-375.580) (-373.762) -- 0:00:35
396500 -- [-374.129] (-374.650) (-373.248) (-372.833) * (-373.475) (-373.108) [-372.526] (-376.035) -- 0:00:35
397000 -- [-372.833] (-371.862) (-373.196) (-373.405) * (-373.113) [-372.495] (-374.847) (-378.636) -- 0:00:34
397500 -- [-371.963] (-374.743) (-372.807) (-374.174) * (-376.894) [-373.215] (-373.897) (-372.431) -- 0:00:36
398000 -- (-372.492) [-372.448] (-373.668) (-374.974) * (-377.451) [-372.239] (-375.026) (-373.566) -- 0:00:36
398500 -- [-371.694] (-377.967) (-371.729) (-372.375) * (-375.319) [-378.111] (-374.187) (-375.143) -- 0:00:36
399000 -- (-373.035) (-377.002) [-374.149] (-372.518) * (-372.632) (-376.420) [-374.434] (-371.584) -- 0:00:36
399500 -- [-372.441] (-372.843) (-372.371) (-372.987) * (-374.838) (-372.555) (-373.843) [-371.859] -- 0:00:36
400000 -- (-376.630) [-371.695] (-374.459) (-374.115) * (-376.092) (-372.042) [-374.164] (-376.637) -- 0:00:36
Average standard deviation of split frequencies: 0.012804
400500 -- [-373.665] (-374.152) (-376.691) (-371.357) * (-375.539) (-372.335) [-375.827] (-376.133) -- 0:00:35
401000 -- (-371.647) [-373.399] (-373.903) (-377.244) * (-377.460) [-372.573] (-372.902) (-372.815) -- 0:00:35
401500 -- (-372.805) [-372.558] (-375.034) (-374.376) * (-372.499) (-373.598) [-371.880] (-373.760) -- 0:00:35
402000 -- (-374.101) (-371.227) (-375.517) [-372.822] * [-373.308] (-376.575) (-374.028) (-372.971) -- 0:00:35
402500 -- [-375.744] (-373.551) (-371.378) (-374.416) * (-374.059) (-374.931) [-371.535] (-372.596) -- 0:00:35
403000 -- (-375.456) (-373.202) (-376.353) [-375.162] * [-372.853] (-373.694) (-375.409) (-374.244) -- 0:00:35
403500 -- [-371.649] (-375.727) (-372.616) (-373.048) * (-377.443) [-373.826] (-373.193) (-371.898) -- 0:00:35
404000 -- [-372.830] (-372.548) (-374.904) (-373.377) * (-371.655) [-372.024] (-371.982) (-373.547) -- 0:00:35
404500 -- [-372.566] (-377.191) (-372.077) (-375.010) * (-373.232) (-371.626) [-372.692] (-373.065) -- 0:00:35
405000 -- (-372.430) [-372.503] (-372.019) (-376.865) * (-371.975) (-371.605) (-374.477) [-374.981] -- 0:00:35
Average standard deviation of split frequencies: 0.013288
405500 -- (-374.578) (-374.806) [-374.737] (-371.783) * (-372.205) (-374.286) (-373.551) [-372.688] -- 0:00:35
406000 -- (-372.868) (-373.250) [-372.446] (-372.300) * (-372.180) [-375.149] (-374.591) (-373.654) -- 0:00:35
406500 -- (-373.816) (-376.004) (-373.792) [-375.924] * (-373.995) [-375.798] (-372.636) (-373.023) -- 0:00:35
407000 -- (-372.752) [-376.388] (-377.129) (-372.598) * (-372.135) [-373.322] (-375.916) (-376.595) -- 0:00:34
407500 -- (-373.707) (-377.236) (-376.722) [-371.846] * [-374.279] (-373.215) (-376.608) (-374.178) -- 0:00:34
408000 -- (-374.029) (-371.566) (-373.133) [-371.894] * [-372.665] (-373.201) (-372.808) (-372.555) -- 0:00:34
408500 -- (-374.411) (-372.667) [-374.407] (-373.463) * (-371.935) (-372.933) (-374.767) [-374.293] -- 0:00:34
409000 -- (-375.603) (-373.398) [-373.113] (-372.643) * (-375.742) (-372.565) (-376.868) [-373.610] -- 0:00:34
409500 -- (-375.250) (-372.431) (-372.966) [-374.599] * (-372.297) (-373.085) (-372.769) [-375.872] -- 0:00:34
410000 -- (-373.461) (-374.472) [-373.003] (-373.652) * (-372.502) (-371.532) [-376.304] (-374.193) -- 0:00:34
Average standard deviation of split frequencies: 0.012882
410500 -- (-373.216) [-372.160] (-374.412) (-377.551) * (-375.108) [-373.797] (-374.955) (-372.168) -- 0:00:34
411000 -- (-372.192) [-375.437] (-377.964) (-376.142) * (-371.895) [-373.145] (-373.631) (-371.877) -- 0:00:34
411500 -- (-375.609) [-372.521] (-371.824) (-376.056) * [-371.682] (-377.741) (-374.605) (-375.253) -- 0:00:34
412000 -- [-376.783] (-373.508) (-377.573) (-373.062) * [-371.489] (-376.398) (-375.245) (-372.567) -- 0:00:34
412500 -- (-375.838) (-373.409) (-376.229) [-372.263] * (-373.734) (-374.128) (-372.880) [-372.072] -- 0:00:34
413000 -- (-371.868) (-372.654) (-373.577) [-372.057] * (-372.235) [-373.097] (-373.225) (-372.273) -- 0:00:34
413500 -- [-374.498] (-372.747) (-376.534) (-372.371) * (-373.163) (-372.213) [-373.836] (-377.040) -- 0:00:34
414000 -- (-373.937) (-373.240) (-371.763) [-373.621] * [-372.430] (-372.108) (-371.677) (-372.275) -- 0:00:33
414500 -- [-374.261] (-376.555) (-374.382) (-374.770) * (-375.007) (-377.376) [-372.686] (-371.974) -- 0:00:35
415000 -- (-373.370) (-375.023) (-376.007) [-371.984] * (-372.924) [-371.951] (-374.211) (-374.734) -- 0:00:35
Average standard deviation of split frequencies: 0.012906
415500 -- (-373.514) (-374.282) [-374.909] (-373.419) * (-373.317) (-380.311) [-372.395] (-374.961) -- 0:00:35
416000 -- (-374.400) [-373.478] (-375.072) (-375.580) * (-372.493) [-375.761] (-377.392) (-373.816) -- 0:00:35
416500 -- (-372.087) [-372.477] (-376.082) (-371.906) * [-374.337] (-375.289) (-371.728) (-371.863) -- 0:00:35
417000 -- (-371.564) [-374.314] (-373.981) (-372.060) * (-376.463) (-373.457) [-376.959] (-373.872) -- 0:00:34
417500 -- (-372.817) (-373.378) [-372.477] (-375.001) * (-375.398) [-374.899] (-378.438) (-375.145) -- 0:00:34
418000 -- (-372.287) (-371.734) (-374.509) [-371.493] * (-373.188) [-373.377] (-378.298) (-373.479) -- 0:00:34
418500 -- (-373.230) (-371.525) [-372.795] (-373.247) * (-372.332) [-374.301] (-377.540) (-376.630) -- 0:00:34
419000 -- (-372.929) [-373.978] (-372.551) (-371.170) * (-373.250) [-375.068] (-375.745) (-375.056) -- 0:00:34
419500 -- (-374.301) [-372.758] (-373.201) (-373.295) * (-374.681) (-374.626) [-371.743] (-372.502) -- 0:00:34
420000 -- (-373.066) (-374.773) (-373.199) [-373.383] * (-372.911) (-372.924) (-373.505) [-373.613] -- 0:00:34
Average standard deviation of split frequencies: 0.015029
420500 -- (-374.011) [-376.344] (-373.691) (-374.223) * (-371.703) (-373.713) [-371.576] (-373.635) -- 0:00:34
421000 -- (-372.787) [-373.927] (-373.154) (-374.481) * [-372.013] (-371.568) (-374.951) (-373.703) -- 0:00:34
421500 -- (-372.896) (-373.048) [-374.075] (-372.780) * (-371.808) [-374.487] (-374.605) (-373.928) -- 0:00:34
422000 -- [-371.692] (-373.429) (-373.167) (-373.211) * (-372.406) (-377.023) [-372.778] (-379.036) -- 0:00:34
422500 -- (-372.988) [-375.469] (-373.019) (-375.557) * (-375.798) [-372.411] (-373.620) (-373.493) -- 0:00:34
423000 -- (-373.171) (-377.848) (-375.103) [-373.907] * (-372.217) (-372.623) (-373.927) [-373.419] -- 0:00:34
423500 -- (-372.134) (-374.513) [-372.198] (-375.239) * (-372.554) (-376.263) (-374.854) [-371.483] -- 0:00:34
424000 -- [-372.268] (-380.064) (-374.319) (-374.629) * (-372.232) (-371.952) [-371.725] (-373.104) -- 0:00:33
424500 -- (-376.654) [-373.764] (-374.614) (-374.837) * (-373.603) (-379.190) [-376.182] (-373.236) -- 0:00:33
425000 -- (-373.006) (-373.809) (-373.377) [-373.561] * (-371.641) (-381.491) (-376.298) [-373.045] -- 0:00:33
Average standard deviation of split frequencies: 0.014631
425500 -- (-372.798) (-375.275) [-375.417] (-373.259) * [-371.539] (-374.873) (-379.046) (-374.245) -- 0:00:33
426000 -- (-373.886) (-377.430) (-373.307) [-374.135] * (-375.047) (-372.078) [-377.261] (-374.309) -- 0:00:33
426500 -- (-371.334) [-372.517] (-374.665) (-373.228) * (-371.439) [-373.285] (-374.944) (-371.913) -- 0:00:33
427000 -- (-371.298) [-371.639] (-372.877) (-374.204) * (-371.548) [-372.378] (-375.317) (-372.102) -- 0:00:33
427500 -- (-371.826) (-374.527) [-374.108] (-376.043) * [-374.713] (-372.829) (-375.942) (-373.343) -- 0:00:33
428000 -- (-373.277) (-372.984) [-372.752] (-375.967) * (-375.468) [-373.692] (-373.440) (-374.991) -- 0:00:33
428500 -- [-372.768] (-376.245) (-374.293) (-372.621) * (-371.977) (-377.456) [-374.682] (-374.282) -- 0:00:33
429000 -- (-374.034) (-372.690) (-374.305) [-373.404] * (-372.204) [-371.898] (-376.899) (-375.459) -- 0:00:33
429500 -- (-372.556) (-374.022) (-373.270) [-372.500] * [-372.089] (-373.583) (-373.735) (-372.415) -- 0:00:33
430000 -- [-372.405] (-373.707) (-377.874) (-374.128) * [-374.805] (-372.732) (-375.222) (-372.261) -- 0:00:33
Average standard deviation of split frequencies: 0.014294
430500 -- (-373.248) (-379.909) (-373.659) [-376.035] * [-372.914] (-372.964) (-374.960) (-372.243) -- 0:00:33
431000 -- (-372.815) (-373.840) (-373.197) [-372.060] * (-373.031) (-373.495) [-378.794] (-372.250) -- 0:00:34
431500 -- [-374.263] (-374.777) (-372.437) (-379.676) * (-372.286) (-372.494) (-374.214) [-372.852] -- 0:00:34
432000 -- (-389.774) [-375.395] (-374.522) (-373.952) * [-375.075] (-372.793) (-372.429) (-374.022) -- 0:00:34
432500 -- (-373.321) (-373.738) [-374.700] (-373.825) * (-375.848) (-372.344) [-373.121] (-372.674) -- 0:00:34
433000 -- (-377.571) [-372.133] (-373.350) (-373.897) * (-372.067) (-373.547) (-373.858) [-372.827] -- 0:00:34
433500 -- (-371.485) (-374.575) [-371.211] (-373.271) * (-371.503) (-375.334) [-372.825] (-373.211) -- 0:00:33
434000 -- [-374.227] (-377.226) (-373.049) (-371.942) * [-371.787] (-377.713) (-371.404) (-372.914) -- 0:00:33
434500 -- (-373.507) (-373.180) (-373.246) [-374.286] * (-371.553) (-375.901) (-373.599) [-373.519] -- 0:00:33
435000 -- (-375.032) [-374.510] (-373.257) (-375.990) * (-371.553) (-379.701) (-374.306) [-374.597] -- 0:00:33
Average standard deviation of split frequencies: 0.013996
435500 -- [-371.549] (-374.953) (-373.891) (-375.415) * (-371.679) (-374.602) (-373.191) [-374.412] -- 0:00:33
436000 -- (-371.949) (-374.269) [-373.509] (-373.346) * [-372.018] (-373.129) (-371.918) (-374.129) -- 0:00:33
436500 -- (-375.845) (-375.519) (-374.101) [-373.765] * [-372.331] (-373.620) (-372.909) (-376.878) -- 0:00:33
437000 -- (-375.526) (-376.895) (-372.275) [-375.030] * [-372.632] (-373.603) (-373.193) (-375.525) -- 0:00:33
437500 -- (-372.866) [-374.243] (-376.340) (-372.623) * [-376.644] (-373.541) (-378.978) (-374.019) -- 0:00:33
438000 -- (-372.937) (-372.521) [-372.225] (-374.448) * (-371.422) [-376.991] (-373.656) (-373.019) -- 0:00:33
438500 -- (-375.310) [-375.671] (-371.391) (-374.045) * [-374.651] (-376.577) (-373.365) (-371.780) -- 0:00:33
439000 -- (-372.949) (-374.078) (-371.506) [-374.804] * (-373.658) [-374.381] (-372.764) (-371.593) -- 0:00:33
439500 -- [-371.811] (-371.992) (-373.761) (-371.688) * (-372.927) (-374.108) [-374.549] (-372.193) -- 0:00:33
440000 -- [-371.876] (-373.247) (-372.684) (-373.975) * [-374.111] (-375.278) (-372.892) (-371.610) -- 0:00:33
Average standard deviation of split frequencies: 0.013844
440500 -- (-374.241) (-376.268) [-372.792] (-375.003) * (-373.353) (-373.449) (-373.866) [-373.025] -- 0:00:33
441000 -- (-373.270) [-376.120] (-372.727) (-377.077) * (-376.594) (-372.834) (-374.970) [-372.845] -- 0:00:32
441500 -- (-372.354) (-375.376) [-373.513] (-374.203) * (-372.673) (-372.626) [-376.547] (-372.533) -- 0:00:32
442000 -- (-372.685) (-375.579) (-372.600) [-375.319] * [-376.334] (-374.112) (-378.068) (-372.123) -- 0:00:32
442500 -- (-373.232) (-374.110) (-373.419) [-373.439] * (-375.806) (-375.928) [-380.388] (-373.714) -- 0:00:32
443000 -- (-373.058) (-374.779) [-372.634] (-375.831) * (-372.860) [-373.841] (-375.013) (-372.625) -- 0:00:32
443500 -- (-376.810) [-372.797] (-373.784) (-374.499) * (-374.403) (-371.329) (-371.475) [-373.307] -- 0:00:32
444000 -- (-375.266) (-372.122) [-375.325] (-374.066) * (-374.156) [-374.150] (-372.365) (-375.740) -- 0:00:32
444500 -- (-373.623) (-375.374) [-372.896] (-374.628) * (-376.949) [-373.333] (-373.775) (-378.494) -- 0:00:32
445000 -- (-376.522) (-372.709) (-375.433) [-374.915] * (-373.255) (-376.503) [-373.874] (-373.195) -- 0:00:32
Average standard deviation of split frequencies: 0.013927
445500 -- [-371.595] (-375.936) (-373.466) (-373.118) * (-373.921) [-376.183] (-371.969) (-373.300) -- 0:00:32
446000 -- (-376.593) (-373.680) (-373.114) [-373.928] * (-372.517) (-372.348) [-374.337] (-376.120) -- 0:00:32
446500 -- [-373.236] (-373.294) (-375.075) (-375.216) * (-371.540) (-373.822) (-374.431) [-372.706] -- 0:00:32
447000 -- (-373.510) (-373.156) [-373.383] (-374.618) * (-373.534) (-374.196) [-373.092] (-375.020) -- 0:00:32
447500 -- (-376.066) (-373.348) [-372.715] (-375.428) * [-374.952] (-374.966) (-373.993) (-371.417) -- 0:00:32
448000 -- (-373.368) (-377.979) [-372.804] (-372.808) * (-377.151) (-373.738) (-382.558) [-372.254] -- 0:00:33
448500 -- (-377.521) [-373.989] (-375.602) (-373.550) * (-373.261) (-376.437) (-376.476) [-371.764] -- 0:00:33
449000 -- (-374.397) [-372.596] (-373.939) (-373.053) * (-371.913) (-373.424) [-374.201] (-382.022) -- 0:00:33
449500 -- (-373.344) (-373.311) [-374.371] (-378.301) * (-372.685) (-374.113) (-373.152) [-374.635] -- 0:00:33
450000 -- (-372.437) (-379.287) [-374.894] (-375.512) * [-372.485] (-375.730) (-372.247) (-373.400) -- 0:00:33
Average standard deviation of split frequencies: 0.014237
450500 -- (-373.048) (-377.924) (-373.304) [-376.761] * (-374.664) (-377.264) [-373.494] (-372.161) -- 0:00:32
451000 -- (-376.074) [-371.849] (-373.915) (-373.614) * [-372.623] (-373.492) (-372.199) (-374.954) -- 0:00:32
451500 -- [-372.845] (-373.264) (-374.862) (-373.478) * (-372.400) [-375.019] (-373.531) (-373.190) -- 0:00:32
452000 -- (-372.727) (-377.303) (-375.293) [-372.919] * (-375.256) [-372.993] (-374.772) (-374.681) -- 0:00:32
452500 -- (-373.814) [-372.189] (-372.981) (-374.080) * (-375.109) [-371.905] (-372.391) (-375.038) -- 0:00:32
453000 -- [-373.414] (-374.166) (-372.629) (-376.772) * (-373.709) (-372.396) (-375.221) [-372.513] -- 0:00:32
453500 -- (-372.664) (-376.934) (-371.694) [-371.583] * (-372.766) (-374.188) [-371.952] (-373.979) -- 0:00:32
454000 -- [-373.726] (-375.429) (-376.533) (-373.799) * (-374.958) (-373.986) (-372.117) [-373.427] -- 0:00:32
454500 -- (-374.974) (-375.074) [-373.891] (-378.913) * (-372.846) (-376.257) [-375.394] (-372.700) -- 0:00:32
455000 -- [-372.170] (-374.647) (-373.765) (-375.676) * (-373.003) (-372.912) [-373.752] (-372.573) -- 0:00:32
Average standard deviation of split frequencies: 0.013899
455500 -- [-372.815] (-375.223) (-373.223) (-373.498) * (-374.002) (-373.380) (-372.680) [-374.105] -- 0:00:32
456000 -- [-371.785] (-373.015) (-375.642) (-373.666) * [-373.248] (-374.203) (-371.703) (-375.907) -- 0:00:32
456500 -- [-374.191] (-374.589) (-379.817) (-376.332) * (-371.509) (-373.677) (-372.736) [-373.312] -- 0:00:32
457000 -- (-375.389) [-374.865] (-372.914) (-375.299) * (-374.880) [-372.826] (-375.559) (-373.196) -- 0:00:32
457500 -- [-372.546] (-373.829) (-374.075) (-373.733) * (-373.797) (-374.061) [-373.144] (-372.866) -- 0:00:32
458000 -- (-373.358) (-373.771) [-374.400] (-372.832) * (-374.590) (-374.958) [-373.728] (-374.534) -- 0:00:31
458500 -- (-373.784) (-376.331) [-373.173] (-374.170) * (-372.347) (-374.987) [-373.235] (-372.179) -- 0:00:31
459000 -- (-372.424) (-375.303) (-375.305) [-373.242] * [-374.691] (-372.391) (-376.168) (-375.386) -- 0:00:31
459500 -- [-373.328] (-373.491) (-372.498) (-372.051) * (-379.452) (-373.375) [-373.754] (-371.864) -- 0:00:31
460000 -- (-373.636) (-374.181) (-380.174) [-373.889] * (-373.475) [-371.582] (-372.174) (-372.546) -- 0:00:31
Average standard deviation of split frequencies: 0.013644
460500 -- (-374.638) (-375.485) [-378.073] (-374.440) * [-372.452] (-374.439) (-373.553) (-371.434) -- 0:00:31
461000 -- (-374.891) (-375.369) (-373.955) [-371.659] * (-374.442) [-374.454] (-375.250) (-373.164) -- 0:00:31
461500 -- (-372.718) [-374.210] (-371.764) (-376.558) * (-372.597) (-371.467) [-372.591] (-371.569) -- 0:00:31
462000 -- (-372.418) [-373.371] (-371.346) (-375.808) * (-371.346) (-374.329) (-374.258) [-372.300] -- 0:00:31
462500 -- (-371.983) (-375.761) [-371.974] (-377.486) * (-375.224) (-381.512) [-374.153] (-373.501) -- 0:00:31
463000 -- (-372.141) (-375.496) [-371.786] (-372.814) * (-373.914) (-375.678) [-374.035] (-373.732) -- 0:00:31
463500 -- [-372.270] (-374.095) (-373.701) (-374.856) * (-374.045) (-375.441) (-372.997) [-374.241] -- 0:00:31
464000 -- (-376.253) [-372.745] (-373.945) (-373.007) * [-373.259] (-372.488) (-374.295) (-374.987) -- 0:00:31
464500 -- (-375.103) [-372.082] (-375.159) (-375.821) * (-371.757) [-372.490] (-372.283) (-376.333) -- 0:00:31
465000 -- (-374.722) (-372.189) (-373.309) [-377.570] * (-373.119) [-372.185] (-374.094) (-373.162) -- 0:00:32
Average standard deviation of split frequencies: 0.013544
465500 -- (-375.215) [-376.569] (-372.485) (-377.455) * [-373.575] (-372.356) (-372.573) (-372.187) -- 0:00:32
466000 -- (-372.701) (-374.443) (-373.328) [-372.595] * (-375.317) (-371.748) (-374.508) [-373.287] -- 0:00:32
466500 -- (-374.675) (-374.345) (-371.803) [-371.856] * [-373.803] (-376.441) (-373.983) (-375.477) -- 0:00:32
467000 -- (-377.162) (-375.549) [-371.340] (-377.817) * [-374.682] (-374.320) (-373.219) (-374.594) -- 0:00:31
467500 -- [-374.072] (-373.998) (-374.630) (-377.037) * [-371.981] (-375.639) (-374.606) (-375.967) -- 0:00:31
468000 -- (-374.533) [-373.235] (-373.045) (-373.577) * (-374.574) (-379.246) [-376.819] (-375.391) -- 0:00:31
468500 -- [-374.536] (-373.812) (-379.326) (-372.548) * (-373.964) (-373.461) [-375.044] (-376.214) -- 0:00:31
469000 -- (-376.907) [-372.451] (-373.750) (-372.904) * (-374.169) (-372.480) [-375.449] (-374.356) -- 0:00:31
469500 -- (-374.578) (-372.955) (-373.767) [-373.992] * (-373.829) (-371.827) (-376.926) [-372.669] -- 0:00:31
470000 -- (-374.777) (-379.412) (-373.136) [-373.642] * (-373.054) (-372.029) [-371.790] (-372.231) -- 0:00:31
Average standard deviation of split frequencies: 0.013243
470500 -- [-375.820] (-372.429) (-372.292) (-373.334) * (-373.424) [-372.402] (-373.446) (-372.261) -- 0:00:31
471000 -- (-372.408) [-372.399] (-374.502) (-372.996) * (-374.455) [-373.661] (-373.163) (-372.538) -- 0:00:31
471500 -- [-372.436] (-375.203) (-376.408) (-372.704) * (-375.384) (-378.416) [-374.098] (-373.885) -- 0:00:31
472000 -- [-375.224] (-373.615) (-376.520) (-371.841) * [-372.449] (-375.156) (-371.516) (-377.819) -- 0:00:31
472500 -- (-374.561) (-377.581) (-376.004) [-371.666] * (-372.987) (-373.453) (-373.850) [-376.990] -- 0:00:31
473000 -- (-372.443) (-373.481) (-371.425) [-372.697] * (-373.753) (-372.265) [-378.364] (-372.319) -- 0:00:31
473500 -- [-373.490] (-375.847) (-372.826) (-374.274) * (-371.771) (-372.154) (-374.037) [-373.295] -- 0:00:31
474000 -- (-374.603) (-374.542) [-374.273] (-374.488) * [-371.655] (-375.318) (-372.626) (-371.674) -- 0:00:31
474500 -- (-372.872) [-374.036] (-372.087) (-373.266) * (-373.435) (-378.110) (-378.498) [-374.009] -- 0:00:31
475000 -- (-374.512) (-377.038) [-372.987] (-372.892) * (-372.518) (-377.203) (-373.060) [-374.945] -- 0:00:30
Average standard deviation of split frequencies: 0.013049
475500 -- [-374.839] (-373.654) (-374.542) (-376.293) * (-373.785) (-375.126) (-371.560) [-372.933] -- 0:00:30
476000 -- (-373.494) (-372.970) (-372.832) [-373.432] * (-372.691) (-372.017) (-373.049) [-372.354] -- 0:00:30
476500 -- (-374.341) [-375.319] (-371.968) (-372.325) * (-374.874) (-375.439) [-372.078] (-371.896) -- 0:00:30
477000 -- [-373.447] (-373.683) (-376.290) (-372.839) * (-373.297) [-372.286] (-374.063) (-375.916) -- 0:00:30
477500 -- (-374.935) [-371.831] (-374.563) (-371.771) * (-377.025) (-373.527) [-377.512] (-372.116) -- 0:00:30
478000 -- (-372.538) [-373.149] (-373.220) (-372.213) * (-374.169) (-374.094) (-372.615) [-373.482] -- 0:00:30
478500 -- (-373.291) (-372.545) [-373.740] (-373.095) * (-373.321) (-374.610) [-373.580] (-373.918) -- 0:00:30
479000 -- (-373.474) (-374.316) (-375.078) [-376.427] * (-371.974) (-372.684) (-374.197) [-372.567] -- 0:00:31
479500 -- (-372.250) (-371.706) [-372.961] (-373.190) * (-373.652) [-375.429] (-372.879) (-373.833) -- 0:00:31
480000 -- (-372.732) (-373.091) (-374.933) [-372.787] * (-372.134) [-373.272] (-371.742) (-371.899) -- 0:00:31
Average standard deviation of split frequencies: 0.013557
480500 -- (-376.264) (-373.903) (-377.920) [-372.543] * (-374.652) (-373.037) [-373.936] (-373.606) -- 0:00:31
481000 -- [-371.824] (-372.232) (-376.579) (-373.470) * (-375.758) (-372.216) (-374.375) [-373.297] -- 0:00:31
481500 -- (-372.068) (-375.583) (-377.777) [-379.748] * (-375.021) [-372.013] (-374.217) (-373.805) -- 0:00:31
482000 -- (-373.216) [-377.715] (-376.232) (-375.836) * (-374.495) (-373.297) [-375.887] (-373.604) -- 0:00:31
482500 -- [-372.844] (-373.283) (-372.225) (-374.152) * (-372.664) (-372.657) [-375.503] (-377.727) -- 0:00:31
483000 -- (-375.781) (-374.435) [-372.353] (-372.257) * (-374.292) [-372.468] (-375.304) (-373.654) -- 0:00:31
483500 -- (-374.127) [-373.848] (-374.320) (-372.626) * (-374.595) (-372.644) (-373.241) [-371.871] -- 0:00:30
484000 -- (-373.666) [-375.220] (-375.180) (-374.141) * [-372.423] (-374.709) (-374.573) (-374.137) -- 0:00:30
484500 -- (-374.695) (-377.559) [-377.140] (-374.318) * [-372.061] (-372.711) (-374.033) (-376.993) -- 0:00:30
485000 -- (-375.810) (-375.830) [-371.901] (-374.846) * (-376.193) (-372.092) [-375.648] (-374.023) -- 0:00:30
Average standard deviation of split frequencies: 0.013202
485500 -- (-372.384) (-375.475) [-373.139] (-374.731) * [-372.583] (-373.663) (-371.783) (-375.863) -- 0:00:30
486000 -- [-374.389] (-372.305) (-373.219) (-373.405) * (-372.513) [-373.720] (-378.312) (-375.598) -- 0:00:30
486500 -- [-371.533] (-374.594) (-372.888) (-373.066) * (-374.659) (-373.435) [-377.234] (-372.464) -- 0:00:30
487000 -- (-376.788) (-375.196) [-372.569] (-374.702) * (-372.411) (-372.823) (-375.327) [-372.311] -- 0:00:30
487500 -- (-374.663) (-374.132) [-372.571] (-373.880) * (-380.827) (-372.177) (-376.952) [-372.307] -- 0:00:30
488000 -- (-373.372) [-374.739] (-372.556) (-374.017) * (-375.175) (-372.847) (-374.161) [-372.857] -- 0:00:30
488500 -- (-372.907) [-375.414] (-373.057) (-375.388) * [-373.805] (-372.908) (-375.442) (-373.104) -- 0:00:30
489000 -- [-373.610] (-374.297) (-371.321) (-376.906) * (-373.956) (-371.708) (-374.002) [-372.968] -- 0:00:30
489500 -- (-376.152) (-372.683) (-374.691) [-375.434] * [-371.769] (-371.433) (-375.313) (-375.028) -- 0:00:30
490000 -- (-372.174) [-372.895] (-373.182) (-374.379) * (-373.648) [-375.093] (-378.185) (-374.698) -- 0:00:30
Average standard deviation of split frequencies: 0.012772
490500 -- (-372.026) (-373.104) (-372.360) [-372.553] * (-374.306) (-375.535) [-372.402] (-377.085) -- 0:00:30
491000 -- (-373.401) (-377.173) (-371.859) [-371.975] * (-378.870) [-374.044] (-375.225) (-376.006) -- 0:00:30
491500 -- (-372.560) (-374.011) (-374.095) [-372.162] * (-377.329) [-375.280] (-372.364) (-372.555) -- 0:00:30
492000 -- (-373.306) (-381.162) (-372.947) [-375.181] * (-376.212) (-376.219) (-372.697) [-371.720] -- 0:00:29
492500 -- [-373.157] (-380.280) (-371.766) (-379.009) * (-373.724) (-378.163) (-375.759) [-376.591] -- 0:00:29
493000 -- [-373.624] (-378.716) (-373.950) (-373.180) * (-372.356) (-371.963) (-374.266) [-373.090] -- 0:00:29
493500 -- (-372.793) (-371.831) (-375.364) [-373.453] * (-372.689) [-371.252] (-374.467) (-373.157) -- 0:00:29
494000 -- (-373.613) [-372.253] (-374.667) (-372.324) * [-373.577] (-375.034) (-373.325) (-375.453) -- 0:00:29
494500 -- (-375.953) [-373.217] (-372.465) (-373.585) * (-373.721) (-376.182) [-372.133] (-376.009) -- 0:00:30
495000 -- (-377.294) (-375.513) (-375.511) [-373.418] * (-375.948) [-373.122] (-373.109) (-377.261) -- 0:00:30
Average standard deviation of split frequencies: 0.012132
495500 -- [-371.504] (-375.237) (-371.723) (-374.368) * (-374.643) [-373.112] (-374.175) (-372.561) -- 0:00:30
496000 -- (-373.059) [-374.085] (-372.295) (-371.707) * (-375.903) (-371.991) [-372.534] (-372.291) -- 0:00:30
496500 -- [-374.700] (-375.501) (-373.846) (-374.526) * (-374.403) (-372.389) (-372.697) [-373.146] -- 0:00:30
497000 -- [-372.993] (-373.167) (-377.012) (-373.271) * (-372.846) [-374.140] (-372.356) (-372.763) -- 0:00:30
497500 -- (-372.469) [-375.295] (-375.950) (-374.156) * (-376.038) (-372.168) (-374.997) [-371.587] -- 0:00:30
498000 -- (-374.195) (-376.965) [-373.860] (-380.115) * (-372.995) [-371.815] (-372.772) (-371.431) -- 0:00:30
498500 -- (-373.261) [-373.166] (-375.932) (-376.468) * (-374.047) (-373.835) (-374.935) [-373.366] -- 0:00:30
499000 -- (-372.278) (-373.262) (-372.874) [-373.749] * [-371.826] (-378.936) (-372.188) (-379.799) -- 0:00:30
499500 -- (-374.583) [-371.852] (-375.207) (-375.751) * (-372.348) [-373.064] (-371.948) (-376.345) -- 0:00:30
500000 -- (-373.093) (-373.275) [-372.055] (-374.178) * (-371.490) (-372.055) [-372.932] (-379.322) -- 0:00:30
Average standard deviation of split frequencies: 0.012064
500500 -- (-372.314) (-375.096) [-371.598] (-373.083) * (-372.827) (-372.676) (-373.396) [-374.031] -- 0:00:29
501000 -- (-375.801) (-380.351) [-373.446] (-372.112) * (-375.992) (-376.166) (-374.403) [-377.949] -- 0:00:29
501500 -- (-372.307) (-376.223) [-371.549] (-377.667) * (-374.163) [-373.580] (-373.312) (-375.360) -- 0:00:29
502000 -- (-372.101) (-372.922) (-373.322) [-376.047] * [-376.674] (-372.147) (-373.427) (-377.324) -- 0:00:29
502500 -- (-373.352) (-371.849) (-376.271) [-371.891] * [-373.450] (-373.921) (-374.402) (-375.326) -- 0:00:29
503000 -- (-374.444) (-377.758) (-375.903) [-372.938] * (-372.787) (-374.216) (-372.477) [-377.111] -- 0:00:29
503500 -- (-372.142) [-372.390] (-373.864) (-374.313) * (-373.649) (-375.202) (-374.003) [-374.419] -- 0:00:29
504000 -- [-374.192] (-373.186) (-376.732) (-371.860) * (-372.531) (-374.421) (-374.414) [-374.141] -- 0:00:29
504500 -- (-375.687) [-371.588] (-373.103) (-372.481) * (-372.950) (-374.046) [-371.661] (-377.847) -- 0:00:29
505000 -- (-381.203) (-374.709) [-373.160] (-372.615) * (-373.078) [-375.923] (-375.913) (-375.769) -- 0:00:29
Average standard deviation of split frequencies: 0.012495
505500 -- (-372.503) (-374.371) (-375.978) [-376.491] * (-376.540) (-373.530) [-374.185] (-375.705) -- 0:00:29
506000 -- [-372.144] (-373.537) (-374.681) (-376.331) * (-371.799) [-373.930] (-377.833) (-373.746) -- 0:00:29
506500 -- (-373.598) (-372.755) (-373.339) [-373.596] * (-373.637) [-373.329] (-375.811) (-374.762) -- 0:00:29
507000 -- (-374.313) (-372.047) (-372.009) [-376.035] * (-375.470) (-374.246) (-375.651) [-372.011] -- 0:00:29
507500 -- [-374.066] (-371.692) (-373.134) (-374.134) * (-375.070) [-371.715] (-372.601) (-372.740) -- 0:00:29
508000 -- (-373.317) (-371.683) [-375.896] (-372.808) * (-375.528) (-375.381) [-374.232] (-374.204) -- 0:00:29
508500 -- (-371.879) (-376.217) (-372.242) [-375.432] * (-375.825) (-382.081) [-372.341] (-372.722) -- 0:00:28
509000 -- [-372.319] (-375.653) (-380.795) (-373.992) * [-371.783] (-381.593) (-373.051) (-374.104) -- 0:00:28
509500 -- (-374.637) (-378.423) (-374.007) [-376.437] * [-372.572] (-377.029) (-371.478) (-373.203) -- 0:00:28
510000 -- (-371.911) (-372.467) (-372.842) [-375.073] * (-372.394) (-372.735) (-372.645) [-372.448] -- 0:00:28
Average standard deviation of split frequencies: 0.012381
510500 -- [-374.231] (-372.370) (-374.684) (-373.806) * (-374.907) (-384.414) (-375.010) [-371.693] -- 0:00:28
511000 -- (-375.890) (-371.373) [-374.650] (-372.652) * (-376.615) (-374.300) [-374.094] (-372.142) -- 0:00:28
511500 -- (-374.033) (-375.222) (-373.119) [-375.098] * (-372.330) [-372.380] (-372.944) (-378.041) -- 0:00:29
512000 -- [-375.431] (-372.346) (-372.577) (-372.851) * (-372.766) (-372.475) (-374.684) [-379.996] -- 0:00:29
512500 -- (-374.097) [-374.201] (-372.586) (-373.274) * (-375.366) (-372.760) [-374.174] (-376.537) -- 0:00:29
513000 -- [-372.879] (-375.877) (-373.326) (-372.456) * [-374.138] (-371.608) (-376.889) (-374.093) -- 0:00:29
513500 -- (-371.327) [-374.475] (-374.833) (-375.439) * [-371.923] (-376.810) (-373.314) (-374.438) -- 0:00:29
514000 -- [-371.263] (-373.026) (-375.181) (-375.085) * (-371.578) (-375.054) [-378.786] (-373.559) -- 0:00:29
514500 -- [-373.422] (-372.237) (-372.055) (-383.039) * (-372.159) [-374.302] (-377.244) (-372.111) -- 0:00:29
515000 -- [-372.025] (-375.514) (-374.321) (-378.585) * (-372.281) (-377.353) [-373.741] (-375.424) -- 0:00:29
Average standard deviation of split frequencies: 0.012790
515500 -- (-375.092) (-372.688) [-373.142] (-373.971) * (-372.807) (-375.452) [-372.449] (-374.341) -- 0:00:29
516000 -- (-375.928) (-373.646) [-372.297] (-374.597) * [-377.206] (-373.910) (-374.792) (-376.526) -- 0:00:29
516500 -- (-372.638) (-373.655) (-374.553) [-371.551] * (-373.391) (-373.457) [-373.337] (-374.747) -- 0:00:29
517000 -- [-373.689] (-376.712) (-373.029) (-372.867) * (-374.766) (-372.434) [-373.280] (-373.977) -- 0:00:28
517500 -- (-372.140) (-374.607) [-374.270] (-371.713) * (-372.935) (-372.864) (-373.204) [-374.626] -- 0:00:28
518000 -- (-373.146) [-373.851] (-373.459) (-371.961) * (-374.286) (-372.606) (-374.082) [-372.540] -- 0:00:28
518500 -- (-375.579) (-375.245) (-374.192) [-372.288] * [-374.675] (-374.944) (-376.668) (-375.958) -- 0:00:28
519000 -- (-373.167) (-375.575) (-377.739) [-373.063] * (-371.767) (-372.845) [-371.605] (-371.516) -- 0:00:28
519500 -- (-373.203) (-373.713) (-374.894) [-371.903] * (-372.307) [-372.692] (-371.937) (-372.745) -- 0:00:28
520000 -- [-377.698] (-372.158) (-374.779) (-374.556) * (-373.792) (-375.034) [-371.967] (-376.665) -- 0:00:28
Average standard deviation of split frequencies: 0.012729
520500 -- (-375.184) (-373.600) [-375.283] (-372.789) * (-372.428) [-372.054] (-373.099) (-374.806) -- 0:00:28
521000 -- (-375.537) [-371.990] (-379.025) (-374.338) * (-371.801) [-374.083] (-375.111) (-375.027) -- 0:00:28
521500 -- (-375.972) [-372.884] (-374.330) (-372.902) * [-372.099] (-376.696) (-377.446) (-377.402) -- 0:00:28
522000 -- [-373.636] (-371.448) (-377.523) (-372.500) * (-373.400) [-372.044] (-372.055) (-386.963) -- 0:00:28
522500 -- (-374.690) (-371.445) (-372.393) [-375.823] * (-375.980) (-372.294) (-374.020) [-380.985] -- 0:00:28
523000 -- (-373.949) (-372.767) (-371.938) [-372.937] * (-373.137) [-372.716] (-374.793) (-376.437) -- 0:00:28
523500 -- (-373.875) (-374.366) (-375.530) [-372.021] * (-373.060) (-372.958) [-374.412] (-377.211) -- 0:00:28
524000 -- (-375.295) (-374.465) (-378.425) [-371.985] * [-377.995] (-373.523) (-375.778) (-376.491) -- 0:00:28
524500 -- [-373.721] (-373.396) (-373.841) (-372.463) * (-376.716) (-371.856) (-371.981) [-373.182] -- 0:00:28
525000 -- (-372.681) (-374.185) [-373.621] (-371.780) * (-372.417) [-374.221] (-372.142) (-373.304) -- 0:00:28
Average standard deviation of split frequencies: 0.012336
525500 -- (-374.343) [-372.758] (-372.230) (-380.281) * (-375.167) (-372.990) (-372.409) [-373.679] -- 0:00:27
526000 -- (-373.491) (-373.117) [-372.341] (-380.773) * (-372.324) (-374.200) (-373.309) [-373.376] -- 0:00:27
526500 -- (-373.468) (-372.190) (-372.250) [-376.553] * (-374.358) (-374.949) [-372.280] (-376.743) -- 0:00:27
527000 -- [-372.332] (-373.821) (-375.249) (-373.487) * [-371.955] (-376.208) (-375.646) (-372.292) -- 0:00:27
527500 -- (-374.064) (-372.985) (-376.392) [-372.544] * (-373.143) (-373.573) [-372.882] (-374.197) -- 0:00:27
528000 -- (-372.018) [-378.901] (-373.721) (-375.487) * (-377.723) (-377.900) [-371.851] (-373.057) -- 0:00:27
528500 -- (-375.499) (-372.769) [-372.593] (-374.288) * (-372.286) [-375.247] (-372.435) (-371.535) -- 0:00:28
529000 -- (-380.576) (-373.551) [-371.634] (-372.901) * (-372.623) [-372.562] (-372.937) (-373.967) -- 0:00:28
529500 -- (-378.172) (-375.230) (-371.345) [-372.615] * (-373.815) (-374.858) [-373.454] (-374.642) -- 0:00:28
530000 -- (-373.670) (-374.206) [-374.235] (-374.389) * [-373.736] (-375.782) (-372.926) (-373.874) -- 0:00:28
Average standard deviation of split frequencies: 0.012437
530500 -- (-373.563) (-375.076) [-372.230] (-372.384) * (-378.065) [-371.938] (-375.294) (-372.413) -- 0:00:28
531000 -- (-372.769) (-374.024) [-372.848] (-373.367) * (-375.512) [-373.124] (-373.216) (-372.637) -- 0:00:28
531500 -- (-374.297) [-372.386] (-372.412) (-373.610) * (-374.713) (-372.488) [-373.968] (-380.119) -- 0:00:28
532000 -- (-373.474) (-375.597) [-376.062] (-373.298) * [-373.700] (-373.277) (-373.821) (-374.845) -- 0:00:28
532500 -- (-372.805) (-375.659) [-373.812] (-373.971) * (-377.059) (-372.614) (-374.061) [-373.868] -- 0:00:28
533000 -- [-371.599] (-375.149) (-372.606) (-375.455) * (-374.472) [-374.664] (-375.125) (-374.221) -- 0:00:28
533500 -- [-373.273] (-373.345) (-375.191) (-375.415) * (-376.064) (-374.825) [-375.208] (-371.819) -- 0:00:27
534000 -- [-372.777] (-374.576) (-378.316) (-374.271) * (-373.498) (-373.496) [-375.649] (-372.277) -- 0:00:27
534500 -- (-373.872) [-372.428] (-373.100) (-374.951) * [-372.959] (-371.965) (-376.103) (-376.553) -- 0:00:27
535000 -- (-371.511) [-371.548] (-374.465) (-374.499) * (-372.684) (-372.041) (-374.540) [-373.623] -- 0:00:27
Average standard deviation of split frequencies: 0.012571
535500 -- [-371.468] (-372.090) (-374.410) (-374.086) * (-376.024) [-373.008] (-372.020) (-373.600) -- 0:00:27
536000 -- (-373.047) (-374.274) [-375.788] (-371.589) * [-374.363] (-377.552) (-376.175) (-372.511) -- 0:00:27
536500 -- (-372.014) [-375.837] (-371.960) (-371.518) * (-375.928) (-374.483) (-372.106) [-373.094] -- 0:00:27
537000 -- (-373.324) (-373.887) (-374.130) [-371.624] * (-377.415) (-374.771) (-374.004) [-373.742] -- 0:00:27
537500 -- (-372.572) (-371.508) [-373.342] (-372.294) * (-374.307) (-373.241) (-377.122) [-375.231] -- 0:00:27
538000 -- [-373.856] (-371.222) (-376.410) (-372.792) * (-375.776) (-375.636) [-371.961] (-373.138) -- 0:00:27
538500 -- (-372.388) (-373.126) [-379.686] (-373.442) * [-376.810] (-375.313) (-374.500) (-373.160) -- 0:00:27
539000 -- (-375.058) [-371.870] (-373.838) (-374.476) * (-372.230) [-374.184] (-374.423) (-373.371) -- 0:00:27
539500 -- (-375.386) (-372.858) (-372.044) [-373.974] * (-373.014) [-375.124] (-375.235) (-371.998) -- 0:00:27
540000 -- (-375.027) (-378.290) [-372.507] (-372.388) * [-372.116] (-375.033) (-373.753) (-372.682) -- 0:00:27
Average standard deviation of split frequencies: 0.012479
540500 -- [-374.032] (-377.048) (-372.418) (-374.374) * (-378.350) (-375.037) (-373.580) [-373.291] -- 0:00:27
541000 -- (-372.029) (-375.665) (-372.417) [-372.189] * (-380.146) [-373.859] (-372.860) (-375.097) -- 0:00:27
541500 -- (-375.558) (-374.664) [-372.829] (-375.778) * [-373.962] (-373.747) (-372.196) (-372.420) -- 0:00:27
542000 -- (-375.314) (-376.262) [-372.046] (-373.306) * (-373.788) (-373.071) (-374.666) [-375.735] -- 0:00:27
542500 -- [-371.362] (-374.784) (-374.658) (-376.331) * (-374.222) (-372.306) [-374.907] (-374.046) -- 0:00:26
543000 -- [-373.822] (-375.235) (-372.501) (-372.690) * (-372.571) (-372.652) [-373.507] (-374.901) -- 0:00:26
543500 -- (-376.137) (-373.597) (-376.909) [-373.258] * (-372.526) [-375.002] (-372.430) (-374.431) -- 0:00:26
544000 -- (-375.111) (-373.584) [-375.639] (-374.740) * (-371.573) (-372.599) (-372.550) [-372.541] -- 0:00:26
544500 -- [-373.275] (-372.846) (-374.571) (-375.684) * (-377.182) (-372.108) (-374.749) [-373.778] -- 0:00:26
545000 -- (-373.538) (-374.876) [-372.668] (-375.083) * [-374.564] (-373.049) (-375.320) (-375.437) -- 0:00:26
Average standard deviation of split frequencies: 0.011884
545500 -- (-373.407) (-372.075) [-372.372] (-371.854) * (-372.197) [-374.648] (-376.046) (-371.408) -- 0:00:27
546000 -- (-373.661) (-372.993) (-374.421) [-372.255] * (-373.006) [-374.751] (-372.870) (-373.502) -- 0:00:27
546500 -- [-377.294] (-373.028) (-373.754) (-372.071) * (-376.605) (-376.048) [-373.938] (-372.248) -- 0:00:27
547000 -- [-373.861] (-374.478) (-372.942) (-373.192) * (-372.919) [-376.599] (-376.521) (-374.068) -- 0:00:27
547500 -- (-372.072) (-376.971) (-372.979) [-373.766] * (-374.246) (-371.984) (-372.631) [-375.684] -- 0:00:27
548000 -- [-372.292] (-379.016) (-374.075) (-372.155) * (-374.386) [-373.963] (-377.413) (-371.918) -- 0:00:27
548500 -- (-375.368) [-372.454] (-371.971) (-374.678) * (-374.259) (-372.639) (-376.281) [-371.834] -- 0:00:27
549000 -- [-376.479] (-373.597) (-372.851) (-371.838) * (-375.364) (-372.957) (-373.851) [-373.817] -- 0:00:27
549500 -- (-375.179) (-373.713) [-372.342] (-372.730) * (-374.534) (-373.493) (-373.287) [-373.712] -- 0:00:27
550000 -- [-377.315] (-375.165) (-375.598) (-374.108) * (-374.260) [-373.412] (-375.304) (-373.815) -- 0:00:27
Average standard deviation of split frequencies: 0.011632
550500 -- [-377.709] (-372.632) (-374.072) (-376.707) * (-373.653) [-373.362] (-374.513) (-373.446) -- 0:00:26
551000 -- (-375.409) (-372.989) [-372.471] (-376.044) * (-376.251) (-372.190) [-373.644] (-373.525) -- 0:00:26
551500 -- [-377.519] (-372.416) (-375.401) (-378.316) * (-374.471) (-372.146) (-373.968) [-372.266] -- 0:00:26
552000 -- (-376.358) [-373.245] (-373.600) (-374.962) * (-374.689) [-371.931] (-373.735) (-377.519) -- 0:00:26
552500 -- (-372.527) (-373.968) [-374.428] (-372.857) * (-373.388) (-372.867) (-373.193) [-372.057] -- 0:00:26
553000 -- (-374.324) (-374.472) (-374.676) [-372.313] * (-372.670) (-371.728) (-372.813) [-373.259] -- 0:00:26
553500 -- (-371.947) (-374.553) (-383.932) [-372.195] * (-373.200) [-375.836] (-375.847) (-373.838) -- 0:00:26
554000 -- (-373.750) [-372.441] (-380.957) (-372.356) * (-371.909) (-375.686) [-374.742] (-372.918) -- 0:00:26
554500 -- (-372.003) (-372.917) (-372.447) [-371.790] * (-371.646) [-374.669] (-372.115) (-376.874) -- 0:00:26
555000 -- (-372.132) (-372.622) [-374.512] (-375.258) * (-373.280) (-375.502) (-372.662) [-376.727] -- 0:00:26
Average standard deviation of split frequencies: 0.011870
555500 -- (-373.364) [-371.915] (-373.839) (-381.005) * (-373.953) (-374.708) (-374.550) [-374.409] -- 0:00:26
556000 -- (-373.992) [-374.258] (-375.222) (-376.383) * (-372.927) [-374.807] (-376.091) (-376.756) -- 0:00:26
556500 -- (-372.729) (-371.934) [-374.733] (-374.418) * (-376.112) (-372.840) (-373.326) [-373.951] -- 0:00:26
557000 -- (-372.816) [-371.313] (-372.589) (-372.455) * (-371.753) [-373.295] (-371.689) (-371.441) -- 0:00:26
557500 -- (-380.538) [-373.397] (-372.555) (-371.825) * (-372.469) (-375.992) [-372.367] (-374.554) -- 0:00:26
558000 -- (-373.863) (-377.787) (-374.893) [-374.529] * (-372.535) [-373.209] (-371.706) (-376.545) -- 0:00:26
558500 -- (-374.429) (-376.291) (-373.893) [-378.909] * (-374.796) (-373.926) [-373.046] (-372.985) -- 0:00:26
559000 -- (-374.540) (-373.536) [-376.414] (-377.034) * (-371.431) (-375.726) [-373.910] (-373.696) -- 0:00:26
559500 -- (-374.690) (-373.367) [-372.695] (-372.377) * (-371.378) (-375.933) [-373.135] (-376.317) -- 0:00:25
560000 -- (-375.507) (-372.852) [-375.411] (-372.096) * (-371.809) (-377.188) [-372.343] (-376.262) -- 0:00:25
Average standard deviation of split frequencies: 0.011128
560500 -- (-377.220) [-372.872] (-373.209) (-374.443) * [-373.358] (-372.867) (-374.373) (-374.106) -- 0:00:25
561000 -- [-375.721] (-373.364) (-376.286) (-374.399) * (-371.936) (-373.734) [-371.775] (-375.451) -- 0:00:26
561500 -- (-373.454) (-373.739) (-372.411) [-372.906] * (-378.225) (-374.452) [-372.314] (-371.605) -- 0:00:26
562000 -- (-376.609) (-372.220) (-381.331) [-372.892] * (-372.242) (-376.103) [-373.072] (-371.755) -- 0:00:26
562500 -- [-374.178] (-372.508) (-378.983) (-376.739) * (-372.741) (-376.107) [-371.825] (-372.058) -- 0:00:26
563000 -- (-373.376) [-371.934] (-375.135) (-379.376) * (-371.550) (-372.175) (-372.257) [-379.363] -- 0:00:26
563500 -- (-376.210) (-373.250) [-372.299] (-378.732) * (-377.143) (-375.147) [-379.361] (-376.756) -- 0:00:26
564000 -- [-372.752] (-373.008) (-373.742) (-380.772) * (-374.842) [-372.099] (-378.434) (-377.522) -- 0:00:26
564500 -- (-372.528) (-373.490) [-371.663] (-379.316) * (-375.909) (-373.032) (-381.434) [-373.300] -- 0:00:26
565000 -- (-374.735) (-372.131) [-373.601] (-373.520) * (-374.243) (-373.389) [-375.134] (-378.473) -- 0:00:26
Average standard deviation of split frequencies: 0.011317
565500 -- (-376.229) (-371.651) [-375.798] (-374.879) * [-373.971] (-374.891) (-375.201) (-375.040) -- 0:00:26
566000 -- (-375.510) (-375.550) (-374.089) [-374.105] * [-376.743] (-372.743) (-374.153) (-375.188) -- 0:00:26
566500 -- (-372.769) [-373.924] (-373.807) (-372.267) * (-373.257) (-372.095) [-376.270] (-371.973) -- 0:00:26
567000 -- [-371.702] (-374.952) (-372.253) (-371.805) * (-374.485) [-373.879] (-373.662) (-374.481) -- 0:00:25
567500 -- [-373.303] (-375.031) (-374.767) (-378.924) * (-371.657) (-377.936) [-373.697] (-373.265) -- 0:00:25
568000 -- (-371.842) [-373.757] (-374.270) (-382.217) * (-372.708) (-372.578) [-373.799] (-372.634) -- 0:00:25
568500 -- (-378.133) [-372.382] (-376.554) (-375.039) * (-376.266) (-374.468) (-372.735) [-371.548] -- 0:00:25
569000 -- (-373.211) [-373.348] (-372.618) (-376.029) * [-378.459] (-377.415) (-375.929) (-373.464) -- 0:00:25
569500 -- (-373.581) [-372.243] (-371.960) (-373.118) * [-371.781] (-375.413) (-376.356) (-373.729) -- 0:00:25
570000 -- (-374.438) [-374.279] (-374.728) (-373.328) * (-374.485) [-372.508] (-373.250) (-372.199) -- 0:00:25
Average standard deviation of split frequencies: 0.011419
570500 -- (-373.369) [-376.269] (-375.058) (-374.441) * (-378.341) [-375.114] (-375.081) (-373.588) -- 0:00:25
571000 -- (-373.014) [-371.760] (-373.928) (-376.251) * (-373.633) (-375.672) (-372.596) [-372.940] -- 0:00:25
571500 -- (-373.001) (-373.836) (-373.117) [-374.614] * (-374.808) [-373.213] (-374.237) (-373.894) -- 0:00:25
572000 -- (-371.858) (-376.043) [-373.242] (-371.914) * [-378.069] (-371.744) (-374.394) (-371.811) -- 0:00:25
572500 -- (-374.480) (-373.514) [-372.402] (-373.325) * (-373.346) [-372.737] (-374.687) (-373.765) -- 0:00:25
573000 -- (-375.205) (-375.186) (-372.871) [-372.807] * (-373.499) (-372.139) [-373.847] (-374.584) -- 0:00:25
573500 -- [-372.785] (-376.688) (-372.480) (-372.336) * [-373.233] (-374.714) (-374.008) (-378.514) -- 0:00:25
574000 -- (-372.355) (-374.267) [-373.036] (-374.439) * (-373.179) [-371.780] (-372.696) (-378.489) -- 0:00:25
574500 -- (-374.777) [-373.444] (-373.829) (-372.344) * [-371.837] (-372.258) (-373.222) (-372.663) -- 0:00:25
575000 -- (-376.311) (-372.030) [-372.066] (-372.752) * [-374.118] (-373.387) (-375.871) (-372.446) -- 0:00:25
Average standard deviation of split frequencies: 0.011169
575500 -- (-372.647) (-372.318) (-373.928) [-373.128] * (-373.920) (-373.374) (-374.745) [-372.275] -- 0:00:25
576000 -- (-375.047) (-377.242) [-371.612] (-373.424) * [-373.451] (-373.201) (-372.721) (-373.903) -- 0:00:25
576500 -- (-376.078) [-372.701] (-372.962) (-374.810) * [-373.901] (-373.721) (-373.906) (-373.468) -- 0:00:24
577000 -- (-373.299) (-377.634) [-375.309] (-374.758) * (-373.532) (-373.128) (-376.152) [-371.909] -- 0:00:24
577500 -- (-374.301) [-373.183] (-376.636) (-373.447) * (-371.440) (-373.610) (-373.455) [-373.056] -- 0:00:24
578000 -- (-372.009) (-377.630) [-371.662] (-374.724) * (-371.970) (-372.728) (-375.301) [-373.873] -- 0:00:25
578500 -- [-373.189] (-379.044) (-372.689) (-373.880) * (-371.279) (-373.903) (-374.784) [-372.633] -- 0:00:25
579000 -- (-373.261) [-372.872] (-372.736) (-372.813) * (-371.656) (-375.257) (-372.412) [-374.766] -- 0:00:25
579500 -- [-373.447] (-373.173) (-372.876) (-374.269) * [-371.773] (-376.883) (-374.451) (-374.125) -- 0:00:25
580000 -- [-374.253] (-375.435) (-374.041) (-373.877) * (-374.766) [-374.076] (-371.820) (-373.925) -- 0:00:25
Average standard deviation of split frequencies: 0.010148
580500 -- (-372.237) (-371.984) (-373.753) [-371.842] * (-373.990) [-373.354] (-375.924) (-372.134) -- 0:00:25
581000 -- [-371.981] (-375.665) (-374.124) (-375.749) * (-375.107) (-371.343) (-374.906) [-373.133] -- 0:00:25
581500 -- (-374.153) (-373.335) (-373.663) [-373.030] * [-372.137] (-377.127) (-371.844) (-375.116) -- 0:00:25
582000 -- (-374.676) (-373.956) (-372.685) [-372.570] * [-373.475] (-378.659) (-371.936) (-376.634) -- 0:00:25
582500 -- (-374.648) (-375.993) (-373.402) [-374.997] * (-371.739) (-373.995) (-373.623) [-373.662] -- 0:00:25
583000 -- (-373.502) (-375.808) [-373.049] (-375.663) * (-374.368) (-372.896) [-377.238] (-373.447) -- 0:00:25
583500 -- [-371.424] (-371.560) (-374.154) (-376.180) * (-375.116) (-373.178) (-374.413) [-375.735] -- 0:00:24
584000 -- [-373.273] (-371.747) (-376.319) (-375.287) * (-374.844) (-373.619) [-372.308] (-373.155) -- 0:00:24
584500 -- [-371.864] (-375.459) (-373.733) (-375.274) * (-373.827) [-374.311] (-373.788) (-372.085) -- 0:00:24
585000 -- (-373.114) (-374.785) [-374.218] (-377.703) * (-376.636) (-372.571) (-376.318) [-371.377] -- 0:00:24
Average standard deviation of split frequencies: 0.010413
585500 -- (-373.220) [-374.767] (-373.624) (-371.887) * (-373.122) (-372.231) (-374.505) [-372.592] -- 0:00:24
586000 -- (-373.932) (-375.551) [-371.994] (-373.947) * [-374.010] (-373.265) (-373.882) (-373.710) -- 0:00:24
586500 -- (-373.467) (-373.657) [-374.342] (-377.241) * (-372.937) (-377.007) [-372.453] (-375.934) -- 0:00:24
587000 -- (-374.149) (-373.446) (-375.127) [-371.986] * [-372.910] (-374.250) (-375.678) (-372.617) -- 0:00:24
587500 -- (-373.887) [-373.961] (-375.135) (-371.970) * (-372.416) (-373.082) [-372.129] (-372.223) -- 0:00:24
588000 -- (-372.896) (-372.152) (-373.782) [-372.477] * (-372.382) [-374.173] (-371.462) (-372.891) -- 0:00:24
588500 -- [-375.714] (-377.135) (-373.106) (-372.558) * (-373.575) [-374.533] (-371.313) (-380.936) -- 0:00:24
589000 -- (-372.170) [-378.018] (-374.606) (-372.869) * [-374.012] (-372.509) (-372.025) (-374.141) -- 0:00:24
589500 -- [-375.390] (-373.685) (-371.802) (-375.430) * [-372.832] (-372.363) (-372.844) (-373.594) -- 0:00:24
590000 -- (-372.871) [-372.969] (-374.531) (-373.781) * [-372.703] (-372.602) (-371.902) (-377.377) -- 0:00:24
Average standard deviation of split frequencies: 0.010419
590500 -- (-373.687) (-373.614) (-374.877) [-373.852] * [-375.233] (-375.547) (-373.188) (-372.022) -- 0:00:24
591000 -- (-374.427) [-375.018] (-377.018) (-379.428) * [-373.013] (-374.045) (-372.431) (-374.876) -- 0:00:24
591500 -- [-373.380] (-372.277) (-375.034) (-375.734) * [-374.833] (-372.335) (-374.371) (-374.594) -- 0:00:24
592000 -- (-374.408) [-375.857] (-385.029) (-375.264) * (-372.805) [-373.189] (-373.419) (-374.485) -- 0:00:24
592500 -- [-372.964] (-373.378) (-375.632) (-374.456) * [-374.006] (-374.503) (-375.418) (-372.741) -- 0:00:24
593000 -- (-377.948) [-372.192] (-375.160) (-375.145) * [-373.832] (-371.392) (-371.922) (-376.167) -- 0:00:24
593500 -- (-373.581) (-374.146) (-375.887) [-372.542] * [-372.620] (-371.295) (-372.457) (-372.958) -- 0:00:23
594000 -- [-373.626] (-374.428) (-374.536) (-374.744) * (-373.413) (-374.151) (-371.757) [-371.674] -- 0:00:23
594500 -- (-374.390) (-373.530) [-376.875] (-373.508) * (-372.402) (-371.747) [-375.974] (-372.633) -- 0:00:23
595000 -- (-373.537) (-371.483) [-373.660] (-373.656) * [-372.659] (-376.639) (-374.327) (-371.959) -- 0:00:24
Average standard deviation of split frequencies: 0.010143
595500 -- (-374.251) (-374.560) (-375.049) [-372.854] * (-374.872) (-377.046) [-372.889] (-373.379) -- 0:00:24
596000 -- (-372.700) (-373.965) [-372.626] (-374.427) * (-374.207) [-373.256] (-373.024) (-373.492) -- 0:00:24
596500 -- (-373.025) (-378.803) [-372.429] (-371.939) * (-372.246) (-373.226) [-372.932] (-375.924) -- 0:00:24
597000 -- (-375.131) (-377.143) [-372.322] (-376.547) * (-378.393) (-371.722) (-373.455) [-372.574] -- 0:00:24
597500 -- (-373.261) (-373.177) (-373.739) [-372.941] * (-377.335) (-372.076) [-373.966] (-378.845) -- 0:00:24
598000 -- (-371.925) (-374.734) [-372.043] (-372.257) * (-372.234) [-372.746] (-374.146) (-375.852) -- 0:00:24
598500 -- [-371.870] (-372.556) (-374.167) (-371.426) * (-377.016) (-372.248) [-371.950] (-372.186) -- 0:00:24
599000 -- (-371.577) [-372.723] (-377.988) (-376.033) * [-372.817] (-372.674) (-375.735) (-373.821) -- 0:00:24
599500 -- [-372.075] (-372.111) (-381.998) (-371.690) * [-373.261] (-377.106) (-374.359) (-372.361) -- 0:00:24
600000 -- (-373.111) [-372.822] (-371.788) (-371.786) * (-372.929) (-380.450) (-374.413) [-375.873] -- 0:00:24
Average standard deviation of split frequencies: 0.010064
600500 -- (-372.458) (-375.072) (-374.840) [-372.368] * [-375.760] (-374.015) (-372.638) (-373.976) -- 0:00:23
601000 -- [-373.305] (-372.783) (-374.011) (-374.354) * (-372.500) (-371.976) (-373.756) [-372.444] -- 0:00:23
601500 -- [-374.930] (-372.775) (-372.402) (-374.358) * (-372.446) (-371.744) [-375.771] (-378.456) -- 0:00:23
602000 -- (-373.071) (-374.204) (-374.911) [-373.158] * (-376.112) [-371.178] (-375.074) (-375.022) -- 0:00:23
602500 -- (-373.732) (-373.575) (-373.174) [-372.904] * (-373.737) (-371.959) [-374.001] (-373.195) -- 0:00:23
603000 -- [-372.206] (-373.507) (-376.628) (-374.210) * (-372.329) (-375.006) [-373.046] (-374.856) -- 0:00:23
603500 -- (-371.956) [-371.754] (-372.253) (-372.642) * (-371.897) [-374.185] (-373.325) (-372.704) -- 0:00:23
604000 -- (-371.699) (-372.495) (-372.980) [-372.519] * (-373.081) (-373.016) [-373.937] (-373.500) -- 0:00:23
604500 -- [-371.971] (-372.177) (-372.870) (-373.492) * (-372.501) [-375.764] (-373.614) (-371.334) -- 0:00:23
605000 -- (-372.428) (-373.921) [-372.541] (-373.562) * (-378.285) (-375.465) (-372.940) [-371.590] -- 0:00:23
Average standard deviation of split frequencies: 0.010250
605500 -- (-371.793) (-374.234) [-372.896] (-372.432) * [-371.395] (-371.931) (-373.623) (-374.523) -- 0:00:23
606000 -- (-372.439) (-374.248) [-373.922] (-377.389) * (-376.347) (-374.418) (-375.376) [-372.228] -- 0:00:23
606500 -- (-371.500) (-374.372) (-375.878) [-372.274] * (-375.583) (-372.807) (-373.585) [-374.064] -- 0:00:23
607000 -- (-371.939) [-372.668] (-375.972) (-373.703) * [-372.243] (-371.921) (-375.505) (-372.864) -- 0:00:23
607500 -- (-376.634) [-371.981] (-375.762) (-373.418) * (-374.388) (-371.502) [-372.292] (-371.900) -- 0:00:23
608000 -- (-378.622) (-373.057) (-375.433) [-374.908] * (-374.394) (-371.710) (-371.772) [-372.488] -- 0:00:23
608500 -- [-372.669] (-372.656) (-373.583) (-375.229) * (-371.646) (-371.380) [-371.899] (-372.367) -- 0:00:23
609000 -- (-375.640) [-374.489] (-372.255) (-375.773) * (-372.675) (-372.106) [-373.631] (-372.335) -- 0:00:23
609500 -- [-372.158] (-374.273) (-372.685) (-374.556) * (-376.660) (-374.455) [-375.360] (-373.023) -- 0:00:23
610000 -- (-373.746) [-372.971] (-374.141) (-373.198) * (-373.484) (-372.848) (-378.779) [-371.996] -- 0:00:23
Average standard deviation of split frequencies: 0.009854
610500 -- (-376.391) (-375.021) (-375.343) [-373.277] * (-373.880) (-371.884) (-371.998) [-372.275] -- 0:00:22
611000 -- (-371.554) (-374.489) (-374.985) [-372.501] * (-377.123) (-371.635) (-374.685) [-373.850] -- 0:00:22
611500 -- (-374.907) [-373.114] (-376.618) (-372.804) * (-379.440) (-375.320) [-372.910] (-374.038) -- 0:00:22
612000 -- [-372.008] (-374.371) (-372.571) (-374.166) * [-374.587] (-374.613) (-371.482) (-373.880) -- 0:00:23
612500 -- (-374.638) (-373.153) [-373.978] (-376.499) * (-372.662) [-372.311] (-375.043) (-373.419) -- 0:00:23
613000 -- (-373.943) (-376.882) (-376.038) [-376.245] * (-375.417) (-374.292) [-372.808] (-375.176) -- 0:00:23
613500 -- (-374.390) (-376.559) [-374.785] (-373.666) * (-376.879) [-374.915] (-373.104) (-374.603) -- 0:00:23
614000 -- (-375.951) [-375.645] (-372.687) (-372.386) * (-379.653) (-374.732) [-373.768] (-372.395) -- 0:00:23
614500 -- (-376.657) (-375.689) [-373.298] (-373.087) * [-374.932] (-375.094) (-375.073) (-372.872) -- 0:00:23
615000 -- (-375.182) [-373.069] (-375.308) (-374.308) * (-373.674) (-373.765) (-373.989) [-372.195] -- 0:00:23
Average standard deviation of split frequencies: 0.009231
615500 -- (-371.429) (-373.994) [-372.007] (-373.030) * (-372.599) [-374.321] (-374.691) (-371.763) -- 0:00:23
616000 -- (-371.583) [-372.889] (-373.042) (-371.681) * (-377.630) [-371.355] (-377.755) (-372.199) -- 0:00:23
616500 -- (-373.078) (-373.336) [-372.888] (-372.291) * [-372.422] (-374.266) (-373.498) (-373.379) -- 0:00:23
617000 -- (-374.128) (-373.602) [-374.684] (-372.231) * (-373.015) (-371.766) [-374.107] (-372.776) -- 0:00:22
617500 -- (-375.908) (-372.148) [-375.343] (-372.079) * [-373.167] (-372.635) (-373.082) (-373.275) -- 0:00:22
618000 -- (-379.133) (-377.059) [-374.138] (-373.667) * (-373.082) (-371.755) (-372.819) [-373.274] -- 0:00:22
618500 -- (-376.582) [-372.869] (-375.958) (-372.678) * [-373.939] (-373.366) (-371.679) (-372.550) -- 0:00:22
619000 -- (-374.117) (-373.713) (-372.087) [-372.789] * (-373.718) (-374.731) (-375.913) [-372.574] -- 0:00:22
619500 -- (-374.678) (-374.466) [-371.687] (-374.205) * (-373.016) (-374.443) (-372.355) [-374.177] -- 0:00:22
620000 -- (-376.083) (-375.224) [-374.133] (-372.620) * (-372.885) (-380.451) [-372.714] (-372.353) -- 0:00:22
Average standard deviation of split frequencies: 0.009779
620500 -- (-378.956) [-372.792] (-373.128) (-374.561) * (-372.999) (-373.427) [-373.955] (-372.777) -- 0:00:22
621000 -- (-375.523) (-373.489) (-373.205) [-373.523] * (-375.405) [-372.243] (-372.340) (-374.683) -- 0:00:22
621500 -- (-373.806) (-376.131) (-374.498) [-375.871] * (-377.355) (-372.027) (-372.187) [-374.629] -- 0:00:22
622000 -- (-374.435) (-372.545) [-372.572] (-376.107) * (-372.390) (-375.782) [-371.996] (-372.977) -- 0:00:22
622500 -- (-372.765) [-373.776] (-376.784) (-374.572) * (-372.700) [-372.253] (-372.243) (-372.303) -- 0:00:22
623000 -- (-372.318) [-371.807] (-378.395) (-379.277) * (-376.070) (-373.377) (-376.055) [-372.879] -- 0:00:22
623500 -- (-373.101) (-372.166) (-373.351) [-375.504] * (-373.918) (-373.640) (-374.170) [-376.757] -- 0:00:22
624000 -- [-372.471] (-374.102) (-371.924) (-372.013) * (-373.240) (-372.244) (-375.153) [-374.395] -- 0:00:22
624500 -- (-375.610) (-373.239) (-372.460) [-377.292] * [-373.533] (-374.543) (-372.583) (-377.283) -- 0:00:22
625000 -- (-375.192) (-372.327) (-371.964) [-374.195] * (-376.716) (-375.303) [-373.097] (-372.892) -- 0:00:22
Average standard deviation of split frequencies: 0.009460
625500 -- (-372.911) (-373.278) [-372.254] (-377.624) * (-376.340) (-374.902) (-373.229) [-373.367] -- 0:00:22
626000 -- (-374.231) (-381.774) [-371.944] (-373.629) * (-377.320) (-373.592) [-373.406] (-374.895) -- 0:00:22
626500 -- (-373.903) (-373.894) (-371.891) [-371.643] * [-374.637] (-374.234) (-372.922) (-373.487) -- 0:00:22
627000 -- (-372.370) [-373.920] (-377.583) (-372.564) * (-373.777) (-373.482) [-372.189] (-373.246) -- 0:00:22
627500 -- [-372.531] (-372.727) (-372.803) (-374.229) * (-381.426) (-371.720) (-373.096) [-372.357] -- 0:00:21
628000 -- (-372.199) [-372.253] (-373.031) (-371.503) * (-377.231) (-372.751) [-373.343] (-373.422) -- 0:00:21
628500 -- (-372.665) [-372.593] (-373.109) (-376.452) * [-374.574] (-374.257) (-378.145) (-372.675) -- 0:00:21
629000 -- (-377.366) [-371.871] (-377.129) (-372.947) * (-371.956) (-373.282) [-372.278] (-372.234) -- 0:00:22
629500 -- (-377.057) (-371.970) [-373.607] (-373.345) * [-371.806] (-376.305) (-373.898) (-377.351) -- 0:00:22
630000 -- [-374.571] (-373.436) (-375.331) (-372.995) * (-374.165) (-373.863) [-373.225] (-371.953) -- 0:00:22
Average standard deviation of split frequencies: 0.009764
630500 -- (-372.493) [-372.595] (-372.639) (-374.021) * (-372.178) (-371.743) (-375.095) [-374.026] -- 0:00:22
631000 -- (-379.675) (-372.277) [-372.387] (-372.929) * [-372.109] (-371.956) (-373.594) (-372.622) -- 0:00:22
631500 -- (-374.402) [-373.450] (-374.144) (-373.178) * (-371.931) (-374.246) [-375.112] (-374.577) -- 0:00:22
632000 -- (-373.618) [-374.688] (-371.664) (-374.354) * (-374.312) [-371.624] (-374.600) (-373.016) -- 0:00:22
632500 -- (-375.103) (-379.565) [-371.860] (-373.991) * (-373.355) [-373.251] (-375.806) (-379.616) -- 0:00:22
633000 -- (-374.328) (-375.232) [-373.313] (-374.485) * (-373.478) [-374.571] (-373.436) (-372.477) -- 0:00:22
633500 -- (-378.166) (-372.252) (-371.804) [-373.691] * [-373.773] (-374.923) (-373.552) (-377.197) -- 0:00:21
634000 -- (-373.500) (-372.726) [-374.130] (-374.574) * (-374.194) [-373.154] (-371.910) (-373.176) -- 0:00:21
634500 -- (-374.370) (-371.906) [-373.540] (-374.062) * (-372.945) [-371.994] (-372.138) (-375.618) -- 0:00:21
635000 -- (-375.756) (-373.765) [-376.837] (-371.283) * (-373.805) (-373.106) [-375.007] (-375.053) -- 0:00:21
Average standard deviation of split frequencies: 0.009775
635500 -- [-376.078] (-372.152) (-373.143) (-375.098) * [-374.808] (-376.636) (-376.656) (-376.104) -- 0:00:21
636000 -- (-375.175) (-377.246) (-372.348) [-374.648] * (-372.132) [-375.860] (-376.978) (-372.875) -- 0:00:21
636500 -- (-372.317) [-374.641] (-374.189) (-373.126) * [-372.999] (-373.390) (-373.825) (-373.563) -- 0:00:21
637000 -- (-371.780) (-372.434) [-378.045] (-372.379) * (-373.120) [-373.854] (-373.157) (-375.582) -- 0:00:21
637500 -- (-373.067) [-374.629] (-372.599) (-372.642) * (-375.923) (-372.393) [-373.805] (-374.726) -- 0:00:21
638000 -- [-375.580] (-377.036) (-375.730) (-375.628) * (-376.816) (-373.244) (-374.544) [-372.478] -- 0:00:21
638500 -- (-372.737) (-374.826) [-373.614] (-375.716) * (-371.980) (-372.984) (-373.188) [-372.459] -- 0:00:21
639000 -- [-371.755] (-374.973) (-373.210) (-375.621) * (-377.607) [-372.543] (-376.607) (-375.470) -- 0:00:21
639500 -- [-371.958] (-372.221) (-373.105) (-375.662) * [-374.943] (-375.052) (-375.522) (-377.672) -- 0:00:21
640000 -- (-372.103) (-372.116) (-371.804) [-372.588] * [-376.023] (-371.713) (-376.777) (-375.388) -- 0:00:21
Average standard deviation of split frequencies: 0.009933
640500 -- [-375.348] (-372.209) (-373.468) (-373.297) * (-372.423) (-376.369) [-374.416] (-374.539) -- 0:00:21
641000 -- (-374.095) [-371.531] (-376.119) (-374.258) * [-373.882] (-372.454) (-375.358) (-373.553) -- 0:00:21
641500 -- (-374.660) (-373.473) (-377.250) [-372.607] * [-371.427] (-376.675) (-378.475) (-375.892) -- 0:00:21
642000 -- [-373.154] (-371.964) (-373.537) (-374.001) * (-375.075) [-372.964] (-373.566) (-374.794) -- 0:00:21
642500 -- [-373.003] (-372.568) (-372.168) (-372.178) * (-374.566) (-374.003) [-375.830] (-372.470) -- 0:00:21
643000 -- [-373.235] (-376.193) (-374.413) (-378.211) * (-377.167) (-375.300) (-377.413) [-372.306] -- 0:00:21
643500 -- (-374.075) (-373.666) (-372.825) [-376.012] * [-375.601] (-372.538) (-372.202) (-373.693) -- 0:00:21
644000 -- (-373.129) [-372.131] (-371.999) (-373.239) * (-376.531) [-374.153] (-374.411) (-375.182) -- 0:00:21
644500 -- [-372.690] (-373.355) (-372.614) (-373.330) * (-373.241) (-374.032) [-374.352] (-372.952) -- 0:00:20
645000 -- (-372.381) [-373.763] (-374.523) (-373.416) * [-371.611] (-374.399) (-376.773) (-372.382) -- 0:00:20
Average standard deviation of split frequencies: 0.010173
645500 -- (-374.866) (-372.453) (-376.173) [-375.806] * (-373.228) (-374.962) (-372.122) [-372.371] -- 0:00:21
646000 -- (-373.777) (-372.588) (-374.485) [-373.020] * (-376.117) (-375.365) [-374.272] (-374.445) -- 0:00:21
646500 -- (-374.456) [-372.787] (-372.683) (-371.948) * [-372.841] (-373.163) (-374.295) (-372.677) -- 0:00:21
647000 -- (-376.996) (-373.583) [-376.256] (-376.989) * (-372.133) (-373.490) [-375.137] (-378.554) -- 0:00:21
647500 -- [-373.424] (-371.881) (-373.725) (-373.453) * (-373.363) (-374.386) [-374.594] (-373.404) -- 0:00:21
648000 -- (-372.514) (-372.939) [-372.532] (-371.680) * (-377.352) (-372.462) [-377.029] (-371.598) -- 0:00:21
648500 -- [-375.033] (-371.461) (-371.743) (-373.904) * [-371.519] (-373.856) (-375.198) (-374.609) -- 0:00:21
649000 -- [-373.187] (-375.782) (-374.142) (-373.317) * (-371.323) (-372.057) (-371.795) [-375.209] -- 0:00:21
649500 -- (-372.327) (-371.911) (-373.534) [-375.023] * (-372.950) [-372.391] (-373.727) (-372.447) -- 0:00:21
650000 -- (-374.408) [-372.125] (-374.398) (-380.659) * [-376.950] (-372.905) (-375.403) (-374.838) -- 0:00:21
Average standard deviation of split frequencies: 0.009101
650500 -- [-372.191] (-372.116) (-377.411) (-375.356) * (-373.596) [-374.610] (-374.641) (-373.434) -- 0:00:20
651000 -- (-373.853) [-372.061] (-375.335) (-374.064) * (-373.196) (-381.003) (-376.833) [-374.021] -- 0:00:20
651500 -- (-371.771) [-374.080] (-374.694) (-373.394) * (-377.305) (-373.706) [-374.294] (-372.240) -- 0:00:20
652000 -- (-373.136) (-372.606) (-374.504) [-372.181] * (-373.636) (-372.373) (-372.622) [-372.231] -- 0:00:20
652500 -- (-375.516) [-372.174] (-371.505) (-375.167) * (-375.354) (-376.325) [-372.221] (-371.289) -- 0:00:20
653000 -- (-382.250) (-372.535) [-372.105] (-374.983) * (-374.517) (-372.765) [-371.554] (-376.377) -- 0:00:20
653500 -- [-373.561] (-372.611) (-372.662) (-372.815) * (-378.187) (-375.412) [-372.694] (-375.741) -- 0:00:20
654000 -- (-374.453) (-372.381) [-373.050] (-372.316) * (-372.613) [-374.863] (-376.528) (-371.811) -- 0:00:20
654500 -- (-376.954) [-373.209] (-374.621) (-375.698) * (-375.257) (-377.398) [-372.924] (-373.654) -- 0:00:20
655000 -- (-373.195) (-372.393) (-373.812) [-375.400] * (-374.938) (-371.162) (-373.735) [-376.216] -- 0:00:20
Average standard deviation of split frequencies: 0.009432
655500 -- (-374.931) (-373.235) [-373.595] (-377.439) * (-373.530) (-373.380) [-372.084] (-375.510) -- 0:00:20
656000 -- (-372.907) [-372.418] (-372.715) (-375.207) * (-374.519) (-373.754) [-374.393] (-372.840) -- 0:00:20
656500 -- [-372.290] (-372.318) (-372.776) (-371.503) * (-373.610) (-372.025) [-372.799] (-372.803) -- 0:00:20
657000 -- (-375.658) (-373.336) [-372.285] (-372.586) * (-371.485) (-372.349) (-379.690) [-373.256] -- 0:00:20
657500 -- [-373.525] (-371.858) (-372.265) (-371.885) * (-372.086) (-377.113) [-373.684] (-372.397) -- 0:00:20
658000 -- (-380.837) (-371.984) [-371.642] (-375.276) * (-372.864) [-373.217] (-372.252) (-374.023) -- 0:00:20
658500 -- (-373.202) (-371.805) [-375.990] (-373.535) * (-375.378) (-371.557) (-372.537) [-377.378] -- 0:00:20
659000 -- (-372.679) [-373.343] (-372.248) (-374.603) * (-371.585) (-372.440) (-372.179) [-372.256] -- 0:00:20
659500 -- (-372.379) (-373.305) [-373.194] (-372.536) * [-372.212] (-375.312) (-373.029) (-374.316) -- 0:00:20
660000 -- (-375.458) (-376.647) [-375.801] (-374.951) * (-376.905) [-376.883] (-372.962) (-378.211) -- 0:00:20
Average standard deviation of split frequencies: 0.009677
660500 -- (-381.178) [-372.955] (-373.401) (-372.912) * [-374.087] (-376.024) (-373.003) (-372.541) -- 0:00:20
661000 -- [-372.689] (-378.309) (-374.709) (-373.746) * (-373.571) [-372.132] (-371.572) (-372.368) -- 0:00:20
661500 -- [-377.211] (-372.492) (-373.873) (-372.582) * (-372.170) (-374.108) [-371.521] (-372.734) -- 0:00:19
662000 -- (-373.572) (-373.642) (-375.136) [-373.803] * (-372.794) (-377.229) [-373.156] (-371.669) -- 0:00:19
662500 -- (-372.962) (-374.934) [-375.100] (-372.306) * (-373.742) [-373.789] (-372.251) (-372.750) -- 0:00:19
663000 -- (-378.304) (-374.278) [-373.873] (-373.314) * (-372.086) (-375.322) [-372.816] (-376.314) -- 0:00:20
663500 -- (-374.641) (-377.217) [-373.665] (-374.713) * [-371.868] (-374.780) (-375.150) (-377.652) -- 0:00:20
664000 -- [-373.865] (-373.496) (-374.225) (-372.159) * (-374.108) [-372.620] (-373.398) (-380.473) -- 0:00:20
664500 -- (-373.438) [-372.382] (-372.823) (-379.958) * (-376.486) (-372.423) (-372.484) [-375.096] -- 0:00:20
665000 -- (-373.665) [-373.129] (-376.575) (-380.979) * (-376.355) (-372.096) (-378.035) [-373.633] -- 0:00:20
Average standard deviation of split frequencies: 0.009423
665500 -- (-373.472) [-375.246] (-377.702) (-376.314) * (-375.706) (-372.342) [-372.390] (-372.808) -- 0:00:20
666000 -- (-373.719) (-372.143) [-373.785] (-377.303) * (-373.867) (-376.716) (-373.870) [-372.477] -- 0:00:20
666500 -- (-374.460) (-374.864) [-374.164] (-373.185) * (-372.359) (-375.940) [-373.209] (-373.534) -- 0:00:20
667000 -- (-375.920) (-373.690) (-377.429) [-371.623] * (-372.486) [-371.284] (-372.392) (-374.096) -- 0:00:19
667500 -- [-373.593] (-374.066) (-379.111) (-371.686) * (-375.265) [-374.279] (-372.877) (-375.427) -- 0:00:19
668000 -- (-373.985) (-373.916) (-380.011) [-375.030] * (-374.378) (-375.221) (-373.849) [-374.011] -- 0:00:19
668500 -- (-375.531) [-372.829] (-371.907) (-371.549) * (-374.139) (-372.700) [-371.594] (-376.903) -- 0:00:19
669000 -- (-376.429) (-374.347) [-374.312] (-372.006) * (-373.696) (-371.310) (-373.198) [-377.468] -- 0:00:19
669500 -- [-374.528] (-374.340) (-376.982) (-373.647) * (-375.227) [-372.715] (-373.535) (-375.007) -- 0:00:19
670000 -- (-372.990) [-372.674] (-373.647) (-375.256) * (-374.330) (-374.512) [-373.162] (-375.172) -- 0:00:19
Average standard deviation of split frequencies: 0.009577
670500 -- (-373.233) (-372.993) (-372.430) [-372.798] * (-373.626) [-374.802] (-372.524) (-372.131) -- 0:00:19
671000 -- (-374.635) (-373.296) [-374.269] (-374.163) * (-373.000) (-377.102) (-375.127) [-371.876] -- 0:00:19
671500 -- [-372.410] (-374.904) (-371.281) (-373.804) * (-373.693) (-375.526) (-372.355) [-373.177] -- 0:00:19
672000 -- [-378.190] (-374.894) (-374.571) (-372.507) * (-373.614) (-372.670) (-374.358) [-373.572] -- 0:00:19
672500 -- (-373.564) (-372.445) (-373.493) [-372.078] * (-373.850) [-378.710] (-375.013) (-372.964) -- 0:00:19
673000 -- (-372.740) (-371.506) (-372.666) [-372.072] * (-373.645) (-375.141) (-372.334) [-373.705] -- 0:00:19
673500 -- (-371.839) (-373.394) (-372.675) [-373.871] * (-372.415) (-372.072) (-372.826) [-372.916] -- 0:00:19
674000 -- (-371.966) [-372.384] (-373.975) (-377.917) * (-375.314) [-374.066] (-373.324) (-376.542) -- 0:00:19
674500 -- (-374.824) (-374.782) [-372.975] (-375.289) * (-373.846) (-373.516) [-374.057] (-372.727) -- 0:00:19
675000 -- (-374.864) (-374.723) (-371.723) [-372.651] * (-374.205) [-375.694] (-383.579) (-372.140) -- 0:00:19
Average standard deviation of split frequencies: 0.010583
675500 -- (-372.802) (-373.354) [-374.261] (-375.487) * (-373.242) (-373.164) (-378.696) [-373.604] -- 0:00:19
676000 -- (-376.153) (-374.521) (-371.939) [-375.087] * (-374.152) [-375.235] (-373.626) (-373.475) -- 0:00:19
676500 -- (-373.421) (-374.344) (-374.074) [-375.875] * (-373.847) [-377.365] (-372.678) (-374.622) -- 0:00:19
677000 -- (-374.084) (-376.108) [-375.072] (-373.017) * [-375.443] (-374.565) (-373.140) (-374.193) -- 0:00:19
677500 -- [-372.642] (-375.722) (-373.966) (-372.778) * (-376.433) (-374.769) (-373.356) [-374.412] -- 0:00:19
678000 -- (-376.751) [-374.510] (-374.003) (-372.453) * (-372.662) (-372.226) (-375.459) [-374.748] -- 0:00:18
678500 -- (-374.073) (-374.352) [-379.842] (-376.158) * (-374.966) (-371.583) (-376.779) [-371.730] -- 0:00:18
679000 -- [-375.979] (-373.577) (-373.004) (-373.770) * [-374.128] (-372.530) (-375.783) (-372.813) -- 0:00:18
679500 -- (-373.430) [-373.058] (-373.891) (-372.041) * (-376.513) [-373.113] (-373.155) (-376.459) -- 0:00:19
680000 -- (-374.377) (-377.216) (-373.813) [-376.253] * [-374.320] (-375.753) (-372.650) (-375.673) -- 0:00:19
Average standard deviation of split frequencies: 0.009826
680500 -- (-374.810) (-378.628) (-372.775) [-374.169] * [-374.333] (-374.851) (-375.915) (-375.323) -- 0:00:19
681000 -- (-373.659) (-375.503) [-372.512] (-374.395) * (-372.918) (-375.454) (-376.389) [-372.711] -- 0:00:19
681500 -- (-374.262) [-373.898] (-376.383) (-373.977) * (-372.835) (-376.718) [-372.543] (-375.147) -- 0:00:19
682000 -- (-373.615) [-373.323] (-373.820) (-373.033) * (-373.990) [-375.745] (-371.866) (-372.855) -- 0:00:19
682500 -- (-375.829) [-375.018] (-374.222) (-373.833) * (-377.813) [-375.176] (-371.834) (-375.682) -- 0:00:19
683000 -- (-374.686) [-375.486] (-376.059) (-376.042) * (-376.170) (-372.925) [-373.420] (-372.230) -- 0:00:19
683500 -- (-375.661) [-378.319] (-375.999) (-372.983) * (-380.582) [-374.464] (-373.720) (-375.285) -- 0:00:18
684000 -- (-374.416) [-372.296] (-373.647) (-378.297) * (-373.568) (-371.627) (-375.182) [-372.227] -- 0:00:18
684500 -- (-372.160) (-375.812) (-374.017) [-372.742] * (-376.196) [-373.718] (-374.197) (-372.386) -- 0:00:18
685000 -- (-373.611) [-374.364] (-375.337) (-373.940) * (-374.551) (-374.345) [-378.858] (-374.057) -- 0:00:18
Average standard deviation of split frequencies: 0.009792
685500 -- [-371.688] (-373.868) (-377.409) (-375.907) * (-372.899) [-377.453] (-372.984) (-375.871) -- 0:00:18
686000 -- [-371.952] (-374.661) (-373.025) (-373.291) * (-373.337) (-373.806) (-373.562) [-373.210] -- 0:00:18
686500 -- (-375.901) [-376.486] (-371.911) (-372.035) * (-375.311) (-374.120) [-373.762] (-375.686) -- 0:00:18
687000 -- (-375.755) (-375.836) [-374.945] (-375.191) * (-372.995) [-373.029] (-376.169) (-384.097) -- 0:00:18
687500 -- (-375.229) [-372.533] (-374.287) (-374.835) * (-377.568) (-375.165) (-378.109) [-373.720] -- 0:00:18
688000 -- [-372.111] (-372.889) (-374.579) (-375.204) * (-371.398) (-376.854) (-372.875) [-372.788] -- 0:00:18
688500 -- (-373.691) (-373.229) [-378.574] (-376.728) * [-375.757] (-374.348) (-372.285) (-372.601) -- 0:00:18
689000 -- (-374.233) (-372.030) [-374.065] (-377.717) * (-374.358) (-373.649) [-373.831] (-374.256) -- 0:00:18
689500 -- (-372.134) [-376.403] (-376.318) (-377.559) * (-375.838) [-374.816] (-373.650) (-372.215) -- 0:00:18
690000 -- (-371.163) (-372.665) (-371.510) [-371.893] * (-372.940) [-373.160] (-375.625) (-373.011) -- 0:00:18
Average standard deviation of split frequencies: 0.009676
690500 -- (-371.161) (-372.823) [-371.760] (-373.517) * (-373.277) (-374.831) (-373.433) [-372.252] -- 0:00:18
691000 -- (-372.715) (-375.504) [-372.218] (-374.814) * (-372.644) (-376.050) [-372.629] (-374.656) -- 0:00:18
691500 -- [-378.781] (-374.298) (-375.282) (-374.507) * [-374.111] (-379.133) (-374.424) (-373.572) -- 0:00:18
692000 -- (-374.954) (-372.443) (-376.420) [-372.980] * (-375.479) (-374.992) [-372.442] (-375.426) -- 0:00:18
692500 -- (-372.403) (-372.956) [-372.023] (-373.352) * (-377.195) [-375.307] (-374.988) (-376.227) -- 0:00:18
693000 -- (-371.939) (-371.928) (-372.329) [-371.604] * (-371.964) (-373.329) [-376.976] (-372.840) -- 0:00:18
693500 -- (-373.765) [-371.406] (-373.229) (-375.049) * [-373.589] (-373.750) (-375.239) (-372.648) -- 0:00:18
694000 -- (-372.558) (-372.026) [-372.199] (-373.877) * (-372.995) [-373.152] (-375.424) (-377.083) -- 0:00:18
694500 -- (-371.421) [-371.609] (-371.912) (-381.003) * [-373.403] (-372.566) (-377.564) (-376.885) -- 0:00:18
695000 -- [-372.518] (-371.815) (-373.620) (-376.718) * (-373.868) (-371.703) (-374.319) [-375.988] -- 0:00:17
Average standard deviation of split frequencies: 0.009694
695500 -- (-377.776) (-373.590) (-373.387) [-373.408] * (-375.714) [-371.884] (-381.823) (-373.229) -- 0:00:17
696000 -- (-373.482) (-373.727) (-371.926) [-374.976] * (-376.137) [-372.848] (-375.656) (-375.224) -- 0:00:18
696500 -- (-373.095) (-372.438) (-377.244) [-373.633] * [-372.193] (-376.454) (-372.667) (-375.249) -- 0:00:18
697000 -- (-374.772) (-373.582) (-378.887) [-373.509] * (-373.325) (-374.393) [-372.080] (-376.259) -- 0:00:18
697500 -- (-373.669) (-373.096) (-373.194) [-374.980] * [-373.322] (-374.778) (-371.778) (-374.825) -- 0:00:18
698000 -- (-373.086) [-375.135] (-372.724) (-372.716) * (-375.207) [-372.057] (-372.843) (-373.573) -- 0:00:18
698500 -- (-373.305) (-372.984) (-374.810) [-372.666] * [-372.150] (-376.847) (-373.039) (-373.940) -- 0:00:18
699000 -- [-372.208] (-374.340) (-372.498) (-374.981) * (-375.618) (-375.224) [-374.238] (-373.982) -- 0:00:18
699500 -- (-379.644) (-373.489) (-372.321) [-372.784] * (-376.672) (-373.486) (-377.905) [-373.098] -- 0:00:18
700000 -- [-374.590] (-372.530) (-371.794) (-373.263) * [-371.894] (-374.086) (-372.756) (-377.992) -- 0:00:18
Average standard deviation of split frequencies: 0.009041
700500 -- [-375.876] (-377.693) (-373.437) (-375.670) * (-371.867) [-373.929] (-373.778) (-374.401) -- 0:00:17
701000 -- (-376.514) [-371.393] (-374.008) (-374.635) * (-373.039) (-373.827) (-373.208) [-373.902] -- 0:00:17
701500 -- [-373.017] (-373.769) (-372.155) (-374.495) * [-374.220] (-373.106) (-372.407) (-377.676) -- 0:00:17
702000 -- (-374.679) [-371.730] (-371.427) (-374.470) * (-373.837) (-373.431) [-372.843] (-374.092) -- 0:00:17
702500 -- (-375.131) [-372.900] (-374.063) (-375.099) * (-373.892) [-374.429] (-375.755) (-374.139) -- 0:00:17
703000 -- (-376.632) (-372.776) (-371.308) [-372.163] * (-373.579) [-377.236] (-379.039) (-373.570) -- 0:00:17
703500 -- (-373.457) [-372.361] (-372.027) (-372.767) * (-373.472) (-373.244) (-377.830) [-372.951] -- 0:00:17
704000 -- (-375.962) (-374.274) [-372.546] (-372.427) * (-372.815) (-371.393) (-374.448) [-374.680] -- 0:00:17
704500 -- (-375.262) [-373.592] (-376.333) (-379.169) * (-371.811) (-371.949) [-372.042] (-375.002) -- 0:00:17
705000 -- (-375.279) (-372.918) [-375.682] (-373.685) * (-372.529) (-372.197) (-372.973) [-374.897] -- 0:00:17
Average standard deviation of split frequencies: 0.009473
705500 -- (-375.370) (-372.782) [-374.100] (-373.492) * (-373.740) (-373.022) (-374.763) [-372.628] -- 0:00:17
706000 -- (-375.196) (-373.998) (-376.820) [-372.234] * (-372.629) [-373.401] (-372.546) (-376.422) -- 0:00:17
706500 -- [-376.294] (-373.628) (-374.022) (-372.945) * [-372.264] (-373.600) (-377.838) (-374.845) -- 0:00:17
707000 -- [-374.510] (-375.553) (-380.160) (-373.840) * (-373.135) (-376.586) [-373.570] (-371.950) -- 0:00:17
707500 -- (-381.094) (-374.210) (-373.762) [-374.257] * [-377.161] (-373.971) (-372.636) (-372.915) -- 0:00:17
708000 -- (-381.847) (-373.453) (-373.913) [-372.741] * (-372.918) (-372.782) [-374.217] (-374.654) -- 0:00:17
708500 -- (-374.889) (-375.237) (-371.548) [-375.446] * (-373.707) (-371.588) [-377.474] (-376.512) -- 0:00:17
709000 -- (-377.904) (-373.033) (-372.499) [-371.795] * (-374.636) (-372.300) [-373.349] (-372.475) -- 0:00:17
709500 -- (-374.369) [-374.426] (-373.183) (-374.883) * (-372.419) (-372.007) [-371.569] (-373.881) -- 0:00:17
710000 -- (-375.691) [-376.532] (-375.582) (-372.652) * (-371.859) [-372.371] (-372.785) (-373.929) -- 0:00:17
Average standard deviation of split frequencies: 0.009369
710500 -- (-373.080) [-373.121] (-375.446) (-372.499) * (-371.779) (-374.070) (-372.424) [-376.300] -- 0:00:17
711000 -- (-374.032) (-376.274) (-371.520) [-374.170] * (-373.253) [-372.369] (-373.123) (-375.075) -- 0:00:17
711500 -- (-372.957) (-372.144) [-373.361] (-372.786) * (-372.796) (-374.593) (-373.089) [-371.997] -- 0:00:17
712000 -- (-372.132) (-373.454) (-377.129) [-373.948] * (-374.332) [-373.084] (-371.267) (-374.589) -- 0:00:16
712500 -- [-372.847] (-375.302) (-375.078) (-375.789) * (-373.708) (-372.206) (-372.373) [-376.369] -- 0:00:17
713000 -- [-372.966] (-373.491) (-373.362) (-373.202) * [-374.299] (-374.442) (-375.302) (-374.831) -- 0:00:17
713500 -- (-374.202) [-373.080] (-374.507) (-375.109) * (-376.869) [-372.532] (-373.220) (-375.593) -- 0:00:17
714000 -- (-372.623) (-372.437) (-377.069) [-383.959] * (-374.218) [-373.337] (-376.948) (-375.211) -- 0:00:17
714500 -- (-372.833) (-374.162) (-376.364) [-372.040] * (-377.150) (-376.915) (-382.063) [-375.691] -- 0:00:17
715000 -- [-371.822] (-376.382) (-371.878) (-377.859) * (-378.945) [-371.931] (-381.480) (-371.693) -- 0:00:17
Average standard deviation of split frequencies: 0.009300
715500 -- (-372.764) (-374.974) (-376.754) [-377.565] * (-373.104) [-371.814] (-372.645) (-372.295) -- 0:00:17
716000 -- (-374.960) [-371.983] (-375.501) (-379.424) * (-372.293) (-376.027) [-375.559] (-371.785) -- 0:00:17
716500 -- (-374.057) [-373.785] (-375.975) (-380.857) * [-372.689] (-374.744) (-373.275) (-371.559) -- 0:00:17
717000 -- (-381.758) (-380.810) [-377.606] (-374.358) * (-372.188) (-371.798) (-374.535) [-372.105] -- 0:00:16
717500 -- (-373.142) (-374.643) (-374.312) [-373.472] * (-372.227) [-373.745] (-373.734) (-374.419) -- 0:00:16
718000 -- (-374.556) (-371.931) (-376.418) [-376.265] * [-374.553] (-372.630) (-373.428) (-373.246) -- 0:00:16
718500 -- (-372.006) (-372.750) (-376.886) [-371.757] * (-371.971) (-374.320) (-375.185) [-378.980] -- 0:00:16
719000 -- (-371.737) (-375.939) (-372.390) [-373.365] * [-372.039] (-373.988) (-372.174) (-377.558) -- 0:00:16
719500 -- (-371.688) [-375.432] (-372.051) (-375.443) * (-373.325) (-372.310) (-373.804) [-371.453] -- 0:00:16
720000 -- (-372.540) [-373.057] (-372.379) (-375.542) * (-371.667) [-372.882] (-376.097) (-375.268) -- 0:00:16
Average standard deviation of split frequencies: 0.008953
720500 -- [-373.191] (-373.190) (-372.531) (-373.234) * (-373.797) (-372.319) [-374.189] (-373.701) -- 0:00:16
721000 -- [-374.256] (-371.773) (-373.421) (-376.068) * (-373.892) [-372.015] (-372.912) (-375.300) -- 0:00:16
721500 -- (-375.819) (-376.323) (-373.109) [-376.698] * (-373.383) (-372.023) [-373.099] (-373.436) -- 0:00:16
722000 -- (-374.018) (-376.328) (-380.571) [-371.980] * (-372.590) [-371.872] (-375.585) (-373.152) -- 0:00:16
722500 -- (-374.349) (-376.152) [-373.760] (-373.263) * (-372.422) (-374.288) [-372.046] (-371.983) -- 0:00:16
723000 -- (-374.654) (-375.570) [-374.416] (-375.467) * [-371.517] (-374.969) (-376.025) (-372.266) -- 0:00:16
723500 -- (-373.648) [-378.306] (-372.959) (-373.261) * (-371.730) (-373.679) (-374.296) [-373.589] -- 0:00:16
724000 -- (-372.877) (-377.254) [-372.488] (-372.044) * [-374.140] (-378.312) (-378.726) (-374.379) -- 0:00:16
724500 -- (-373.176) (-377.903) [-371.924] (-371.678) * (-376.562) (-375.928) (-375.997) [-373.347] -- 0:00:16
725000 -- [-374.744] (-374.959) (-372.553) (-373.014) * (-373.714) (-374.229) (-373.293) [-375.732] -- 0:00:16
Average standard deviation of split frequencies: 0.009090
725500 -- (-373.980) (-377.239) [-372.818] (-373.462) * (-375.008) [-372.929] (-376.510) (-374.568) -- 0:00:16
726000 -- (-371.616) (-372.959) (-375.665) [-373.113] * (-375.803) (-373.153) [-371.830] (-378.649) -- 0:00:16
726500 -- (-372.717) (-371.401) [-374.750] (-373.152) * (-372.975) (-375.743) (-373.909) [-372.198] -- 0:00:16
727000 -- (-374.724) (-373.102) [-377.498] (-373.104) * [-372.641] (-375.867) (-371.522) (-373.463) -- 0:00:16
727500 -- [-372.581] (-374.969) (-376.525) (-375.896) * [-372.984] (-372.359) (-373.973) (-378.624) -- 0:00:16
728000 -- (-373.208) [-372.359] (-379.802) (-373.331) * [-372.395] (-375.737) (-372.549) (-380.815) -- 0:00:16
728500 -- (-375.455) [-372.605] (-375.392) (-372.931) * (-373.846) (-375.055) (-373.972) [-375.395] -- 0:00:16
729000 -- (-376.558) (-374.847) (-371.713) [-372.216] * (-373.732) [-373.502] (-372.643) (-375.409) -- 0:00:15
729500 -- (-376.624) (-376.111) [-372.483] (-372.547) * (-375.781) (-373.737) (-373.647) [-373.158] -- 0:00:16
730000 -- (-372.711) [-372.731] (-374.083) (-374.447) * (-371.738) (-375.057) (-374.018) [-372.882] -- 0:00:16
Average standard deviation of split frequencies: 0.008956
730500 -- (-374.283) (-375.608) [-374.518] (-372.749) * [-373.849] (-373.009) (-373.728) (-372.621) -- 0:00:16
731000 -- [-373.954] (-372.851) (-373.301) (-372.249) * (-377.212) (-372.005) [-372.989] (-372.721) -- 0:00:16
731500 -- (-374.786) (-376.247) (-372.968) [-375.328] * (-371.689) (-374.551) [-372.381] (-374.196) -- 0:00:16
732000 -- (-372.236) (-373.095) [-372.461] (-373.001) * (-376.136) [-371.877] (-372.400) (-373.656) -- 0:00:16
732500 -- (-373.250) (-374.308) [-371.633] (-372.849) * (-381.831) [-372.333] (-377.262) (-372.220) -- 0:00:16
733000 -- (-372.546) [-374.840] (-371.958) (-372.766) * (-375.615) [-372.718] (-378.606) (-372.075) -- 0:00:16
733500 -- [-374.661] (-375.400) (-375.517) (-373.452) * [-374.283] (-371.687) (-374.189) (-373.493) -- 0:00:15
734000 -- (-372.901) (-376.370) (-378.570) [-372.278] * (-373.741) (-373.592) (-372.236) [-373.095] -- 0:00:15
734500 -- [-374.433] (-374.697) (-372.059) (-373.372) * (-375.732) (-377.107) (-373.765) [-375.649] -- 0:00:15
735000 -- (-374.502) (-373.006) (-375.289) [-372.353] * (-373.393) [-372.035] (-372.309) (-376.556) -- 0:00:15
Average standard deviation of split frequencies: 0.009367
735500 -- (-375.741) [-373.115] (-373.486) (-374.009) * (-372.687) (-372.599) [-372.488] (-372.142) -- 0:00:15
736000 -- [-375.962] (-371.729) (-374.508) (-377.714) * (-378.185) (-374.288) (-371.813) [-372.261] -- 0:00:15
736500 -- (-376.200) (-372.204) [-371.466] (-379.089) * [-373.660] (-376.259) (-372.026) (-372.154) -- 0:00:15
737000 -- [-375.183] (-374.377) (-373.245) (-374.812) * (-374.302) (-372.314) [-371.874] (-373.270) -- 0:00:15
737500 -- [-373.095] (-371.867) (-372.595) (-371.916) * (-374.428) [-372.236] (-372.781) (-372.030) -- 0:00:15
738000 -- (-372.511) (-371.806) [-371.771] (-375.476) * (-372.189) (-372.419) [-373.352] (-371.827) -- 0:00:15
738500 -- (-371.881) (-371.508) (-372.014) [-376.986] * (-373.912) [-373.110] (-372.938) (-378.034) -- 0:00:15
739000 -- [-371.330] (-372.075) (-377.573) (-375.386) * (-373.613) (-374.321) [-372.715] (-375.050) -- 0:00:15
739500 -- (-371.377) (-378.588) [-378.439] (-373.423) * (-372.756) (-375.611) (-373.625) [-371.441] -- 0:00:15
740000 -- (-375.251) (-371.801) [-371.819] (-373.278) * (-375.944) (-375.404) [-372.734] (-371.378) -- 0:00:15
Average standard deviation of split frequencies: 0.009467
740500 -- [-374.045] (-371.803) (-371.676) (-373.563) * [-376.755] (-376.855) (-376.791) (-372.824) -- 0:00:15
741000 -- (-372.262) (-372.244) (-375.765) [-372.887] * (-373.734) [-373.536] (-377.873) (-372.078) -- 0:00:15
741500 -- (-377.387) (-374.128) (-373.542) [-372.935] * (-374.391) (-381.333) [-372.379] (-371.810) -- 0:00:15
742000 -- (-377.460) [-375.196] (-381.204) (-374.171) * (-373.849) (-373.956) (-371.323) [-375.838] -- 0:00:15
742500 -- (-374.373) [-372.868] (-376.119) (-375.391) * (-377.983) (-372.856) [-372.418] (-375.658) -- 0:00:15
743000 -- (-373.769) [-373.384] (-375.399) (-375.125) * (-375.378) (-371.879) [-372.339] (-376.346) -- 0:00:15
743500 -- [-373.187] (-375.550) (-373.515) (-375.647) * (-376.326) [-372.386] (-371.585) (-373.988) -- 0:00:15
744000 -- (-376.371) (-372.213) [-373.219] (-377.017) * (-373.721) [-371.964] (-374.097) (-374.648) -- 0:00:15
744500 -- (-375.895) (-372.708) (-372.068) [-374.159] * (-374.311) [-376.195] (-374.384) (-375.310) -- 0:00:15
745000 -- (-375.997) [-372.853] (-373.224) (-372.696) * (-374.154) (-374.099) (-373.199) [-373.156] -- 0:00:15
Average standard deviation of split frequencies: 0.009558
745500 -- (-372.650) [-372.325] (-377.356) (-374.497) * (-372.710) (-372.927) (-373.073) [-372.464] -- 0:00:15
746000 -- (-372.322) (-373.658) (-376.994) [-374.665] * (-375.458) (-373.904) (-371.321) [-372.443] -- 0:00:14
746500 -- (-374.628) [-373.109] (-372.802) (-373.847) * [-373.334] (-373.963) (-372.072) (-373.051) -- 0:00:15
747000 -- [-373.059] (-372.701) (-371.380) (-374.039) * (-374.293) [-375.108] (-374.525) (-374.739) -- 0:00:15
747500 -- (-372.903) [-373.730] (-373.032) (-374.824) * (-373.346) (-376.133) (-373.044) [-374.738] -- 0:00:15
748000 -- (-373.680) (-376.279) [-371.964] (-374.482) * (-372.639) (-373.578) (-373.383) [-373.729] -- 0:00:15
748500 -- (-377.837) [-375.206] (-373.788) (-374.594) * (-373.038) [-372.942] (-372.938) (-373.348) -- 0:00:15
749000 -- (-372.569) (-376.027) [-372.092] (-373.425) * (-371.546) (-374.074) (-372.383) [-374.149] -- 0:00:15
749500 -- (-371.604) (-372.140) [-372.091] (-371.557) * [-371.690] (-372.073) (-372.625) (-373.580) -- 0:00:15
750000 -- (-372.048) [-374.735] (-374.071) (-371.614) * [-374.618] (-373.039) (-372.889) (-373.833) -- 0:00:15
Average standard deviation of split frequencies: 0.009145
750500 -- [-372.250] (-374.736) (-376.836) (-373.966) * [-374.832] (-374.530) (-372.139) (-378.047) -- 0:00:14
751000 -- (-378.969) (-372.779) [-376.314] (-376.536) * (-377.564) [-376.657] (-372.804) (-373.916) -- 0:00:14
751500 -- (-373.016) (-375.342) (-375.242) [-375.721] * [-373.053] (-373.183) (-374.218) (-373.682) -- 0:00:14
752000 -- (-372.878) (-374.304) (-377.160) [-373.320] * (-378.600) [-374.540] (-372.535) (-372.254) -- 0:00:14
752500 -- (-374.270) [-372.011] (-374.027) (-373.342) * (-372.818) (-372.945) [-372.070] (-371.530) -- 0:00:14
753000 -- (-373.486) [-375.018] (-372.306) (-371.753) * (-373.942) (-375.321) (-373.987) [-371.498] -- 0:00:14
753500 -- (-373.160) [-374.584] (-371.551) (-374.411) * (-372.915) [-372.706] (-376.125) (-376.727) -- 0:00:14
754000 -- (-371.859) (-375.373) (-373.376) [-372.704] * (-372.730) (-372.173) [-372.245] (-374.646) -- 0:00:14
754500 -- (-372.952) (-371.978) [-371.997] (-372.751) * (-372.912) (-373.509) [-376.234] (-372.840) -- 0:00:14
755000 -- [-372.263] (-374.099) (-371.995) (-373.683) * (-373.451) (-373.234) [-372.030] (-371.990) -- 0:00:14
Average standard deviation of split frequencies: 0.009119
755500 -- (-371.886) (-375.097) [-374.463] (-378.160) * (-374.022) (-375.759) [-371.187] (-372.427) -- 0:00:14
756000 -- (-373.924) (-371.675) (-373.483) [-372.589] * (-375.570) [-373.619] (-374.029) (-372.857) -- 0:00:14
756500 -- (-373.875) [-371.690] (-373.477) (-373.886) * (-374.325) (-372.498) [-372.969] (-378.079) -- 0:00:14
757000 -- (-373.995) (-374.188) (-373.541) [-371.988] * (-371.769) (-373.315) (-376.593) [-372.743] -- 0:00:14
757500 -- (-372.678) [-373.403] (-374.269) (-375.272) * (-376.007) (-376.945) [-372.115] (-371.929) -- 0:00:14
758000 -- (-376.833) [-374.200] (-377.527) (-375.349) * (-373.121) [-373.032] (-374.292) (-372.145) -- 0:00:14
758500 -- (-373.969) (-373.274) [-375.394] (-378.475) * (-374.062) (-376.436) [-372.431] (-374.603) -- 0:00:14
759000 -- [-376.963] (-376.736) (-375.215) (-375.107) * (-371.888) (-374.938) [-372.124] (-374.548) -- 0:00:14
759500 -- (-371.635) [-374.864] (-376.730) (-375.455) * (-373.127) [-372.288] (-371.390) (-371.761) -- 0:00:14
760000 -- (-372.432) (-380.906) [-373.015] (-373.738) * (-374.965) (-377.079) (-372.313) [-371.596] -- 0:00:14
Average standard deviation of split frequencies: 0.009373
760500 -- (-372.431) (-375.860) [-372.760] (-374.684) * (-373.388) (-376.893) (-373.346) [-375.549] -- 0:00:14
761000 -- (-372.597) (-374.454) (-379.999) [-371.290] * (-372.529) (-377.671) [-374.235] (-376.447) -- 0:00:14
761500 -- (-373.822) (-372.717) [-375.510] (-371.696) * [-374.635] (-376.488) (-376.786) (-372.850) -- 0:00:14
762000 -- (-372.533) [-375.234] (-373.722) (-373.430) * (-374.606) (-374.822) (-375.798) [-372.470] -- 0:00:14
762500 -- (-372.371) [-372.155] (-371.499) (-373.258) * (-372.284) (-374.770) (-373.800) [-376.450] -- 0:00:14
763000 -- [-376.752] (-374.041) (-374.996) (-374.441) * (-373.878) (-374.623) (-372.184) [-372.863] -- 0:00:13
763500 -- (-372.793) [-374.307] (-375.019) (-372.533) * [-374.000] (-374.076) (-375.131) (-377.149) -- 0:00:14
764000 -- (-373.042) [-374.656] (-378.214) (-371.922) * (-374.431) (-374.444) [-376.490] (-373.270) -- 0:00:14
764500 -- (-372.826) (-374.148) (-371.711) [-372.575] * (-371.915) [-377.813] (-373.124) (-377.123) -- 0:00:14
765000 -- (-372.431) (-373.854) (-372.690) [-374.976] * (-371.960) (-371.451) [-374.805] (-380.236) -- 0:00:14
Average standard deviation of split frequencies: 0.009267
765500 -- (-371.592) (-373.350) [-374.099] (-373.312) * (-371.692) [-371.895] (-373.258) (-373.456) -- 0:00:14
766000 -- (-373.020) (-376.576) [-372.297] (-373.654) * [-371.455] (-371.235) (-372.709) (-375.300) -- 0:00:14
766500 -- (-371.952) (-373.833) [-372.548] (-372.959) * [-372.306] (-371.442) (-374.612) (-372.899) -- 0:00:14
767000 -- (-373.036) (-372.905) (-373.182) [-372.786] * [-372.542] (-372.199) (-373.867) (-374.556) -- 0:00:13
767500 -- (-372.290) (-373.396) [-374.840] (-373.526) * (-375.848) [-374.906] (-373.700) (-373.956) -- 0:00:13
768000 -- [-372.646] (-375.900) (-372.468) (-372.666) * (-372.993) (-372.359) (-373.820) [-371.387] -- 0:00:13
768500 -- [-372.086] (-374.672) (-374.429) (-372.236) * (-372.978) (-372.163) [-375.053] (-372.140) -- 0:00:13
769000 -- (-373.302) [-373.677] (-373.426) (-371.767) * (-371.998) (-373.194) [-374.391] (-372.498) -- 0:00:13
769500 -- (-373.450) [-373.284] (-372.994) (-371.848) * (-372.407) (-372.439) (-372.647) [-372.704] -- 0:00:13
770000 -- (-372.825) (-376.348) (-374.487) [-372.566] * (-372.488) (-372.495) [-375.586] (-375.381) -- 0:00:13
Average standard deviation of split frequencies: 0.009596
770500 -- [-373.805] (-371.364) (-376.008) (-375.427) * (-372.248) (-374.514) [-375.654] (-374.266) -- 0:00:13
771000 -- (-372.245) (-373.026) [-372.167] (-373.693) * (-374.709) (-374.000) [-375.420] (-371.883) -- 0:00:13
771500 -- (-374.243) (-372.032) [-372.850] (-372.782) * (-374.919) [-373.643] (-373.256) (-372.577) -- 0:00:13
772000 -- (-375.496) (-373.065) (-375.287) [-372.756] * (-378.574) (-372.704) [-374.235] (-373.213) -- 0:00:13
772500 -- (-372.468) (-374.644) [-372.303] (-375.035) * (-375.109) (-372.587) (-374.526) [-372.294] -- 0:00:13
773000 -- (-375.482) (-373.243) [-374.123] (-377.640) * (-376.366) (-373.521) (-372.171) [-371.661] -- 0:00:13
773500 -- (-373.466) (-376.524) (-371.330) [-371.802] * (-372.504) (-376.621) (-373.535) [-372.742] -- 0:00:13
774000 -- [-372.545] (-371.397) (-371.554) (-371.903) * (-372.031) (-372.402) (-374.574) [-372.650] -- 0:00:13
774500 -- (-371.372) (-372.889) (-372.259) [-372.931] * [-374.614] (-372.814) (-374.094) (-377.150) -- 0:00:13
775000 -- [-372.043] (-377.317) (-372.896) (-374.308) * [-374.846] (-376.769) (-375.959) (-373.047) -- 0:00:13
Average standard deviation of split frequencies: 0.009378
775500 -- [-373.451] (-373.899) (-372.755) (-373.697) * [-371.782] (-375.535) (-377.886) (-377.868) -- 0:00:13
776000 -- (-375.428) (-372.868) (-374.422) [-373.445] * (-373.859) (-373.279) (-373.388) [-372.193] -- 0:00:13
776500 -- (-372.962) [-373.013] (-374.183) (-372.217) * (-372.687) (-372.052) [-373.420] (-373.391) -- 0:00:13
777000 -- (-375.310) (-372.906) [-371.813] (-371.245) * (-373.988) [-373.267] (-373.448) (-374.262) -- 0:00:13
777500 -- (-375.362) [-374.584] (-373.549) (-372.662) * (-374.871) [-372.594] (-373.724) (-374.278) -- 0:00:13
778000 -- [-375.564] (-374.433) (-374.020) (-371.805) * (-375.007) (-374.472) [-372.483] (-373.154) -- 0:00:13
778500 -- (-374.819) (-371.722) [-371.915] (-373.052) * (-373.790) (-373.747) (-372.119) [-372.345] -- 0:00:13
779000 -- [-375.302] (-375.592) (-372.746) (-372.209) * (-376.363) (-374.555) [-374.311] (-376.501) -- 0:00:13
779500 -- (-375.950) (-374.085) [-375.020] (-373.967) * (-374.100) (-374.034) [-372.975] (-372.841) -- 0:00:13
780000 -- (-373.485) (-372.018) [-372.385] (-373.707) * [-376.249] (-373.218) (-378.025) (-375.503) -- 0:00:12
Average standard deviation of split frequencies: 0.009095
780500 -- [-372.061] (-375.587) (-372.887) (-378.404) * (-373.157) (-376.821) (-373.731) [-375.703] -- 0:00:13
781000 -- (-372.386) [-372.254] (-372.962) (-377.789) * (-373.874) (-373.080) (-376.119) [-379.115] -- 0:00:13
781500 -- [-373.430] (-376.727) (-373.386) (-374.736) * [-373.930] (-374.746) (-372.877) (-376.521) -- 0:00:13
782000 -- [-371.869] (-371.750) (-373.840) (-374.330) * (-373.038) (-373.926) (-376.404) [-372.852] -- 0:00:13
782500 -- (-373.447) [-375.557] (-374.229) (-372.421) * [-376.767] (-372.922) (-374.054) (-375.232) -- 0:00:13
783000 -- (-374.350) (-372.421) [-373.020] (-373.970) * (-377.437) (-376.560) [-374.550] (-372.842) -- 0:00:13
783500 -- (-373.666) (-373.911) (-373.350) [-371.383] * (-377.260) (-373.287) (-372.370) [-373.390] -- 0:00:12
784000 -- (-379.443) (-372.559) (-373.257) [-374.596] * (-374.356) (-374.179) [-376.898] (-371.874) -- 0:00:12
784500 -- (-374.775) (-374.635) (-376.354) [-372.527] * (-375.331) [-374.646] (-372.821) (-374.230) -- 0:00:12
785000 -- (-375.483) (-372.521) (-377.064) [-373.659] * (-375.713) (-372.433) [-374.181] (-376.952) -- 0:00:12
Average standard deviation of split frequencies: 0.008921
785500 -- (-372.988) (-373.526) (-377.507) [-372.848] * (-376.045) (-371.943) [-374.006] (-376.624) -- 0:00:12
786000 -- (-376.096) (-377.247) (-377.497) [-375.047] * (-373.354) [-372.595] (-374.564) (-378.198) -- 0:00:12
786500 -- [-371.437] (-373.182) (-376.582) (-373.422) * [-372.071] (-372.121) (-372.761) (-375.317) -- 0:00:12
787000 -- [-374.373] (-371.918) (-371.785) (-381.381) * [-372.409] (-374.860) (-379.349) (-373.966) -- 0:00:12
787500 -- [-378.874] (-377.499) (-371.459) (-374.705) * (-372.050) (-373.076) (-371.915) [-373.356] -- 0:00:12
788000 -- (-375.506) (-373.901) [-373.005] (-372.929) * (-374.295) (-375.255) [-372.736] (-373.191) -- 0:00:12
788500 -- (-373.339) (-373.892) (-372.746) [-374.970] * [-372.840] (-373.944) (-374.316) (-373.530) -- 0:00:12
789000 -- (-373.188) (-373.726) (-373.170) [-373.341] * (-379.809) (-373.582) [-372.624] (-374.195) -- 0:00:12
789500 -- (-373.538) [-373.673] (-374.123) (-373.253) * (-374.892) (-372.422) [-371.835] (-373.449) -- 0:00:12
790000 -- [-373.244] (-373.380) (-372.915) (-374.637) * [-371.787] (-372.924) (-375.932) (-377.050) -- 0:00:12
Average standard deviation of split frequencies: 0.009241
790500 -- (-373.427) (-372.989) (-375.583) [-372.656] * (-374.527) (-375.767) [-375.551] (-372.930) -- 0:00:12
791000 -- [-372.074] (-372.870) (-376.172) (-373.206) * [-375.372] (-373.283) (-373.571) (-372.214) -- 0:00:12
791500 -- (-373.151) (-374.321) [-374.831] (-372.496) * (-375.012) [-373.965] (-371.861) (-373.569) -- 0:00:12
792000 -- [-377.333] (-372.023) (-376.616) (-372.380) * (-371.808) [-374.271] (-374.174) (-374.166) -- 0:00:12
792500 -- [-373.238] (-373.035) (-373.441) (-372.657) * (-375.557) (-375.147) (-373.992) [-373.596] -- 0:00:12
793000 -- (-373.739) [-372.668] (-372.503) (-373.671) * [-373.021] (-374.665) (-371.976) (-373.566) -- 0:00:12
793500 -- [-372.309] (-374.222) (-373.072) (-373.732) * (-372.070) (-377.281) [-376.079] (-371.732) -- 0:00:12
794000 -- [-372.361] (-371.886) (-373.491) (-371.803) * (-372.870) (-382.342) [-373.974] (-373.081) -- 0:00:12
794500 -- (-374.435) (-372.982) (-373.683) [-373.163] * (-380.480) [-375.912] (-373.056) (-372.822) -- 0:00:12
795000 -- (-372.507) [-372.870] (-373.672) (-375.466) * (-376.176) [-379.615] (-373.732) (-373.909) -- 0:00:12
Average standard deviation of split frequencies: 0.009179
795500 -- [-374.168] (-372.286) (-373.619) (-373.593) * [-372.600] (-376.467) (-373.905) (-376.388) -- 0:00:12
796000 -- (-372.907) [-373.143] (-374.128) (-374.598) * [-373.246] (-377.569) (-375.380) (-374.255) -- 0:00:12
796500 -- (-374.948) (-375.019) (-371.704) [-374.017] * [-371.679] (-372.721) (-375.105) (-375.364) -- 0:00:12
797000 -- [-373.181] (-379.055) (-374.522) (-375.590) * (-372.530) [-373.139] (-374.436) (-375.099) -- 0:00:11
797500 -- (-372.567) [-374.522] (-374.187) (-374.397) * (-373.017) (-372.454) (-375.300) [-372.905] -- 0:00:12
798000 -- (-374.249) (-374.462) (-376.327) [-373.343] * (-372.683) (-374.357) [-375.586] (-372.037) -- 0:00:12
798500 -- (-375.210) (-371.635) (-375.018) [-371.903] * (-374.613) (-372.900) [-377.877] (-371.506) -- 0:00:12
799000 -- (-378.875) [-372.007] (-376.945) (-374.383) * [-372.400] (-374.171) (-372.740) (-373.486) -- 0:00:12
799500 -- (-373.170) [-373.967] (-373.683) (-375.106) * (-376.712) (-373.217) (-374.393) [-372.766] -- 0:00:12
800000 -- [-374.200] (-376.409) (-371.756) (-376.212) * (-376.393) (-373.654) (-371.695) [-373.252] -- 0:00:12
Average standard deviation of split frequencies: 0.009347
800500 -- (-373.102) (-375.757) (-372.533) [-376.448] * [-374.119] (-371.598) (-371.625) (-375.399) -- 0:00:11
801000 -- [-372.392] (-372.247) (-371.941) (-373.379) * (-372.580) (-374.644) (-377.592) [-371.571] -- 0:00:11
801500 -- (-372.534) (-372.926) (-371.940) [-373.825] * [-372.041] (-373.876) (-372.348) (-373.791) -- 0:00:11
802000 -- (-372.187) (-378.376) [-374.419] (-371.572) * [-372.017] (-379.631) (-372.765) (-373.221) -- 0:00:11
802500 -- (-377.963) [-372.876] (-374.828) (-372.992) * (-372.675) (-376.188) [-372.227] (-373.678) -- 0:00:11
803000 -- (-379.871) (-379.691) [-372.416] (-371.589) * (-375.339) (-373.990) (-373.426) [-371.898] -- 0:00:11
803500 -- (-374.199) (-373.122) [-374.196] (-373.226) * (-371.957) [-373.025] (-371.767) (-374.533) -- 0:00:11
804000 -- [-372.467] (-378.135) (-373.984) (-371.718) * [-373.861] (-376.135) (-372.025) (-372.226) -- 0:00:11
804500 -- (-373.348) [-371.819] (-373.296) (-372.435) * (-376.254) [-376.886] (-371.495) (-372.025) -- 0:00:11
805000 -- (-374.408) (-372.684) [-374.801] (-374.907) * (-372.452) [-377.912] (-373.442) (-376.317) -- 0:00:11
Average standard deviation of split frequencies: 0.009321
805500 -- (-375.500) [-372.704] (-372.388) (-374.296) * [-373.221] (-377.554) (-373.465) (-372.862) -- 0:00:11
806000 -- (-374.231) (-372.714) (-372.920) [-371.952] * (-372.043) [-375.251] (-381.663) (-372.529) -- 0:00:11
806500 -- (-374.371) [-372.178] (-374.259) (-372.166) * (-371.973) (-374.868) [-373.415] (-374.412) -- 0:00:11
807000 -- (-373.248) (-373.826) [-371.970] (-373.245) * [-374.840] (-373.298) (-372.746) (-371.932) -- 0:00:11
807500 -- (-378.534) (-377.044) [-371.524] (-380.571) * (-372.658) (-372.851) [-374.082] (-373.115) -- 0:00:11
808000 -- [-375.569] (-374.526) (-371.767) (-379.465) * [-377.069] (-373.478) (-376.967) (-372.970) -- 0:00:11
808500 -- [-372.241] (-372.308) (-372.638) (-373.399) * [-374.104] (-378.114) (-372.846) (-374.458) -- 0:00:11
809000 -- (-372.585) (-376.580) (-374.293) [-372.709] * (-378.064) (-372.652) (-371.605) [-375.189] -- 0:00:11
809500 -- [-372.324] (-376.602) (-373.334) (-373.519) * (-375.814) [-371.641] (-375.479) (-381.587) -- 0:00:11
810000 -- (-375.448) (-372.887) [-374.501] (-374.219) * (-375.621) (-372.281) (-372.807) [-372.502] -- 0:00:11
Average standard deviation of split frequencies: 0.009740
810500 -- (-374.500) [-374.667] (-374.500) (-372.970) * (-380.566) [-377.708] (-373.046) (-374.215) -- 0:00:11
811000 -- (-372.734) (-372.089) (-374.680) [-372.011] * (-376.739) (-373.399) [-374.750] (-377.119) -- 0:00:11
811500 -- (-378.089) [-375.469] (-373.254) (-372.730) * [-374.610] (-374.873) (-374.680) (-376.251) -- 0:00:11
812000 -- (-374.460) [-378.129] (-373.303) (-379.869) * (-372.277) [-374.820] (-375.801) (-374.302) -- 0:00:11
812500 -- (-373.108) [-375.755] (-372.995) (-379.610) * [-373.366] (-373.469) (-372.639) (-376.681) -- 0:00:11
813000 -- (-372.029) (-375.703) (-375.348) [-372.840] * [-373.136] (-374.148) (-373.620) (-373.661) -- 0:00:11
813500 -- (-376.444) [-375.918] (-372.494) (-372.109) * (-373.716) (-375.343) [-372.721] (-372.349) -- 0:00:11
814000 -- (-371.982) [-374.179] (-374.579) (-375.377) * (-372.233) [-376.371] (-375.094) (-379.875) -- 0:00:10
814500 -- (-371.887) (-372.707) [-372.716] (-374.785) * [-371.719] (-378.142) (-373.396) (-376.747) -- 0:00:11
815000 -- (-373.703) (-375.392) [-373.262] (-376.212) * (-373.802) (-374.027) (-373.517) [-376.607] -- 0:00:11
Average standard deviation of split frequencies: 0.009568
815500 -- (-374.495) [-372.680] (-375.671) (-376.649) * (-372.042) (-373.276) [-374.673] (-379.094) -- 0:00:11
816000 -- [-374.915] (-374.370) (-371.705) (-375.521) * [-373.076] (-374.697) (-373.700) (-375.125) -- 0:00:11
816500 -- (-374.028) [-374.061] (-371.962) (-375.430) * (-378.898) (-375.065) [-374.547] (-374.424) -- 0:00:11
817000 -- (-373.344) (-374.867) [-378.297] (-373.826) * [-373.409] (-373.544) (-374.762) (-375.603) -- 0:00:10
817500 -- (-375.002) (-374.167) (-372.956) [-373.709] * [-372.605] (-373.862) (-376.099) (-373.190) -- 0:00:10
818000 -- (-373.537) [-372.658] (-374.904) (-372.654) * (-372.579) (-372.469) (-372.530) [-372.656] -- 0:00:10
818500 -- (-372.307) (-373.719) [-372.391] (-373.153) * (-372.298) (-373.667) (-373.399) [-371.633] -- 0:00:10
819000 -- [-374.312] (-372.163) (-373.601) (-374.454) * [-375.689] (-372.735) (-371.923) (-374.790) -- 0:00:10
819500 -- [-371.553] (-373.568) (-377.163) (-373.878) * (-374.778) (-372.826) (-373.251) [-375.534] -- 0:00:10
820000 -- (-372.323) (-372.901) [-371.622] (-375.813) * (-372.233) (-373.895) [-375.066] (-374.383) -- 0:00:10
Average standard deviation of split frequencies: 0.009298
820500 -- (-376.742) (-376.558) (-373.803) [-373.312] * (-379.667) [-376.264] (-371.683) (-374.145) -- 0:00:10
821000 -- (-378.602) [-371.757] (-374.501) (-372.958) * (-376.539) (-375.663) [-371.987] (-374.453) -- 0:00:10
821500 -- (-372.181) (-372.363) (-373.286) [-371.707] * (-372.553) (-373.862) [-372.573] (-375.974) -- 0:00:10
822000 -- (-373.341) (-372.404) [-374.479] (-372.051) * [-375.257] (-372.272) (-375.988) (-380.519) -- 0:00:10
822500 -- (-372.591) (-372.946) (-373.135) [-373.012] * [-371.548] (-372.068) (-373.942) (-377.718) -- 0:00:10
823000 -- [-372.508] (-375.368) (-371.802) (-373.369) * (-372.996) (-374.919) [-373.452] (-372.982) -- 0:00:10
823500 -- (-371.987) (-371.929) (-373.793) [-373.274] * (-371.992) [-373.596] (-372.508) (-372.629) -- 0:00:10
824000 -- [-372.035] (-372.485) (-381.998) (-373.968) * (-371.798) (-376.247) [-374.925] (-377.551) -- 0:00:10
824500 -- (-372.839) [-372.369] (-374.810) (-374.191) * (-378.219) [-375.548] (-373.434) (-377.579) -- 0:00:10
825000 -- (-372.863) [-372.356] (-375.078) (-377.596) * [-377.055] (-374.781) (-376.404) (-378.027) -- 0:00:10
Average standard deviation of split frequencies: 0.008989
825500 -- (-372.219) [-375.833] (-373.607) (-374.061) * (-375.320) (-374.750) (-372.033) [-373.947] -- 0:00:10
826000 -- (-373.560) [-372.558] (-373.695) (-373.942) * (-376.239) [-374.521] (-371.736) (-373.755) -- 0:00:10
826500 -- (-372.297) (-374.231) (-375.284) [-372.502] * (-378.660) [-371.819] (-372.175) (-372.642) -- 0:00:10
827000 -- (-372.243) (-372.345) [-375.417] (-372.600) * (-373.192) (-371.881) [-374.682] (-372.669) -- 0:00:10
827500 -- (-376.161) (-372.563) (-371.925) [-372.256] * [-373.662] (-373.196) (-374.217) (-373.106) -- 0:00:10
828000 -- (-372.841) [-372.270] (-374.737) (-374.484) * [-372.388] (-373.577) (-373.044) (-372.999) -- 0:00:10
828500 -- (-373.287) (-372.304) [-374.462] (-375.190) * [-372.276] (-372.627) (-372.410) (-374.383) -- 0:00:10
829000 -- [-371.606] (-372.429) (-374.633) (-373.073) * (-371.813) (-374.133) [-371.462] (-376.060) -- 0:00:10
829500 -- [-374.235] (-373.285) (-371.709) (-373.407) * (-372.513) (-375.998) [-374.236] (-374.539) -- 0:00:10
830000 -- [-374.957] (-373.760) (-375.064) (-373.761) * (-371.489) [-375.480] (-373.337) (-374.167) -- 0:00:10
Average standard deviation of split frequencies: 0.008761
830500 -- (-372.590) [-377.483] (-374.457) (-375.044) * (-373.204) (-373.671) [-373.771] (-376.664) -- 0:00:10
831000 -- [-373.370] (-380.336) (-374.177) (-372.166) * (-377.425) (-372.683) [-373.520] (-374.198) -- 0:00:09
831500 -- (-374.105) (-372.591) (-376.991) [-371.636] * [-374.691] (-374.159) (-373.733) (-375.158) -- 0:00:10
832000 -- [-376.004] (-374.035) (-372.683) (-373.914) * [-373.534] (-371.722) (-371.659) (-372.792) -- 0:00:10
832500 -- (-371.836) (-376.648) [-372.094] (-373.934) * [-376.295] (-374.474) (-374.922) (-373.252) -- 0:00:10
833000 -- (-371.950) (-373.871) (-374.347) [-372.383] * (-376.858) (-374.969) (-371.451) [-373.248] -- 0:00:10
833500 -- [-371.980] (-374.098) (-375.026) (-378.521) * (-372.075) (-372.385) (-372.510) [-374.387] -- 0:00:09
834000 -- [-371.849] (-373.976) (-376.118) (-379.331) * (-373.533) (-372.380) (-372.663) [-374.747] -- 0:00:09
834500 -- (-371.350) (-372.258) [-374.328] (-375.900) * (-375.167) (-372.202) [-372.697] (-373.019) -- 0:00:09
835000 -- (-372.455) [-374.112] (-375.586) (-373.447) * (-376.214) (-374.756) [-373.045] (-378.434) -- 0:00:09
Average standard deviation of split frequencies: 0.008352
835500 -- [-372.533] (-378.152) (-371.900) (-374.823) * (-372.158) [-375.252] (-374.049) (-374.571) -- 0:00:09
836000 -- (-373.114) (-375.544) [-373.957] (-373.079) * (-371.704) (-373.611) [-373.799] (-372.264) -- 0:00:09
836500 -- (-372.814) (-374.829) [-375.495] (-373.984) * [-372.546] (-373.981) (-372.563) (-372.323) -- 0:00:09
837000 -- [-374.129] (-372.104) (-375.902) (-372.601) * [-373.178] (-375.775) (-377.794) (-376.066) -- 0:00:09
837500 -- (-374.901) (-372.286) (-372.791) [-373.670] * [-373.001] (-374.517) (-373.985) (-374.865) -- 0:00:09
838000 -- (-375.173) (-372.257) [-371.989] (-372.575) * (-375.093) [-374.784] (-374.654) (-373.390) -- 0:00:09
838500 -- [-379.697] (-372.696) (-374.861) (-377.617) * (-372.046) [-374.105] (-374.705) (-378.477) -- 0:00:09
839000 -- (-378.337) (-373.593) (-373.735) [-372.856] * (-376.353) (-374.125) [-371.497] (-374.091) -- 0:00:09
839500 -- (-377.110) (-373.356) (-372.542) [-375.722] * [-371.779] (-374.404) (-371.514) (-374.981) -- 0:00:09
840000 -- (-372.659) [-371.470] (-375.019) (-377.402) * (-373.024) (-373.426) [-374.915] (-376.394) -- 0:00:09
Average standard deviation of split frequencies: 0.008411
840500 -- (-377.117) (-375.408) (-372.003) [-375.421] * [-371.980] (-373.279) (-376.706) (-376.138) -- 0:00:09
841000 -- (-372.848) [-373.124] (-372.249) (-377.449) * (-372.802) [-373.747] (-374.704) (-376.033) -- 0:00:09
841500 -- (-376.844) [-374.514] (-371.535) (-373.219) * (-376.208) (-374.593) [-374.811] (-376.285) -- 0:00:09
842000 -- (-372.037) (-377.610) [-373.075] (-372.639) * (-374.464) [-373.215] (-373.070) (-375.634) -- 0:00:09
842500 -- (-376.147) (-372.039) (-376.153) [-372.291] * (-374.165) [-372.945] (-375.601) (-377.658) -- 0:00:09
843000 -- [-374.933] (-373.628) (-372.234) (-373.131) * (-372.200) (-373.259) [-372.035] (-372.527) -- 0:00:09
843500 -- (-372.472) (-374.567) (-372.010) [-372.318] * [-374.098] (-373.691) (-372.415) (-375.456) -- 0:00:09
844000 -- (-372.970) (-372.323) (-375.003) [-378.463] * (-375.398) (-372.429) [-374.952] (-374.058) -- 0:00:09
844500 -- (-374.981) (-374.224) [-374.788] (-373.002) * (-372.178) (-373.656) (-373.863) [-373.976] -- 0:00:09
845000 -- (-375.085) (-376.210) (-374.256) [-371.772] * (-375.332) [-371.642] (-373.518) (-371.477) -- 0:00:09
Average standard deviation of split frequencies: 0.008428
845500 -- (-374.774) [-376.134] (-372.733) (-371.719) * (-373.920) (-373.443) [-375.087] (-371.824) -- 0:00:09
846000 -- (-373.377) (-371.784) [-372.583] (-372.661) * (-372.364) [-372.875] (-378.138) (-371.603) -- 0:00:09
846500 -- (-375.339) (-374.497) (-375.313) [-372.519] * (-375.049) (-372.148) (-377.865) [-373.037] -- 0:00:09
847000 -- (-375.711) (-371.237) (-371.794) [-373.176] * (-373.161) [-372.580] (-374.209) (-373.075) -- 0:00:09
847500 -- (-373.825) (-373.250) (-371.153) [-373.180] * [-371.908] (-371.613) (-374.933) (-373.241) -- 0:00:08
848000 -- (-374.814) (-372.763) (-371.688) [-375.913] * (-372.647) [-371.936] (-372.038) (-373.949) -- 0:00:08
848500 -- (-374.938) (-372.541) (-371.739) [-373.725] * [-375.201] (-372.036) (-372.172) (-372.897) -- 0:00:08
849000 -- (-374.224) (-376.169) (-374.584) [-376.727] * (-375.249) (-374.986) (-373.705) [-372.670] -- 0:00:09
849500 -- (-371.759) (-375.323) [-372.480] (-373.063) * (-372.057) (-372.673) [-374.471] (-371.506) -- 0:00:09
850000 -- (-373.786) (-375.255) (-371.974) [-374.747] * (-377.684) (-372.255) [-373.315] (-372.838) -- 0:00:09
Average standard deviation of split frequencies: 0.008278
850500 -- [-372.891] (-373.567) (-373.318) (-375.425) * [-371.650] (-375.006) (-375.077) (-372.413) -- 0:00:08
851000 -- (-371.380) (-371.910) [-372.333] (-374.203) * [-371.658] (-375.438) (-373.061) (-375.071) -- 0:00:08
851500 -- (-371.540) [-371.446] (-374.213) (-372.568) * [-374.824] (-373.210) (-372.034) (-371.234) -- 0:00:08
852000 -- (-372.873) (-379.903) (-371.900) [-371.795] * [-371.938] (-374.710) (-374.670) (-373.740) -- 0:00:08
852500 -- (-371.370) (-375.231) (-376.807) [-374.173] * [-373.106] (-372.427) (-375.891) (-372.894) -- 0:00:08
853000 -- (-371.732) [-373.951] (-374.993) (-376.371) * [-372.334] (-372.326) (-372.687) (-375.180) -- 0:00:08
853500 -- (-372.006) [-379.183] (-371.967) (-373.040) * [-375.680] (-374.013) (-374.644) (-373.862) -- 0:00:08
854000 -- [-373.431] (-375.179) (-373.355) (-372.024) * [-372.497] (-375.271) (-375.749) (-374.958) -- 0:00:08
854500 -- (-372.523) (-374.351) [-372.433] (-372.835) * [-373.067] (-371.772) (-374.037) (-373.506) -- 0:00:08
855000 -- (-374.479) (-377.868) [-372.259] (-372.239) * (-373.037) (-372.963) [-371.564] (-373.145) -- 0:00:08
Average standard deviation of split frequencies: 0.008226
855500 -- (-378.599) (-373.080) [-375.197] (-371.433) * (-375.552) [-371.906] (-372.662) (-373.563) -- 0:00:08
856000 -- (-371.828) (-377.477) [-373.375] (-372.182) * (-373.000) (-373.897) (-371.553) [-372.738] -- 0:00:08
856500 -- (-372.266) [-375.263] (-372.214) (-374.309) * (-377.739) [-372.748] (-374.881) (-372.054) -- 0:00:08
857000 -- [-373.265] (-372.151) (-374.768) (-375.090) * (-371.962) (-373.256) [-375.458] (-371.978) -- 0:00:08
857500 -- [-372.383] (-373.347) (-374.548) (-373.971) * (-372.222) [-373.115] (-379.284) (-371.943) -- 0:00:08
858000 -- (-373.267) (-373.995) [-372.372] (-374.768) * (-374.127) [-372.811] (-372.676) (-373.487) -- 0:00:08
858500 -- (-371.673) (-379.736) [-372.370] (-376.167) * (-374.287) [-372.392] (-372.622) (-375.803) -- 0:00:08
859000 -- [-373.494] (-379.065) (-372.259) (-374.334) * (-379.078) [-376.480] (-375.264) (-373.887) -- 0:00:08
859500 -- (-374.424) (-377.320) (-378.017) [-374.117] * [-372.188] (-374.449) (-373.346) (-375.497) -- 0:00:08
860000 -- (-372.025) (-379.532) (-374.416) [-372.541] * (-372.407) (-373.876) (-374.297) [-373.541] -- 0:00:08
Average standard deviation of split frequencies: 0.008079
860500 -- (-371.967) [-376.763] (-374.286) (-372.348) * (-376.048) [-376.772] (-374.087) (-376.099) -- 0:00:08
861000 -- (-374.111) (-373.024) (-376.286) [-373.434] * (-374.617) (-372.159) (-374.202) [-373.816] -- 0:00:08
861500 -- [-373.512] (-373.225) (-376.416) (-372.958) * [-375.293] (-373.701) (-375.774) (-374.419) -- 0:00:08
862000 -- [-374.120] (-371.532) (-375.076) (-372.155) * (-374.997) [-371.939] (-371.907) (-376.156) -- 0:00:08
862500 -- (-374.852) (-372.418) (-374.472) [-373.383] * (-374.102) (-371.926) [-373.963] (-375.588) -- 0:00:08
863000 -- (-371.895) (-373.391) [-379.921] (-377.842) * (-373.156) [-371.395] (-374.712) (-373.318) -- 0:00:08
863500 -- [-372.687] (-372.931) (-374.090) (-373.060) * (-375.007) [-372.831] (-373.245) (-379.784) -- 0:00:08
864000 -- (-372.939) (-373.690) (-372.545) [-373.173] * (-373.031) (-372.523) [-374.526] (-375.801) -- 0:00:08
864500 -- (-372.608) (-372.759) (-372.949) [-372.354] * [-374.084] (-375.703) (-378.031) (-376.373) -- 0:00:07
865000 -- (-373.190) (-376.570) (-373.087) [-372.694] * (-372.089) [-371.440] (-373.920) (-375.596) -- 0:00:07
Average standard deviation of split frequencies: 0.008199
865500 -- (-373.824) [-379.009] (-375.210) (-374.285) * (-373.643) (-373.041) [-374.021] (-372.750) -- 0:00:08
866000 -- [-372.649] (-372.919) (-373.343) (-376.804) * (-373.546) (-373.948) [-374.168] (-373.836) -- 0:00:08
866500 -- (-372.640) [-372.229] (-372.360) (-371.713) * [-372.589] (-373.319) (-373.702) (-374.106) -- 0:00:08
867000 -- (-376.627) [-371.906] (-372.125) (-373.788) * (-372.108) [-373.693] (-373.419) (-374.752) -- 0:00:07
867500 -- (-374.538) (-375.533) [-372.726] (-374.090) * [-373.678] (-372.507) (-373.342) (-374.041) -- 0:00:07
868000 -- (-373.916) (-372.698) (-376.906) [-375.615] * (-374.729) [-374.272] (-377.457) (-373.822) -- 0:00:07
868500 -- (-375.034) [-371.810] (-378.692) (-371.996) * (-373.098) [-373.219] (-372.719) (-374.220) -- 0:00:07
869000 -- (-372.160) (-375.862) [-374.301] (-374.726) * (-376.005) [-372.238] (-373.788) (-377.363) -- 0:00:07
869500 -- (-372.793) (-371.952) (-374.359) [-371.851] * (-373.114) [-373.338] (-374.181) (-372.801) -- 0:00:07
870000 -- (-375.864) [-373.423] (-372.288) (-372.477) * (-372.830) (-373.456) [-372.635] (-373.573) -- 0:00:07
Average standard deviation of split frequencies: 0.008223
870500 -- (-375.964) [-378.185] (-375.829) (-372.103) * (-373.700) (-375.753) [-375.113] (-373.623) -- 0:00:07
871000 -- (-371.781) [-373.936] (-373.299) (-373.354) * [-375.131] (-372.491) (-375.062) (-376.261) -- 0:00:07
871500 -- [-373.223] (-374.312) (-374.668) (-374.003) * (-375.588) (-374.351) [-373.710] (-374.851) -- 0:00:07
872000 -- [-374.729] (-372.106) (-372.789) (-373.719) * (-374.325) (-374.065) [-373.821] (-373.575) -- 0:00:07
872500 -- (-374.284) [-373.776] (-374.303) (-374.540) * [-373.298] (-375.081) (-374.633) (-373.406) -- 0:00:07
873000 -- (-373.389) (-375.591) (-374.239) [-373.013] * [-373.998] (-372.583) (-374.497) (-371.906) -- 0:00:07
873500 -- (-374.287) (-376.583) (-372.614) [-372.830] * [-373.569] (-373.844) (-372.701) (-372.172) -- 0:00:07
874000 -- (-373.074) (-377.013) (-373.694) [-371.942] * [-373.503] (-372.367) (-373.825) (-377.324) -- 0:00:07
874500 -- (-375.048) [-374.579] (-377.408) (-372.626) * (-372.610) (-373.678) [-374.201] (-376.418) -- 0:00:07
875000 -- (-372.746) [-372.419] (-373.670) (-374.628) * (-375.067) (-371.733) [-372.268] (-372.120) -- 0:00:07
Average standard deviation of split frequencies: 0.008274
875500 -- (-373.142) (-375.012) [-373.594] (-375.212) * [-371.770] (-374.597) (-372.363) (-375.644) -- 0:00:07
876000 -- (-372.450) [-372.212] (-375.689) (-373.856) * [-373.425] (-374.856) (-372.485) (-376.903) -- 0:00:07
876500 -- (-372.149) [-372.068] (-377.260) (-371.854) * (-372.244) (-373.509) [-372.703] (-375.524) -- 0:00:07
877000 -- (-373.324) [-373.480] (-371.632) (-378.978) * [-373.696] (-372.376) (-374.128) (-372.229) -- 0:00:07
877500 -- (-372.583) [-376.276] (-372.406) (-374.511) * (-380.305) [-372.153] (-372.154) (-374.042) -- 0:00:07
878000 -- (-374.014) (-376.269) (-373.640) [-378.907] * (-376.400) (-373.180) (-373.036) [-372.630] -- 0:00:07
878500 -- (-374.559) (-372.535) (-374.018) [-374.286] * (-374.591) (-372.791) [-373.408] (-373.409) -- 0:00:07
879000 -- (-373.265) [-375.906] (-372.536) (-375.765) * (-375.928) (-372.988) (-375.631) [-372.803] -- 0:00:07
879500 -- (-371.797) (-375.135) [-375.877] (-373.592) * (-375.278) (-372.384) (-371.499) [-372.858] -- 0:00:07
880000 -- (-372.098) (-373.812) (-372.874) [-375.332] * (-374.594) [-373.311] (-377.468) (-371.532) -- 0:00:07
Average standard deviation of split frequencies: 0.008063
880500 -- (-375.196) (-375.173) [-375.428] (-372.877) * [-377.389] (-376.262) (-376.196) (-372.057) -- 0:00:07
881000 -- [-376.613] (-373.216) (-378.996) (-373.143) * (-373.328) (-376.945) [-374.697] (-372.969) -- 0:00:07
881500 -- (-374.667) (-372.712) [-376.908] (-372.975) * (-373.922) [-373.855] (-373.081) (-375.070) -- 0:00:06
882000 -- (-374.022) (-371.407) (-375.044) [-372.562] * (-373.232) (-375.189) (-374.955) [-372.587] -- 0:00:06
882500 -- (-373.921) [-374.089] (-376.780) (-374.823) * (-374.723) [-371.617] (-371.542) (-375.069) -- 0:00:07
883000 -- (-373.670) (-373.250) (-372.163) [-375.780] * (-375.593) [-372.578] (-371.784) (-373.537) -- 0:00:07
883500 -- (-373.136) (-375.917) [-374.705] (-376.237) * [-372.358] (-372.581) (-375.375) (-373.211) -- 0:00:06
884000 -- (-371.740) (-375.916) (-374.258) [-374.109] * (-372.735) (-372.215) [-373.835] (-371.656) -- 0:00:06
884500 -- (-373.995) (-373.538) [-374.467] (-373.286) * [-372.726] (-371.846) (-374.309) (-371.394) -- 0:00:06
885000 -- (-373.648) (-371.970) [-376.362] (-374.836) * (-375.598) (-371.811) (-377.955) [-371.565] -- 0:00:06
Average standard deviation of split frequencies: 0.008147
885500 -- (-373.843) [-373.284] (-373.176) (-373.436) * [-372.729] (-372.286) (-375.429) (-374.415) -- 0:00:06
886000 -- (-375.932) (-377.859) (-372.454) [-375.439] * (-375.709) (-373.969) [-374.409] (-372.478) -- 0:00:06
886500 -- (-372.290) [-372.369] (-374.052) (-375.227) * (-374.772) [-372.845] (-372.215) (-373.819) -- 0:00:06
887000 -- [-374.200] (-374.063) (-376.616) (-374.014) * (-376.346) [-372.779] (-378.429) (-372.794) -- 0:00:06
887500 -- (-375.114) [-374.003] (-376.627) (-375.111) * (-373.824) (-376.494) [-371.360] (-372.717) -- 0:00:06
888000 -- (-371.692) [-372.960] (-377.241) (-373.087) * (-375.602) [-373.146] (-374.096) (-374.770) -- 0:00:06
888500 -- (-371.472) (-377.987) [-374.047] (-373.339) * (-373.404) (-374.125) (-372.465) [-375.609] -- 0:00:06
889000 -- (-376.371) (-373.762) [-372.442] (-373.032) * (-378.088) (-376.305) (-374.477) [-371.359] -- 0:00:06
889500 -- (-376.385) (-374.781) [-373.923] (-375.054) * (-372.841) (-374.572) [-374.662] (-373.166) -- 0:00:06
890000 -- (-374.273) (-373.285) (-376.153) [-372.866] * [-371.597] (-374.970) (-372.886) (-372.029) -- 0:00:06
Average standard deviation of split frequencies: 0.008270
890500 -- [-375.175] (-372.602) (-374.084) (-374.443) * (-371.604) (-375.323) [-376.399] (-372.613) -- 0:00:06
891000 -- (-376.300) (-371.930) (-372.982) [-373.244] * (-372.372) (-372.213) (-374.957) [-372.889] -- 0:00:06
891500 -- [-374.001] (-373.777) (-373.320) (-378.664) * (-375.015) (-372.663) [-372.099] (-372.847) -- 0:00:06
892000 -- [-372.026] (-373.782) (-376.491) (-372.000) * (-374.311) (-375.540) (-373.918) [-372.490] -- 0:00:06
892500 -- (-373.544) (-374.372) [-373.857] (-373.174) * (-375.215) [-372.640] (-373.778) (-372.239) -- 0:00:06
893000 -- [-372.563] (-371.326) (-374.609) (-373.529) * (-376.322) [-375.013] (-375.693) (-372.415) -- 0:00:06
893500 -- [-374.298] (-372.415) (-372.990) (-373.445) * (-373.434) [-373.586] (-381.056) (-374.813) -- 0:00:06
894000 -- [-374.681] (-375.641) (-373.484) (-374.792) * (-375.351) (-375.203) [-373.123] (-374.438) -- 0:00:06
894500 -- [-373.176] (-375.517) (-373.773) (-372.377) * (-374.763) [-373.696] (-371.910) (-372.332) -- 0:00:06
895000 -- (-371.561) [-375.851] (-374.115) (-375.301) * (-374.268) (-374.533) (-371.618) [-378.919] -- 0:00:06
Average standard deviation of split frequencies: 0.008615
895500 -- (-374.156) (-373.831) [-371.511] (-374.620) * (-374.242) (-373.201) (-372.656) [-373.436] -- 0:00:06
896000 -- [-372.772] (-373.364) (-373.460) (-372.296) * (-371.699) (-374.037) (-373.330) [-371.800] -- 0:00:06
896500 -- (-372.785) (-371.741) [-372.516] (-371.797) * (-372.414) (-372.215) (-373.771) [-371.767] -- 0:00:06
897000 -- (-375.588) [-371.836] (-376.734) (-371.395) * (-371.476) (-374.341) [-373.805] (-374.187) -- 0:00:06
897500 -- (-372.476) (-372.756) [-374.522] (-376.149) * (-374.507) (-371.808) (-373.570) [-373.220] -- 0:00:06
898000 -- [-375.998] (-372.410) (-371.798) (-378.330) * (-373.520) (-373.669) [-372.378] (-374.283) -- 0:00:06
898500 -- (-374.329) (-372.098) (-376.145) [-377.053] * (-372.423) (-374.823) (-374.902) [-375.006] -- 0:00:06
899000 -- [-374.333] (-371.965) (-375.668) (-375.481) * (-372.421) (-371.674) [-379.043] (-372.566) -- 0:00:06
899500 -- [-375.673] (-371.641) (-373.772) (-372.079) * (-372.383) (-373.137) [-374.585] (-373.668) -- 0:00:06
900000 -- (-373.769) [-373.429] (-372.453) (-372.034) * (-375.321) (-372.936) [-372.094] (-377.396) -- 0:00:06
Average standard deviation of split frequencies: 0.008505
900500 -- [-373.452] (-376.315) (-372.901) (-376.552) * (-378.739) [-371.996] (-377.007) (-373.374) -- 0:00:05
901000 -- (-376.498) (-378.643) [-372.761] (-375.415) * (-376.168) (-373.168) [-372.898] (-374.422) -- 0:00:05
901500 -- (-372.742) (-378.149) [-375.276] (-373.340) * (-375.234) [-376.278] (-374.954) (-381.753) -- 0:00:05
902000 -- [-373.491] (-374.671) (-375.715) (-373.777) * (-372.230) (-375.344) [-373.054] (-377.328) -- 0:00:05
902500 -- (-374.365) (-374.510) [-371.445] (-372.785) * (-375.387) [-372.281] (-372.811) (-371.819) -- 0:00:05
903000 -- (-377.074) [-374.409] (-373.291) (-371.899) * (-374.607) [-372.777] (-372.385) (-376.912) -- 0:00:05
903500 -- (-372.048) (-373.064) (-371.891) [-372.294] * [-371.838] (-375.375) (-372.900) (-377.461) -- 0:00:05
904000 -- [-373.169] (-372.662) (-371.385) (-372.935) * [-379.395] (-372.917) (-372.625) (-375.440) -- 0:00:05
904500 -- (-372.116) (-372.576) (-372.023) [-373.545] * (-379.301) (-372.615) [-372.997] (-377.471) -- 0:00:05
905000 -- (-376.724) (-374.999) (-373.062) [-376.423] * (-374.143) (-373.631) [-372.200] (-374.516) -- 0:00:05
Average standard deviation of split frequencies: 0.008683
905500 -- (-373.522) (-373.901) [-374.202] (-372.389) * (-375.555) (-372.758) (-371.958) [-374.866] -- 0:00:05
906000 -- [-375.452] (-372.159) (-378.662) (-374.742) * (-373.390) [-372.047] (-372.443) (-375.741) -- 0:00:05
906500 -- (-372.675) [-371.856] (-374.071) (-377.634) * (-373.452) (-371.474) [-373.137] (-378.239) -- 0:00:05
907000 -- (-374.976) [-372.761] (-374.974) (-374.037) * [-372.591] (-372.868) (-374.232) (-373.207) -- 0:00:05
907500 -- (-372.924) (-374.831) [-376.257] (-372.319) * (-372.064) [-377.183] (-372.598) (-371.968) -- 0:00:05
908000 -- (-372.375) (-373.338) [-373.724] (-373.672) * (-374.592) [-376.119] (-373.347) (-371.673) -- 0:00:05
908500 -- (-373.495) (-374.065) (-372.699) [-373.272] * (-372.216) [-372.373] (-374.278) (-374.135) -- 0:00:05
909000 -- (-374.416) (-374.480) [-373.258] (-373.658) * [-372.502] (-373.803) (-376.737) (-373.703) -- 0:00:05
909500 -- [-371.332] (-373.952) (-373.612) (-377.634) * (-371.384) (-372.663) (-372.424) [-373.638] -- 0:00:05
910000 -- [-372.082] (-374.133) (-372.331) (-374.418) * [-371.922] (-371.933) (-374.889) (-372.966) -- 0:00:05
Average standard deviation of split frequencies: 0.008735
910500 -- [-373.354] (-372.332) (-373.627) (-374.461) * [-373.611] (-378.454) (-373.151) (-378.382) -- 0:00:05
911000 -- [-373.055] (-373.420) (-376.476) (-372.945) * (-375.467) (-373.079) [-374.826] (-375.130) -- 0:00:05
911500 -- (-371.769) (-373.066) [-372.583] (-373.506) * (-374.393) (-374.654) (-372.594) [-376.875] -- 0:00:05
912000 -- (-372.677) (-373.735) (-372.793) [-372.843] * (-374.115) (-375.992) [-373.477] (-375.492) -- 0:00:05
912500 -- (-373.788) (-372.634) [-371.487] (-374.946) * [-374.104] (-372.934) (-372.930) (-385.661) -- 0:00:05
913000 -- (-376.844) (-377.438) (-371.417) [-372.063] * [-376.274] (-373.685) (-373.999) (-374.436) -- 0:00:05
913500 -- [-372.964] (-374.377) (-372.291) (-372.935) * (-372.661) [-373.998] (-375.376) (-381.067) -- 0:00:05
914000 -- [-372.382] (-372.541) (-375.666) (-374.861) * (-373.273) [-372.171] (-375.079) (-373.481) -- 0:00:05
914500 -- (-381.221) (-372.526) [-374.221] (-371.749) * (-372.629) [-374.024] (-374.109) (-377.959) -- 0:00:05
915000 -- (-374.005) (-375.180) (-371.864) [-372.925] * (-372.658) (-372.285) (-371.902) [-376.441] -- 0:00:05
Average standard deviation of split frequencies: 0.008556
915500 -- [-374.757] (-375.286) (-374.825) (-372.489) * [-373.044] (-374.697) (-373.588) (-372.287) -- 0:00:05
916000 -- [-371.938] (-371.922) (-373.374) (-373.658) * (-372.300) (-377.837) [-376.867] (-374.579) -- 0:00:05
916500 -- [-371.490] (-377.488) (-375.204) (-372.680) * (-372.143) [-372.426] (-375.336) (-372.415) -- 0:00:05
917000 -- (-374.169) (-375.069) [-372.509] (-377.530) * (-373.779) [-372.593] (-375.758) (-373.358) -- 0:00:04
917500 -- (-374.170) (-373.448) (-372.754) [-372.073] * (-375.071) (-372.820) (-372.862) [-372.242] -- 0:00:04
918000 -- (-372.118) (-374.240) (-374.470) [-372.933] * (-377.911) (-373.925) (-372.124) [-373.188] -- 0:00:04
918500 -- (-373.275) (-373.062) [-376.427] (-373.619) * (-373.278) [-373.179] (-373.577) (-374.522) -- 0:00:04
919000 -- (-375.161) (-372.057) (-375.338) [-373.414] * (-371.887) (-375.167) (-380.171) [-374.680] -- 0:00:04
919500 -- [-373.828] (-375.252) (-373.997) (-373.405) * (-376.373) (-378.501) (-373.620) [-375.041] -- 0:00:04
920000 -- (-374.474) [-372.229] (-375.378) (-372.828) * [-376.521] (-379.083) (-372.315) (-381.116) -- 0:00:04
Average standard deviation of split frequencies: 0.008544
920500 -- (-373.344) (-372.538) [-374.127] (-376.174) * (-374.726) (-373.578) (-372.871) [-372.296] -- 0:00:04
921000 -- (-373.993) (-373.875) (-375.807) [-372.963] * (-374.618) (-382.155) [-374.450] (-373.237) -- 0:00:04
921500 -- (-371.529) [-374.123] (-372.876) (-373.909) * (-374.616) (-377.319) (-373.025) [-373.673] -- 0:00:04
922000 -- (-374.075) (-374.316) [-372.077] (-373.321) * [-372.469] (-375.770) (-373.022) (-374.410) -- 0:00:04
922500 -- [-372.308] (-372.809) (-372.866) (-374.434) * (-372.336) (-374.198) [-372.269] (-374.994) -- 0:00:04
923000 -- [-372.641] (-372.126) (-371.858) (-372.645) * [-373.943] (-372.952) (-373.325) (-373.778) -- 0:00:04
923500 -- [-373.780] (-373.187) (-372.153) (-372.018) * (-373.954) [-371.846] (-373.341) (-372.016) -- 0:00:04
924000 -- (-375.702) [-374.685] (-372.607) (-372.025) * (-372.338) [-375.490] (-376.959) (-372.460) -- 0:00:04
924500 -- [-372.141] (-372.080) (-374.428) (-376.774) * (-377.042) (-373.340) [-372.469] (-375.640) -- 0:00:04
925000 -- (-383.816) [-371.458] (-374.782) (-372.432) * (-373.230) (-373.639) [-373.964] (-375.052) -- 0:00:04
Average standard deviation of split frequencies: 0.008272
925500 -- [-375.971] (-371.443) (-378.530) (-373.018) * (-375.480) (-373.874) [-377.936] (-373.669) -- 0:00:04
926000 -- (-373.492) (-375.342) (-376.649) [-373.931] * [-374.766] (-372.736) (-374.568) (-375.747) -- 0:00:04
926500 -- (-374.077) (-375.933) [-373.571] (-374.436) * (-373.734) (-373.716) [-376.539] (-372.681) -- 0:00:04
927000 -- [-373.457] (-376.787) (-375.481) (-374.339) * (-374.200) [-374.825] (-375.905) (-374.036) -- 0:00:04
927500 -- (-372.426) (-374.869) [-372.752] (-373.777) * (-372.650) (-375.660) (-375.114) [-373.699] -- 0:00:04
928000 -- (-373.952) (-373.498) [-373.373] (-374.797) * (-374.201) (-375.029) [-373.739] (-374.348) -- 0:00:04
928500 -- (-373.056) [-374.116] (-374.888) (-375.756) * (-373.204) [-372.998] (-374.527) (-371.857) -- 0:00:04
929000 -- (-373.877) (-372.434) [-371.959] (-374.937) * [-376.005] (-376.770) (-374.033) (-378.461) -- 0:00:04
929500 -- (-373.894) (-372.626) [-373.824] (-373.123) * (-376.921) [-374.719] (-372.567) (-374.155) -- 0:00:04
930000 -- (-373.609) (-373.889) (-374.399) [-371.301] * [-377.331] (-372.839) (-373.884) (-373.802) -- 0:00:04
Average standard deviation of split frequencies: 0.008104
930500 -- (-376.779) (-372.540) (-373.951) [-373.862] * (-371.596) (-376.300) [-373.553] (-372.797) -- 0:00:04
931000 -- (-374.812) (-374.799) (-374.492) [-372.482] * (-372.749) (-372.523) [-373.211] (-375.403) -- 0:00:04
931500 -- [-372.827] (-373.201) (-372.965) (-372.943) * (-372.471) [-373.762] (-375.463) (-373.020) -- 0:00:04
932000 -- [-373.434] (-376.211) (-375.285) (-376.991) * (-371.383) [-372.277] (-379.439) (-371.532) -- 0:00:04
932500 -- (-372.888) (-379.788) [-374.980] (-373.726) * (-374.832) (-373.921) [-372.498] (-372.342) -- 0:00:04
933000 -- (-372.055) (-372.788) [-373.157] (-372.761) * [-373.152] (-373.806) (-374.022) (-373.738) -- 0:00:04
933500 -- [-374.487] (-375.138) (-372.205) (-374.322) * [-373.924] (-374.373) (-372.887) (-374.955) -- 0:00:03
934000 -- (-373.267) (-374.017) (-375.964) [-371.652] * (-375.298) [-372.506] (-378.419) (-374.094) -- 0:00:03
934500 -- [-373.468] (-372.259) (-371.445) (-372.754) * (-375.564) (-373.046) (-372.520) [-375.078] -- 0:00:03
935000 -- (-372.571) (-373.808) (-373.160) [-372.044] * (-374.899) (-373.043) (-372.017) [-373.231] -- 0:00:03
Average standard deviation of split frequencies: 0.008216
935500 -- (-375.585) (-372.783) [-374.816] (-373.517) * [-374.432] (-372.459) (-372.776) (-373.541) -- 0:00:03
936000 -- (-373.846) [-374.557] (-372.728) (-375.480) * [-373.482] (-373.922) (-372.070) (-373.603) -- 0:00:03
936500 -- (-378.226) [-371.583] (-372.169) (-376.126) * (-373.433) (-372.720) (-373.011) [-374.772] -- 0:00:03
937000 -- (-372.947) [-371.546] (-375.231) (-373.966) * [-374.084] (-375.067) (-373.288) (-372.775) -- 0:00:03
937500 -- (-375.921) (-376.019) (-376.369) [-372.452] * (-375.283) [-375.073] (-373.808) (-372.811) -- 0:00:03
938000 -- (-377.261) [-377.874] (-375.816) (-373.659) * (-371.985) [-373.039] (-374.605) (-372.170) -- 0:00:03
938500 -- [-375.158] (-374.377) (-383.116) (-373.399) * (-372.941) (-373.188) [-373.952] (-376.649) -- 0:00:03
939000 -- (-377.979) (-374.117) [-373.584] (-373.198) * (-371.309) (-375.851) (-371.613) [-372.802] -- 0:00:03
939500 -- (-371.894) [-373.993] (-373.321) (-372.668) * (-376.607) (-375.051) [-372.303] (-372.283) -- 0:00:03
940000 -- (-373.309) (-375.528) (-373.821) [-371.451] * (-374.208) [-374.928] (-374.845) (-373.762) -- 0:00:03
Average standard deviation of split frequencies: 0.008269
940500 -- (-375.928) (-374.640) [-374.680] (-372.320) * [-375.899] (-375.679) (-373.425) (-373.750) -- 0:00:03
941000 -- [-373.975] (-375.486) (-377.677) (-375.853) * (-373.743) (-375.212) [-373.679] (-372.320) -- 0:00:03
941500 -- (-372.268) (-375.781) [-371.537] (-373.213) * (-372.888) [-373.157] (-374.121) (-372.466) -- 0:00:03
942000 -- (-373.790) (-375.130) [-372.076] (-375.805) * (-373.338) (-373.916) [-373.200] (-373.512) -- 0:00:03
942500 -- (-376.693) (-376.192) [-371.450] (-372.812) * (-375.601) (-371.568) (-373.619) [-372.024] -- 0:00:03
943000 -- (-372.828) (-376.363) (-371.682) [-372.909] * (-373.119) (-372.863) [-372.103] (-374.805) -- 0:00:03
943500 -- [-372.860] (-375.795) (-374.243) (-375.522) * [-373.672] (-372.717) (-378.333) (-375.018) -- 0:00:03
944000 -- (-375.113) (-373.456) [-371.741] (-372.503) * [-374.052] (-372.360) (-374.742) (-372.988) -- 0:00:03
944500 -- (-374.993) (-371.692) [-372.883] (-374.669) * (-375.724) (-375.450) [-372.156] (-372.882) -- 0:00:03
945000 -- (-373.893) (-372.452) (-374.380) [-372.170] * (-373.316) (-373.495) (-372.600) [-373.611] -- 0:00:03
Average standard deviation of split frequencies: 0.008284
945500 -- (-375.151) (-376.767) (-373.200) [-373.342] * (-371.587) (-372.189) (-372.225) [-376.557] -- 0:00:03
946000 -- [-372.112] (-372.420) (-372.743) (-372.933) * [-372.343] (-373.170) (-374.548) (-373.165) -- 0:00:03
946500 -- (-372.730) (-373.786) [-374.441] (-374.470) * (-372.734) (-372.475) [-373.003] (-373.460) -- 0:00:03
947000 -- (-375.610) (-376.490) [-376.630] (-372.929) * (-372.855) (-373.811) [-372.953] (-372.414) -- 0:00:03
947500 -- (-374.114) [-373.630] (-375.376) (-372.468) * (-372.505) (-374.167) (-373.007) [-372.324] -- 0:00:03
948000 -- (-373.011) (-376.274) (-375.640) [-374.305] * (-375.638) [-374.343] (-374.104) (-371.625) -- 0:00:03
948500 -- [-372.388] (-375.517) (-372.096) (-372.939) * (-374.844) (-379.061) [-372.039] (-372.202) -- 0:00:03
949000 -- [-371.699] (-372.597) (-373.239) (-372.515) * (-381.763) [-374.050] (-372.880) (-378.938) -- 0:00:03
949500 -- [-372.934] (-377.097) (-374.354) (-372.873) * [-373.207] (-383.535) (-372.923) (-376.355) -- 0:00:03
950000 -- [-373.914] (-372.601) (-373.522) (-374.841) * (-372.145) [-373.559] (-372.229) (-372.833) -- 0:00:03
Average standard deviation of split frequencies: 0.008027
950500 -- (-371.826) (-372.529) (-373.945) [-374.627] * (-376.139) (-374.275) [-371.447] (-374.691) -- 0:00:02
951000 -- (-372.694) [-373.845] (-375.057) (-373.038) * (-372.697) (-374.383) (-373.212) [-372.902] -- 0:00:02
951500 -- (-374.838) (-373.621) [-379.208] (-372.690) * (-376.052) [-376.662] (-372.927) (-375.039) -- 0:00:02
952000 -- [-373.369] (-373.224) (-380.982) (-374.232) * (-382.681) (-374.366) [-374.670] (-372.541) -- 0:00:02
952500 -- [-371.416] (-375.529) (-373.231) (-373.085) * (-379.742) [-375.353] (-374.494) (-373.020) -- 0:00:02
953000 -- [-372.882] (-372.162) (-373.276) (-372.463) * [-371.422] (-374.434) (-374.176) (-375.455) -- 0:00:02
953500 -- [-372.911] (-376.182) (-373.759) (-377.796) * [-377.438] (-372.250) (-371.888) (-373.334) -- 0:00:02
954000 -- (-373.573) [-373.754] (-376.896) (-374.442) * (-375.097) [-371.640] (-373.413) (-372.723) -- 0:00:02
954500 -- (-375.093) [-372.812] (-376.352) (-375.505) * (-375.796) (-374.707) [-374.529] (-373.030) -- 0:00:02
955000 -- (-375.140) (-372.873) [-372.026] (-371.683) * (-375.649) (-374.486) (-374.606) [-372.700] -- 0:00:02
Average standard deviation of split frequencies: 0.007890
955500 -- [-375.708] (-377.248) (-371.871) (-372.204) * (-373.666) (-373.175) [-374.807] (-374.061) -- 0:00:02
956000 -- (-373.135) [-374.104] (-372.186) (-383.655) * (-373.293) (-375.047) (-375.306) [-373.684] -- 0:00:02
956500 -- [-373.468] (-372.951) (-376.505) (-373.202) * [-377.671] (-372.050) (-372.676) (-372.718) -- 0:00:02
957000 -- (-371.542) (-373.733) (-380.964) [-372.735] * (-373.493) [-373.427] (-375.800) (-372.894) -- 0:00:02
957500 -- (-374.025) (-373.527) (-379.980) [-373.402] * (-376.794) (-374.078) [-373.949] (-373.623) -- 0:00:02
958000 -- (-373.560) (-372.533) (-375.675) [-373.497] * (-381.582) [-371.822] (-374.438) (-377.220) -- 0:00:02
958500 -- [-372.763] (-377.708) (-375.581) (-375.571) * (-378.489) [-372.704] (-372.075) (-372.232) -- 0:00:02
959000 -- (-375.800) (-377.817) (-372.742) [-376.838] * (-376.593) (-374.322) (-375.517) [-374.085] -- 0:00:02
959500 -- [-373.368] (-377.244) (-372.470) (-374.009) * (-373.901) (-378.567) (-374.317) [-375.130] -- 0:00:02
960000 -- (-374.042) (-376.877) [-372.994] (-377.760) * [-372.639] (-374.986) (-375.973) (-374.462) -- 0:00:02
Average standard deviation of split frequencies: 0.008066
960500 -- [-373.720] (-372.960) (-373.849) (-374.298) * (-373.940) (-374.092) (-373.165) [-372.838] -- 0:00:02
961000 -- [-373.038] (-373.708) (-373.668) (-373.889) * [-374.528] (-375.662) (-377.261) (-378.383) -- 0:00:02
961500 -- (-374.350) [-374.804] (-378.217) (-374.325) * (-374.201) (-372.268) [-377.922] (-375.862) -- 0:00:02
962000 -- (-372.671) [-372.960] (-377.438) (-374.344) * [-372.180] (-372.624) (-373.913) (-374.630) -- 0:00:02
962500 -- (-374.207) [-372.866] (-374.765) (-375.848) * (-377.965) (-376.108) [-372.002] (-374.374) -- 0:00:02
963000 -- [-373.906] (-374.414) (-374.705) (-371.515) * (-373.415) (-374.599) [-371.713] (-373.203) -- 0:00:02
963500 -- (-376.110) (-373.825) [-375.026] (-372.558) * [-371.917] (-373.644) (-371.679) (-375.566) -- 0:00:02
964000 -- (-377.721) (-372.542) [-373.336] (-371.362) * [-371.662] (-374.834) (-372.431) (-374.822) -- 0:00:02
964500 -- [-373.168] (-373.844) (-373.238) (-373.519) * (-373.648) (-376.092) [-373.034] (-378.123) -- 0:00:02
965000 -- (-372.935) (-373.226) (-372.887) [-374.183] * (-372.440) (-373.301) [-372.261] (-376.955) -- 0:00:02
Average standard deviation of split frequencies: 0.007869
965500 -- (-373.077) (-375.482) (-374.463) [-371.787] * [-372.445] (-374.757) (-371.635) (-378.158) -- 0:00:02
966000 -- (-375.478) (-374.183) [-373.808] (-373.304) * (-373.592) (-373.980) (-371.730) [-372.222] -- 0:00:02
966500 -- (-373.184) (-373.538) (-374.210) [-372.552] * (-374.539) [-372.290] (-373.147) (-374.335) -- 0:00:02
967000 -- (-374.645) [-373.287] (-374.909) (-372.648) * (-372.601) (-372.962) (-373.568) [-372.926] -- 0:00:01
967500 -- (-372.832) (-373.650) [-374.173] (-376.158) * (-374.022) (-373.670) (-373.679) [-376.385] -- 0:00:01
968000 -- [-373.114] (-376.097) (-374.481) (-374.880) * (-379.529) (-373.247) (-373.703) [-373.950] -- 0:00:01
968500 -- (-372.865) [-372.257] (-374.056) (-372.594) * (-374.779) (-372.715) (-372.420) [-372.905] -- 0:00:01
969000 -- [-374.128] (-372.826) (-374.785) (-372.338) * (-373.942) [-372.336] (-374.927) (-380.246) -- 0:00:01
969500 -- [-372.882] (-374.367) (-376.679) (-376.997) * (-374.453) [-372.466] (-375.743) (-376.164) -- 0:00:01
970000 -- (-373.155) [-373.842] (-375.698) (-375.527) * (-375.427) [-373.557] (-371.413) (-375.088) -- 0:00:01
Average standard deviation of split frequencies: 0.007953
970500 -- (-373.611) [-371.949] (-373.441) (-374.399) * (-373.919) [-372.605] (-376.379) (-378.045) -- 0:00:01
971000 -- (-376.777) [-374.994] (-372.997) (-373.533) * (-376.658) (-372.624) [-371.441] (-372.728) -- 0:00:01
971500 -- (-374.334) [-374.717] (-373.223) (-373.722) * (-375.925) [-373.692] (-371.978) (-372.179) -- 0:00:01
972000 -- (-374.470) [-373.712] (-373.515) (-374.809) * [-375.670] (-373.201) (-377.356) (-372.964) -- 0:00:01
972500 -- (-375.889) (-371.896) [-373.056] (-374.399) * [-373.093] (-372.270) (-374.692) (-378.403) -- 0:00:01
973000 -- (-374.017) [-371.318] (-375.380) (-373.922) * (-373.982) (-374.046) [-373.490] (-379.311) -- 0:00:01
973500 -- [-375.774] (-371.835) (-375.392) (-373.615) * (-374.021) (-377.325) [-376.191] (-374.286) -- 0:00:01
974000 -- (-374.432) (-380.902) (-373.112) [-373.650] * [-377.520] (-373.779) (-373.335) (-375.319) -- 0:00:01
974500 -- (-372.753) (-372.325) [-374.258] (-372.090) * (-382.099) [-376.832] (-375.361) (-373.371) -- 0:00:01
975000 -- [-371.613] (-374.914) (-373.806) (-374.038) * (-373.935) [-373.175] (-373.545) (-373.808) -- 0:00:01
Average standard deviation of split frequencies: 0.008211
975500 -- (-375.123) (-373.966) (-374.178) [-373.623] * (-380.313) [-372.777] (-371.758) (-373.824) -- 0:00:01
976000 -- (-373.078) [-371.768] (-373.392) (-381.309) * (-371.689) (-373.860) (-372.698) [-372.497] -- 0:00:01
976500 -- (-374.029) [-371.213] (-374.312) (-374.554) * [-371.883] (-372.563) (-373.831) (-371.983) -- 0:00:01
977000 -- (-374.019) (-373.494) [-371.703] (-375.113) * (-372.018) (-373.080) (-374.129) [-372.539] -- 0:00:01
977500 -- (-373.255) [-373.496] (-371.148) (-373.307) * (-375.223) (-376.286) (-373.042) [-373.024] -- 0:00:01
978000 -- (-372.597) [-374.494] (-372.674) (-371.983) * (-372.978) [-373.693] (-372.613) (-373.459) -- 0:00:01
978500 -- (-371.972) [-373.618] (-375.665) (-372.215) * (-376.137) (-372.084) (-372.033) [-374.119] -- 0:00:01
979000 -- (-374.229) (-374.393) [-372.570] (-374.855) * (-376.136) [-372.191] (-374.142) (-374.106) -- 0:00:01
979500 -- (-374.566) (-374.971) [-372.930] (-376.049) * [-377.734] (-373.251) (-374.933) (-375.421) -- 0:00:01
980000 -- (-372.507) (-377.298) [-372.133] (-372.818) * (-372.291) (-374.612) (-373.260) [-374.443] -- 0:00:01
Average standard deviation of split frequencies: 0.008262
980500 -- (-372.557) (-378.801) [-373.778] (-373.301) * [-373.858] (-372.884) (-372.588) (-375.464) -- 0:00:01
981000 -- (-375.122) (-381.769) (-376.152) [-373.586] * (-377.510) (-371.623) [-374.748] (-371.572) -- 0:00:01
981500 -- [-373.573] (-374.747) (-373.850) (-375.773) * [-372.954] (-371.421) (-375.592) (-374.368) -- 0:00:01
982000 -- (-373.707) (-375.836) (-374.254) [-372.843] * (-374.675) (-371.988) (-372.394) [-373.224] -- 0:00:01
982500 -- (-375.976) (-373.289) (-372.913) [-373.376] * (-371.949) (-373.833) [-374.867] (-373.733) -- 0:00:01
983000 -- (-377.061) (-373.873) (-372.467) [-371.764] * (-373.604) (-377.856) (-371.444) [-373.485] -- 0:00:01
983500 -- (-378.738) (-373.381) (-373.112) [-375.429] * (-372.658) (-374.112) [-374.395] (-372.159) -- 0:00:00
984000 -- (-376.028) (-372.494) [-373.517] (-377.746) * [-372.072] (-374.033) (-375.119) (-371.304) -- 0:00:00
984500 -- [-372.166] (-372.619) (-375.911) (-373.108) * (-373.315) (-372.459) [-373.999] (-371.376) -- 0:00:00
985000 -- (-372.249) (-373.971) (-377.267) [-373.836] * (-373.310) (-373.593) [-373.851] (-372.642) -- 0:00:00
Average standard deviation of split frequencies: 0.008247
985500 -- (-372.654) [-372.428] (-373.064) (-373.965) * (-373.225) [-373.050] (-372.039) (-374.689) -- 0:00:00
986000 -- [-374.067] (-372.420) (-372.795) (-374.287) * [-374.074] (-373.108) (-375.431) (-377.077) -- 0:00:00
986500 -- (-374.494) (-373.464) (-373.828) [-373.420] * (-372.565) [-375.758] (-373.476) (-372.170) -- 0:00:00
987000 -- (-372.160) (-373.182) [-373.330] (-373.859) * (-372.554) [-374.762] (-373.184) (-372.102) -- 0:00:00
987500 -- (-372.452) [-373.187] (-373.263) (-372.133) * [-373.444] (-374.819) (-375.936) (-378.025) -- 0:00:00
988000 -- (-371.862) [-372.911] (-374.496) (-374.335) * (-374.680) (-374.773) [-372.634] (-375.704) -- 0:00:00
988500 -- (-373.474) (-375.054) [-373.153] (-374.968) * [-375.554] (-373.507) (-373.000) (-375.293) -- 0:00:00
989000 -- [-372.487] (-374.563) (-373.480) (-373.143) * (-374.781) (-374.349) (-372.688) [-373.216] -- 0:00:00
989500 -- (-373.443) (-374.774) [-373.107] (-373.833) * (-373.893) (-373.211) [-372.607] (-373.396) -- 0:00:00
990000 -- (-379.951) (-372.872) [-372.265] (-373.067) * [-373.917] (-376.007) (-378.069) (-373.635) -- 0:00:00
Average standard deviation of split frequencies: 0.008000
990500 -- (-376.320) (-374.596) [-374.189] (-374.599) * (-372.784) [-373.117] (-372.425) (-373.896) -- 0:00:00
991000 -- (-374.992) (-379.241) [-372.365] (-373.513) * (-372.177) [-374.613] (-375.216) (-377.253) -- 0:00:00
991500 -- (-378.606) (-372.348) (-371.939) [-372.456] * (-373.333) (-375.156) [-373.135] (-371.974) -- 0:00:00
992000 -- [-373.919] (-373.681) (-372.379) (-374.155) * (-374.697) [-376.388] (-372.486) (-373.117) -- 0:00:00
992500 -- (-372.420) (-373.355) [-372.908] (-372.322) * (-372.814) (-375.257) (-375.733) [-372.693] -- 0:00:00
993000 -- (-376.102) [-373.509] (-373.327) (-372.060) * [-376.052] (-371.509) (-374.312) (-373.462) -- 0:00:00
993500 -- (-379.329) [-372.603] (-375.268) (-372.202) * (-372.487) [-372.990] (-372.440) (-373.561) -- 0:00:00
994000 -- [-375.245] (-377.819) (-374.480) (-375.697) * (-372.491) (-374.794) (-373.732) [-372.744] -- 0:00:00
994500 -- [-371.902] (-374.138) (-374.739) (-377.267) * [-371.441] (-373.730) (-373.184) (-372.281) -- 0:00:00
995000 -- [-371.320] (-376.003) (-373.908) (-373.326) * [-371.825] (-373.902) (-374.719) (-372.122) -- 0:00:00
Average standard deviation of split frequencies: 0.007040
995500 -- (-372.003) [-376.190] (-373.825) (-374.145) * [-372.407] (-374.672) (-371.796) (-374.357) -- 0:00:00
996000 -- [-374.064] (-371.625) (-375.070) (-372.988) * [-372.450] (-374.513) (-372.859) (-373.780) -- 0:00:00
996500 -- (-375.924) [-371.606] (-372.576) (-372.322) * (-371.900) (-374.351) [-374.102] (-376.146) -- 0:00:00
997000 -- (-374.439) (-372.621) (-373.780) [-372.401] * (-372.213) (-374.903) [-373.056] (-374.848) -- 0:00:00
997500 -- (-373.589) (-374.725) [-372.855] (-372.264) * [-373.125] (-372.720) (-373.227) (-374.836) -- 0:00:00
998000 -- (-374.861) [-371.848] (-371.793) (-373.698) * (-374.699) (-375.546) [-374.147] (-372.766) -- 0:00:00
998500 -- [-371.565] (-372.151) (-372.361) (-374.126) * (-374.868) (-371.911) (-374.237) [-374.064] -- 0:00:00
999000 -- (-372.876) (-374.560) (-372.374) [-377.053] * (-376.471) [-371.876] (-372.429) (-375.600) -- 0:00:00
999500 -- [-374.883] (-378.236) (-375.787) (-373.200) * (-373.272) [-374.093] (-375.425) (-378.905) -- 0:00:00
1000000 -- (-372.162) (-374.376) [-371.976] (-372.627) * (-375.218) [-373.726] (-374.798) (-377.313) -- 0:00:00
Average standard deviation of split frequencies: 0.007184
Analysis completed in 60 seconds
Analysis used 58.67 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -371.12
Likelihood of best state for "cold" chain of run 2 was -371.12
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 76 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
41.7 % ( 25 %) Dirichlet(Pi{all})
40.3 % ( 30 %) Slider(Pi{all})
78.4 % ( 58 %) Multiplier(Alpha{1,2})
78.1 % ( 59 %) Multiplier(Alpha{3})
26.2 % ( 23 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 35 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
30.7 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
41.9 % ( 28 %) Dirichlet(Pi{all})
40.4 % ( 25 %) Slider(Pi{all})
78.7 % ( 53 %) Multiplier(Alpha{1,2})
78.3 % ( 53 %) Multiplier(Alpha{3})
26.3 % ( 33 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.7 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166547 0.82 0.67
3 | 166959 166057 0.84
4 | 167706 166711 166020
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166194 0.82 0.67
3 | 166227 167303 0.84
4 | 166855 166688 166733
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -372.89
| 1 1 |
| 2 2 2 2 1 1 |
| 11 2 2 1 1|
| 2 2 11 1 2 1 2211 22 1 |
| 1 11 * 1 1 2 2 222 1 2 1 1 1 2 2 2|
|12 2 * 1 * *11 21 2 2 1 1 2 1 |
| 2 2 1 1121 1 1 1 1 2 |
| 1 1 2 2 2 1 1 * 2 1 2 |
| 2 1 21 * 1 2 2 22 |
|212 2 2 2 |
| 1 2 1 |
| 2 2 2 |
| 2 1 |
| 2 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -374.67
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -372.81 -376.95
2 -372.84 -375.99
--------------------------------------
TOTAL -372.83 -376.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895957 0.092503 0.338742 1.476517 0.857004 1327.57 1414.28 1.000
r(A<->C){all} 0.173871 0.021054 0.000027 0.462687 0.137751 149.26 203.09 1.000
r(A<->G){all} 0.164072 0.020249 0.000261 0.455768 0.126516 233.56 271.23 1.000
r(A<->T){all} 0.177513 0.023605 0.000002 0.491932 0.132407 168.19 172.16 1.001
r(C<->G){all} 0.155663 0.018058 0.000130 0.438825 0.115392 121.76 140.21 1.000
r(C<->T){all} 0.163454 0.017786 0.000020 0.423166 0.129169 340.80 379.15 1.003
r(G<->T){all} 0.165427 0.020690 0.000001 0.459965 0.124908 257.38 258.48 1.000
pi(A){all} 0.203480 0.000580 0.154751 0.247598 0.202454 1155.82 1319.94 1.001
pi(C){all} 0.248597 0.000687 0.200354 0.299649 0.247946 1277.05 1297.37 1.000
pi(G){all} 0.310479 0.000752 0.256960 0.365068 0.310482 1190.46 1211.35 1.000
pi(T){all} 0.237444 0.000647 0.189649 0.286948 0.236637 1171.36 1194.10 1.000
alpha{1,2} 0.402204 0.213306 0.000143 1.349383 0.240238 976.82 1183.97 1.000
alpha{3} 0.444157 0.220129 0.000156 1.394500 0.289813 1356.72 1428.86 1.000
pinvar{all} 0.993885 0.000053 0.979517 0.999996 0.996260 1434.96 1467.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ..*..*
9 -- ...*.*
10 -- .*...*
11 -- .**...
12 -- .**.**
13 -- .*.*..
14 -- ...**.
15 -- ..*.*.
16 -- .***.*
17 -- ..**..
18 -- .*..*.
19 -- .****.
20 -- ....**
21 -- ..****
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 471 0.156895 0.015546 0.145903 0.167888 2
8 446 0.148568 0.008480 0.142572 0.154564 2
9 441 0.146902 0.005182 0.143238 0.150566 2
10 432 0.143904 0.004711 0.140573 0.147235 2
11 432 0.143904 0.000942 0.143238 0.144570 2
12 431 0.143571 0.001413 0.142572 0.144570 2
13 430 0.143238 0.002827 0.141239 0.145237 2
14 430 0.143238 0.000942 0.142572 0.143904 2
15 429 0.142905 0.001413 0.141905 0.143904 2
16 429 0.142905 0.028737 0.122585 0.163225 2
17 424 0.141239 0.010364 0.133911 0.148568 2
18 420 0.139907 0.000942 0.139241 0.140573 2
19 418 0.139241 0.009422 0.132578 0.145903 2
20 416 0.138574 0.000942 0.137908 0.139241 2
21 396 0.131912 0.009422 0.125250 0.138574 2
22 273 0.090939 0.013662 0.081279 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101641 0.010141 0.000034 0.302240 0.070688 1.000 2
length{all}[2] 0.098048 0.009352 0.000023 0.292125 0.069296 1.000 2
length{all}[3] 0.102669 0.010621 0.000004 0.302270 0.071172 1.000 2
length{all}[4] 0.100777 0.010279 0.000005 0.302001 0.069744 1.000 2
length{all}[5] 0.096762 0.009439 0.000038 0.286144 0.066726 1.000 2
length{all}[6] 0.102186 0.010347 0.000006 0.308571 0.070478 1.001 2
length{all}[7] 0.101762 0.010761 0.000028 0.311987 0.067827 1.003 2
length{all}[8] 0.092341 0.008071 0.000164 0.285277 0.059114 0.998 2
length{all}[9] 0.091842 0.009301 0.000090 0.303392 0.058454 0.999 2
length{all}[10] 0.093419 0.007170 0.000423 0.265363 0.067932 1.000 2
length{all}[11] 0.097246 0.008988 0.000160 0.284978 0.071899 1.005 2
length{all}[12] 0.100285 0.010909 0.000154 0.328377 0.063279 0.999 2
length{all}[13] 0.097123 0.008836 0.000104 0.285067 0.066645 1.000 2
length{all}[14] 0.097962 0.008384 0.000014 0.292001 0.071660 0.998 2
length{all}[15] 0.093501 0.011679 0.000386 0.291716 0.065129 1.001 2
length{all}[16] 0.094744 0.009051 0.000212 0.295043 0.064107 1.001 2
length{all}[17] 0.104992 0.011468 0.000068 0.297694 0.070183 0.998 2
length{all}[18] 0.098306 0.008880 0.000034 0.281691 0.070496 0.998 2
length{all}[19] 0.103004 0.010786 0.000288 0.317634 0.073015 0.998 2
length{all}[20] 0.103790 0.010821 0.000002 0.288377 0.073711 0.999 2
length{all}[21] 0.093901 0.009637 0.000140 0.271534 0.063994 0.999 2
length{all}[22] 0.098244 0.007205 0.000014 0.259849 0.073862 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007184
Maximum standard deviation of split frequencies = 0.028737
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 270
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 41 patterns at 90 / 90 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 41 patterns at 90 / 90 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40016 bytes for conP
3608 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031996 0.070648 0.098365 0.069634 0.064094 0.046743 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -391.368821
Iterating by ming2
Initial: fx= 391.368821
x= 0.03200 0.07065 0.09836 0.06963 0.06409 0.04674 0.30000 1.30000
1 h-m-p 0.0000 0.0004 215.6356 +++ 374.518679 m 0.0004 14 | 1/8
2 h-m-p 0.0013 0.0102 53.8598 ++ 369.799499 m 0.0102 25 | 2/8
3 h-m-p 0.0000 0.0001 5118.9027 ++ 362.984956 m 0.0001 36 | 3/8
4 h-m-p 0.0000 0.0001 1321.1542 ++ 361.689282 m 0.0001 47 | 4/8
5 h-m-p 0.0000 0.0002 25.3355 ++ 361.542363 m 0.0002 58 | 5/8
6 h-m-p 0.0000 0.0001 37.9487 ++ 361.314840 m 0.0001 69 | 6/8
7 h-m-p 0.0001 0.0119 23.6346 ++++ 357.614046 m 0.0119 82 | 7/8
8 h-m-p 1.6000 8.0000 0.0002 ++ 357.614046 m 8.0000 93 | 7/8
9 h-m-p 0.0160 8.0000 0.3123 -------------.. | 7/8
10 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614046 m 8.0000 131 | 7/8
11 h-m-p 0.0160 8.0000 0.9342 -------------.. | 7/8
12 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614046 m 8.0000 169 | 7/8
13 h-m-p 0.0160 8.0000 0.9166 -------------.. | 7/8
14 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614046 m 8.0000 207 | 7/8
15 h-m-p 0.0160 8.0000 0.9192 -------------.. | 7/8
16 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614045 m 8.0000 245 | 7/8
17 h-m-p 0.0160 8.0000 0.9139 -----------C 357.614045 0 0.0000 268 | 7/8
18 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/8
19 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614045 m 8.0000 306 | 7/8
20 h-m-p 0.0160 8.0000 0.9225 ------------Y 357.614045 0 0.0000 330 | 7/8
21 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/8
22 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614045 m 8.0000 368 | 7/8
23 h-m-p 0.0160 8.0000 0.8960 -----------Y 357.614045 0 0.0000 391 | 7/8
24 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614045 m 8.0000 406 | 7/8
25 h-m-p 0.0160 8.0000 0.9412 -------------.. | 7/8
26 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614045 m 8.0000 444 | 7/8
27 h-m-p 0.0160 8.0000 0.9302 -----------Y 357.614045 0 0.0000 467 | 7/8
28 h-m-p 0.0160 8.0000 0.0001 ------Y 357.614045 0 0.0000 485 | 7/8
29 h-m-p 0.0160 8.0000 0.0000 ----Y 357.614045 0 0.0000 501
Out..
lnL = -357.614045
502 lfun, 502 eigenQcodon, 3012 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.014508 0.061233 0.098763 0.054169 0.106873 0.058626 0.359648 0.628846 0.178887
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.074289
np = 9
lnL0 = -389.655737
Iterating by ming2
Initial: fx= 389.655737
x= 0.01451 0.06123 0.09876 0.05417 0.10687 0.05863 0.35965 0.62885 0.17889
1 h-m-p 0.0000 0.0002 188.1710 +++ 382.969467 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0009 169.6058 ++ 366.715604 m 0.0009 27 | 2/9
3 h-m-p 0.0000 0.0000 693.6451 ++ 365.314512 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0001 189.3460 ++ 364.658753 m 0.0001 51 | 4/9
5 h-m-p 0.0001 0.0003 162.0339 ++ 360.855392 m 0.0003 63 | 5/9
6 h-m-p 0.0017 0.0092 21.4653 ++ 357.903939 m 0.0092 75 | 6/9
7 h-m-p 0.0000 0.0001 66.8413 ++ 357.614120 m 0.0001 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 --------C 357.614120 0 0.0000 107 | 7/9
9 h-m-p 0.0007 0.3610 0.3755 +++++ 357.614031 m 0.3610 124 | 8/9
10 h-m-p 0.4624 8.0000 0.0692 ------------C 357.614031 0 0.0000 150 | 8/9
11 h-m-p 0.0160 8.0000 0.0000 ------Y 357.614031 0 0.0000 169
Out..
lnL = -357.614031
170 lfun, 510 eigenQcodon, 2040 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.040541 0.068969 0.010387 0.067599 0.092473 0.052242 0.273445 0.968917 0.578057 0.437216 2.205675
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.030679
np = 11
lnL0 = -385.426419
Iterating by ming2
Initial: fx= 385.426419
x= 0.04054 0.06897 0.01039 0.06760 0.09247 0.05224 0.27345 0.96892 0.57806 0.43722 2.20568
1 h-m-p 0.0000 0.0001 195.3813 ++ 380.462728 m 0.0001 16 | 1/11
2 h-m-p 0.0004 0.0041 62.3829 ++ 367.122802 m 0.0041 30 | 2/11
3 h-m-p 0.0000 0.0001 745.2374 ++ 363.437673 m 0.0001 44 | 3/11
4 h-m-p 0.0002 0.0012 136.2072 ++ 360.026377 m 0.0012 58 | 4/11
5 h-m-p 0.0033 0.0164 4.2488 ------------.. | 4/11
6 h-m-p 0.0000 0.0000 148.0317 ++ 359.554449 m 0.0000 96 | 5/11
7 h-m-p 0.0008 0.4009 3.1189 -----------.. | 5/11
8 h-m-p 0.0000 0.0000 121.3097 ++ 359.353795 m 0.0000 133 | 6/11
9 h-m-p 0.0009 0.4301 2.7739 -----------.. | 6/11
10 h-m-p 0.0000 0.0002 85.6640 +++ 357.614243 m 0.0002 171 | 7/11
11 h-m-p 0.7763 8.0000 0.0000 ++ 357.614243 m 8.0000 185 | 7/11
12 h-m-p 0.0160 8.0000 0.0178 -------------.. | 7/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 357.614243 m 8.0000 235 | 7/11
14 h-m-p 0.0160 8.0000 1.5309 ----------Y 357.614243 0 0.0000 263 | 7/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614243 m 8.0000 280 | 7/11
16 h-m-p 0.0160 8.0000 1.3614 ------------Y 357.614243 0 0.0000 310 | 7/11
17 h-m-p 0.0160 8.0000 0.0004 +++++ 357.614243 m 8.0000 327 | 7/11
18 h-m-p 0.0034 1.6941 2.2488 ---------Y 357.614243 0 0.0000 354 | 7/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 357.614243 m 8.0000 371 | 7/11
20 h-m-p 0.0160 8.0000 0.0268 +++++ 357.614239 m 8.0000 392 | 7/11
21 h-m-p 0.1001 0.8914 2.1401 ++ 357.614224 m 0.8914 410 | 8/11
22 h-m-p 1.6000 8.0000 0.7428 Y 357.614212 0 2.7151 424 | 8/11
23 h-m-p 1.6000 8.0000 0.0534 C 357.614212 0 0.5772 441 | 8/11
24 h-m-p 1.6000 8.0000 0.0000 ++ 357.614212 m 8.0000 458 | 8/11
25 h-m-p 0.0001 0.0278 133.9121 ---------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614212 m 8.0000 499 | 8/11
27 h-m-p 0.0031 1.5474 0.3281 +++++ 357.614180 m 1.5474 519 | 9/11
28 h-m-p 0.3229 8.0000 1.4214 --------------N 357.614180 0 0.0000 550 | 9/11
29 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614179 m 8.0000 567 | 9/11
30 h-m-p 0.0130 6.5079 16.3561 -------------.. | 9/11
31 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614179 m 8.0000 611 | 9/11
32 h-m-p 0.0160 8.0000 1.4201 ------------Y 357.614179 0 0.0000 639 | 9/11
33 h-m-p 0.0160 8.0000 0.0002 +++++ 357.614179 m 8.0000 656 | 9/11
34 h-m-p 0.0160 8.0000 4.9229 ------------N 357.614179 0 0.0000 684 | 9/11
35 h-m-p 0.0160 8.0000 0.0000 +++++ 357.614179 m 8.0000 701 | 9/11
36 h-m-p 0.0160 8.0000 0.0011 +++++ 357.614179 m 8.0000 720 | 9/11
37 h-m-p 0.0160 8.0000 8.9415 -------------.. | 9/11
38 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614179 m 8.0000 764 | 9/11
39 h-m-p 0.0160 8.0000 2.0720 -----------C 357.614179 0 0.0000 791 | 9/11
40 h-m-p 0.0160 8.0000 0.0006 +++++ 357.614178 m 8.0000 808 | 9/11
41 h-m-p 0.0160 8.0000 2.4572 -------------.. | 9/11
42 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614178 m 8.0000 852 | 9/11
43 h-m-p 0.0160 8.0000 0.5497 -----------N 357.614178 0 0.0000 879 | 9/11
44 h-m-p 0.0160 8.0000 0.0000 ------N 357.614178 0 0.0000 901 | 9/11
45 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614178 m 8.0000 920 | 9/11
46 h-m-p 0.0160 8.0000 2.4582 ------------Y 357.614178 0 0.0000 948 | 9/11
47 h-m-p 0.0160 8.0000 0.0000 +++++ 357.614178 m 8.0000 965 | 9/11
48 h-m-p 0.0160 8.0000 8.6314 -------------.. | 9/11
49 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614178 m 8.0000 1009 | 9/11
50 h-m-p 0.0160 8.0000 0.7656 ----------C 357.614178 0 0.0000 1035 | 9/11
51 h-m-p 0.0160 8.0000 0.0003 +++++ 357.614178 m 8.0000 1054 | 9/11
52 h-m-p 0.0160 8.0000 2.4675 -------------.. | 9/11
53 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614178 m 8.0000 1098 | 9/11
54 h-m-p 0.0160 8.0000 0.2684 +++++ 357.614033 m 8.0000 1117 | 9/11
55 h-m-p 0.5157 8.0000 4.1636 ++ 357.613978 m 8.0000 1133 | 9/11
56 h-m-p 1.6000 8.0000 0.0000 C 357.613978 0 1.6000 1147 | 9/11
57 h-m-p 0.0160 8.0000 0.0000 C 357.613978 0 0.0160 1163
Out..
lnL = -357.613978
1164 lfun, 4656 eigenQcodon, 20952 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -357.631096 S = -357.614322 -0.006428
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:06
did 20 / 41 patterns 0:06
did 30 / 41 patterns 0:06
did 40 / 41 patterns 0:06
did 41 / 41 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089448 0.021521 0.025385 0.034942 0.101472 0.058714 0.000100 0.658809 1.467096
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.375252
np = 9
lnL0 = -384.277344
Iterating by ming2
Initial: fx= 384.277344
x= 0.08945 0.02152 0.02538 0.03494 0.10147 0.05871 0.00011 0.65881 1.46710
1 h-m-p 0.0000 0.0000 189.1805 ++ 384.161243 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0114 35.2290 +++++ 373.743773 m 0.0114 29 | 2/9
3 h-m-p 0.0000 0.0000 6190.6555 ++ 372.655759 m 0.0000 41 | 3/9
4 h-m-p 0.0001 0.0003 66.2630 ++ 371.352059 m 0.0003 53 | 4/9
5 h-m-p 0.0000 0.0004 484.2812 ++ 366.651059 m 0.0004 65 | 5/9
6 h-m-p 0.0002 0.0008 25.7609 ++ 366.134636 m 0.0008 77 | 6/9
7 h-m-p 0.0003 0.0039 66.1989 ++ 364.285144 m 0.0039 89 | 7/9
8 h-m-p 0.0513 0.2564 4.7902 --------------.. | 7/9
9 h-m-p 0.0000 0.0013 68.9687 ++++ 357.613978 m 0.0013 127 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 N 357.613978 0 1.6000 139 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 ----Y 357.613978 0 0.0016 156
Out..
lnL = -357.613978
157 lfun, 1727 eigenQcodon, 9420 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.094658 0.045595 0.047189 0.105452 0.057729 0.083457 0.000100 0.900000 1.067146 1.917658 2.709645
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.684728
np = 11
lnL0 = -390.112780
Iterating by ming2
Initial: fx= 390.112780
x= 0.09466 0.04560 0.04719 0.10545 0.05773 0.08346 0.00011 0.90000 1.06715 1.91766 2.70964
1 h-m-p 0.0000 0.0000 163.3206 ++ 390.034897 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 318.5549 +++ 370.723348 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 154.7454 ++ 370.089674 m 0.0000 45 | 3/11
4 h-m-p 0.0007 0.0505 10.4834 ++++ 367.859564 m 0.0505 61 | 3/11
5 h-m-p 0.0000 0.0000 21.0324
h-m-p: 0.00000000e+00 0.00000000e+00 2.10323535e+01 367.859564
.. | 3/11
6 h-m-p 0.0000 0.0001 161.0511 ++ 364.232643 m 0.0001 86 | 4/11
7 h-m-p 0.0000 0.0000 3517.2356 ++ 359.624334 m 0.0000 100 | 5/11
8 h-m-p 0.0001 0.0003 47.9746 ++ 358.224697 m 0.0003 114 | 6/11
9 h-m-p 0.0010 0.0048 5.6151 ++ 358.107995 m 0.0048 128 | 7/11
10 h-m-p 0.0052 0.0258 3.3982 ++ 357.614126 m 0.0258 142 | 8/11
11 h-m-p 1.6000 8.0000 0.0004 ++ 357.614126 m 8.0000 156 | 8/11
12 h-m-p 0.0160 8.0000 0.9086 -------------.. | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614126 m 8.0000 204 | 8/11
14 h-m-p 0.0160 8.0000 0.5853 ------------C 357.614126 0 0.0000 233 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 357.614126 m 8.0000 253 | 8/11
16 h-m-p 0.0160 8.0000 1.0649 -----------N 357.614126 0 0.0000 281 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614125 m 8.0000 326 | 8/11
19 h-m-p 0.0160 8.0000 0.5836 -----------Y 357.614125 0 0.0000 354 | 8/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614125 m 8.0000 374 | 8/11
21 h-m-p 0.0028 1.4008 1.8483 +++++ 357.614112 m 1.4008 394 | 8/11
22 h-m-p -0.0000 -0.0000 1.5139
h-m-p: -0.00000000e+00 -0.00000000e+00 1.51393311e+00 357.614112
.. | 8/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614111 m 8.0000 422 | 9/11
24 h-m-p 0.0160 8.0000 0.7126 ------------Y 357.614111 0 0.0000 451 | 9/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 357.614111 m 8.0000 470 | 9/11
26 h-m-p 0.0160 8.0000 1.2058 -----------Y 357.614111 0 0.0000 497 | 9/11
27 h-m-p 0.0160 8.0000 0.0000 -------------.. | 9/11
28 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614111 m 8.0000 541 | 9/11
29 h-m-p 0.0160 8.0000 0.9252 -----------C 357.614111 0 0.0000 568 | 9/11
30 h-m-p 0.0160 8.0000 0.0001 ------Y 357.614111 0 0.0000 590 | 9/11
31 h-m-p 0.0160 8.0000 3.8718 -------------.. | 9/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 357.614111 m 8.0000 634 | 9/11
33 h-m-p 0.0064 3.2043 0.2584 ++++
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
+ 357.613978 m 3.2043 653
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97793) = 5.901260e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97760) = 5.901812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97776) = 5.901536e-161 2000 rounds
| 10/11
34 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97778) = 5.901502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901531e-161 2000 rounds
Y 357.613978 0 1.6000 669
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 6.107548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97793) = 5.901251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97761) = 5.901804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
| 10/11
35 h-m-p 1.0000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901525e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
Y 357.613978 0 0.0000 692
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
Out..
lnL = -357.613978
693 lfun, 8316 eigenQcodon, 45738 P(t)
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -357.636196 S = -357.614322 -0.009625
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:21
did 20 / 41 patterns 0:21
did 30 / 41 patterns 0:21
did 40 / 41 patterns 0:21
did 41 / 41 patterns 0:21
QuantileBeta(0.15, 0.00500, 3.97777) = 5.901527e-161 2000 rounds
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=90
NC_011896_1_WP_010907742_1_484_MLBR_RS02325 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
NC_002677_1_NP_301418_1_290_ML0473 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
**************************************************
NC_011896_1_WP_010907742_1_484_MLBR_RS02325 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
NC_002677_1_NP_301418_1_290_ML0473 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
****************************************
>NC_011896_1_WP_010907742_1_484_MLBR_RS02325 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG GTTCGGATGTCTGGTACTTG >NC_002677_1_NP_301418_1_290_ML0473 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG GTTCGGATGTCTGGTACTTG >NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG GTTCGGATGTCTGGTACTTG >NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG GTTCGGATGTCTGGTACTTG >NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG GTTCGGATGTCTGGTACTTG >NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG GTTCGGATGTCTGGTACTTG
>NC_011896_1_WP_010907742_1_484_MLBR_RS02325 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL >NC_002677_1_NP_301418_1_290_ML0473 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL >NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL >NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL >NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL >NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
#NEXUS
[ID: 1005875860]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907742_1_484_MLBR_RS02325
NC_002677_1_NP_301418_1_290_ML0473
NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655
NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515
NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535
NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907742_1_484_MLBR_RS02325,
2 NC_002677_1_NP_301418_1_290_ML0473,
3 NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655,
4 NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515,
5 NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535,
6 NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07068782,2:0.06929631,3:0.07117171,4:0.06974433,5:0.06672599,6:0.07047759);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07068782,2:0.06929631,3:0.07117171,4:0.06974433,5:0.06672599,6:0.07047759);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -372.81 -376.95
2 -372.84 -375.99
--------------------------------------
TOTAL -372.83 -376.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895957 0.092503 0.338742 1.476517 0.857004 1327.57 1414.28 1.000
r(A<->C){all} 0.173871 0.021054 0.000027 0.462687 0.137751 149.26 203.09 1.000
r(A<->G){all} 0.164072 0.020249 0.000261 0.455768 0.126516 233.56 271.23 1.000
r(A<->T){all} 0.177513 0.023605 0.000002 0.491932 0.132407 168.19 172.16 1.001
r(C<->G){all} 0.155663 0.018058 0.000130 0.438825 0.115392 121.76 140.21 1.000
r(C<->T){all} 0.163454 0.017786 0.000020 0.423166 0.129169 340.80 379.15 1.003
r(G<->T){all} 0.165427 0.020690 0.000001 0.459965 0.124908 257.38 258.48 1.000
pi(A){all} 0.203480 0.000580 0.154751 0.247598 0.202454 1155.82 1319.94 1.001
pi(C){all} 0.248597 0.000687 0.200354 0.299649 0.247946 1277.05 1297.37 1.000
pi(G){all} 0.310479 0.000752 0.256960 0.365068 0.310482 1190.46 1211.35 1.000
pi(T){all} 0.237444 0.000647 0.189649 0.286948 0.236637 1171.36 1194.10 1.000
alpha{1,2} 0.402204 0.213306 0.000143 1.349383 0.240238 976.82 1183.97 1.000
alpha{3} 0.444157 0.220129 0.000156 1.394500 0.289813 1356.72 1428.86 1.000
pinvar{all} 0.993885 0.000053 0.979517 0.999996 0.996260 1434.96 1467.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0473/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 90
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0
CTA 3 3 3 3 3 3 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 1 1 1 1 1 1 | AAC 1 1 1 1 1 1 | AGC 5 5 5 5 5 5
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 1 1 1 1 1 | Asp GAT 3 3 3 3 3 3 | Gly GGT 3 3 3 3 3 3
GTC 5 5 5 5 5 5 | GCC 5 5 5 5 5 5 | GAC 4 4 4 4 4 4 | GGC 1 1 1 1 1 1
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3
GTG 4 4 4 4 4 4 | GCG 2 2 2 2 2 2 | GAG 0 0 0 0 0 0 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907742_1_484_MLBR_RS02325
position 1: T:0.21111 C:0.16667 A:0.18889 G:0.43333
position 2: T:0.34444 C:0.22222 A:0.22222 G:0.21111
position 3: T:0.15556 C:0.35556 A:0.20000 G:0.28889
Average T:0.23704 C:0.24815 A:0.20370 G:0.31111
#2: NC_002677_1_NP_301418_1_290_ML0473
position 1: T:0.21111 C:0.16667 A:0.18889 G:0.43333
position 2: T:0.34444 C:0.22222 A:0.22222 G:0.21111
position 3: T:0.15556 C:0.35556 A:0.20000 G:0.28889
Average T:0.23704 C:0.24815 A:0.20370 G:0.31111
#3: NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655
position 1: T:0.21111 C:0.16667 A:0.18889 G:0.43333
position 2: T:0.34444 C:0.22222 A:0.22222 G:0.21111
position 3: T:0.15556 C:0.35556 A:0.20000 G:0.28889
Average T:0.23704 C:0.24815 A:0.20370 G:0.31111
#4: NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515
position 1: T:0.21111 C:0.16667 A:0.18889 G:0.43333
position 2: T:0.34444 C:0.22222 A:0.22222 G:0.21111
position 3: T:0.15556 C:0.35556 A:0.20000 G:0.28889
Average T:0.23704 C:0.24815 A:0.20370 G:0.31111
#5: NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535
position 1: T:0.21111 C:0.16667 A:0.18889 G:0.43333
position 2: T:0.34444 C:0.22222 A:0.22222 G:0.21111
position 3: T:0.15556 C:0.35556 A:0.20000 G:0.28889
Average T:0.23704 C:0.24815 A:0.20370 G:0.31111
#6: NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625
position 1: T:0.21111 C:0.16667 A:0.18889 G:0.43333
position 2: T:0.34444 C:0.22222 A:0.22222 G:0.21111
position 3: T:0.15556 C:0.35556 A:0.20000 G:0.28889
Average T:0.23704 C:0.24815 A:0.20370 G:0.31111
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 6 | TCC 6 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 18 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 6
CTC 12 | CCC 0 | CAC 6 | CGC 0
CTA 18 | CCA 0 | Gln Q CAA 12 | CGA 0
CTG 6 | CCG 6 | CAG 6 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 6
ATC 24 | ACC 6 | AAC 6 | AGC 30
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 6 | ACG 6 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 6 | Asp D GAT 18 | Gly G GGT 18
GTC 30 | GCC 30 | GAC 24 | GGC 6
GTA 6 | GCA 12 | Glu E GAA 30 | GGA 18
GTG 24 | GCG 12 | GAG 0 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21111 C:0.16667 A:0.18889 G:0.43333
position 2: T:0.34444 C:0.22222 A:0.22222 G:0.21111
position 3: T:0.15556 C:0.35556 A:0.20000 G:0.28889
Average T:0.23704 C:0.24815 A:0.20370 G:0.31111
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -357.614045 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.359648 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907742_1_484_MLBR_RS02325: 0.000004, NC_002677_1_NP_301418_1_290_ML0473: 0.000004, NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655: 0.000004, NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515: 0.000004, NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535: 0.000004, NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.35965
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 200.5 69.5 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 200.5 69.5 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 200.5 69.5 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 200.5 69.5 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 200.5 69.5 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 200.5 69.5 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -357.614031 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.273445 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907742_1_484_MLBR_RS02325: 0.000004, NC_002677_1_NP_301418_1_290_ML0473: 0.000004, NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655: 0.000004, NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515: 0.000004, NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535: 0.000004, NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.27345
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 201.2 68.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 201.2 68.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 201.2 68.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 201.2 68.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 201.2 68.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 201.2 68.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -357.613978 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907742_1_484_MLBR_RS02325: 0.000004, NC_002677_1_NP_301418_1_290_ML0473: 0.000004, NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655: 0.000004, NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515: 0.000004, NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535: 0.000004, NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907742_1_484_MLBR_RS02325)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -357.613978 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.214495
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907742_1_484_MLBR_RS02325: 0.000004, NC_002677_1_NP_301418_1_290_ML0473: 0.000004, NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655: 0.000004, NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515: 0.000004, NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535: 0.000004, NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.21450
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -357.613978 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 3.977769 1.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907742_1_484_MLBR_RS02325: 0.000004, NC_002677_1_NP_301418_1_290_ML0473: 0.000004, NZ_LVXE01000035_1_WP_010907742_1_1564_A3216_RS09655: 0.000004, NZ_LYPH01000039_1_WP_010907742_1_1571_A8144_RS07515: 0.000004, NZ_CP029543_1_WP_010907742_1_495_DIJ64_RS02535: 0.000004, NZ_AP014567_1_WP_010907742_1_513_JK2ML_RS02625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 3.97777
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 204.1 65.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907742_1_484_MLBR_RS02325)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:21
Model 1: NearlyNeutral -357.614031 Model 2: PositiveSelection -357.613978 Model 0: one-ratio -357.614045 Model 7: beta -357.613978 Model 8: beta&w>1 -357.613978 Model 0 vs 1 2.7999999929306796E-5 Model 2 vs 1 1.0600000007343624E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
