--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:46:10 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0473/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -372.81 -376.95
2 -372.84 -375.99
--------------------------------------
TOTAL -372.83 -376.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895957 0.092503 0.338742 1.476517 0.857004 1327.57 1414.28 1.000
r(A<->C){all} 0.173871 0.021054 0.000027 0.462687 0.137751 149.26 203.09 1.000
r(A<->G){all} 0.164072 0.020249 0.000261 0.455768 0.126516 233.56 271.23 1.000
r(A<->T){all} 0.177513 0.023605 0.000002 0.491932 0.132407 168.19 172.16 1.001
r(C<->G){all} 0.155663 0.018058 0.000130 0.438825 0.115392 121.76 140.21 1.000
r(C<->T){all} 0.163454 0.017786 0.000020 0.423166 0.129169 340.80 379.15 1.003
r(G<->T){all} 0.165427 0.020690 0.000001 0.459965 0.124908 257.38 258.48 1.000
pi(A){all} 0.203480 0.000580 0.154751 0.247598 0.202454 1155.82 1319.94 1.001
pi(C){all} 0.248597 0.000687 0.200354 0.299649 0.247946 1277.05 1297.37 1.000
pi(G){all} 0.310479 0.000752 0.256960 0.365068 0.310482 1190.46 1211.35 1.000
pi(T){all} 0.237444 0.000647 0.189649 0.286948 0.236637 1171.36 1194.10 1.000
alpha{1,2} 0.402204 0.213306 0.000143 1.349383 0.240238 976.82 1183.97 1.000
alpha{3} 0.444157 0.220129 0.000156 1.394500 0.289813 1356.72 1428.86 1.000
pinvar{all} 0.993885 0.000053 0.979517 0.999996 0.996260 1434.96 1467.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -357.614031
Model 2: PositiveSelection -357.613978
Model 0: one-ratio -357.614045
Model 7: beta -357.613978
Model 8: beta&w>1 -357.613978
Model 0 vs 1 2.7999999929306796E-5
Model 2 vs 1 1.0600000007343624E-4
Model 8 vs 7 0.0
>C1
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C2
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C3
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C4
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C5
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C6
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=90
C1 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C2 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C3 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C4 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C5 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C6 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
**************************************************
C1 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C2 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C3 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C4 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C5 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C6 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2700]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2700]--->[2700]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.451 Mb, Max= 30.613 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C2 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C3 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C4 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C5 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
C6 VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
**************************************************
C1 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C2 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C3 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C4 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C5 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
C6 EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C2 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C3 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C4 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C5 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
C6 GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
**************************************************
C1 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C2 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C3 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C4 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C5 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
C6 CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
**************************************************
C1 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C2 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C3 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C4 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C5 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
C6 CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
**************************************************
C1 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C2 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C3 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C4 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C5 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
C6 GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
**************************************************
C1 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C2 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C3 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C4 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C5 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
C6 GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
**************************************************
C1 GTTCGGATGTCTGGTACTTG
C2 GTTCGGATGTCTGGTACTTG
C3 GTTCGGATGTCTGGTACTTG
C4 GTTCGGATGTCTGGTACTTG
C5 GTTCGGATGTCTGGTACTTG
C6 GTTCGGATGTCTGGTACTTG
********************
>C1
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C2
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C3
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C4
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C5
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C6
GTGCGTACAGTCGACGTGTTGATCACGCTTAGCATCGGAAGCAGTTGGAG
CGAACTTGGTGACCAGGTCCAAGACGCACTCGCCGAAGCGCTACTGCACC
CGGCAACTTGGTGGGCCGATGTGGTAACCGATGACTTCGCCAACTTGGCG
GAAATCTCCAGCAAGCTACTCATGGGATTGATCGGCGCCCTAGCCGAATC
GCATGTCGGATCAGTCGAATTGGTGTCGTTGGCTTGGAGCCAATTTGGTG
GTTCGGATGTCTGGTACTTG
>C1
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C2
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C3
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C4
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C5
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
>C6
VRTVDVLITLSIGSSWSELGDQVQDALAEALLHPATWWADVVTDDFANLA
EISSKLLMGLIGALAESHVGSVELVSLAWSQFGGSDVWYL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 270 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579801485
Setting output file names to "/data/4res/ML0473/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 148623613
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1005875860
Seed = 2028431682
Swapseed = 1579801485
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -604.272943 -- -24.965149
Chain 2 -- -604.272851 -- -24.965149
Chain 3 -- -604.272851 -- -24.965149
Chain 4 -- -604.272908 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -604.272943 -- -24.965149
Chain 2 -- -604.272943 -- -24.965149
Chain 3 -- -604.272943 -- -24.965149
Chain 4 -- -604.272943 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-604.273] (-604.273) (-604.273) (-604.273) * [-604.273] (-604.273) (-604.273) (-604.273)
500 -- [-383.799] (-382.583) (-379.538) (-376.944) * (-388.435) (-392.313) [-380.227] (-383.558) -- 0:00:00
1000 -- (-382.731) (-387.530) [-377.295] (-385.570) * (-380.046) (-379.338) [-380.704] (-377.095) -- 0:00:00
1500 -- (-380.237) (-386.547) (-384.553) [-377.618] * [-377.833] (-393.433) (-383.972) (-378.440) -- 0:00:00
2000 -- (-381.245) (-382.999) (-380.998) [-380.706] * (-381.092) (-382.619) [-381.941] (-383.193) -- 0:00:00
2500 -- (-379.578) [-381.921] (-382.490) (-382.811) * (-384.844) (-380.622) (-393.513) [-383.260] -- 0:00:00
3000 -- (-379.798) (-387.687) (-387.952) [-379.548] * (-376.729) (-391.469) [-377.065] (-382.493) -- 0:00:00
3500 -- (-387.208) (-389.808) (-380.626) [-387.777] * (-385.412) (-380.817) [-385.438] (-380.952) -- 0:00:00
4000 -- [-383.519] (-391.718) (-380.544) (-388.761) * [-380.608] (-383.223) (-380.880) (-384.166) -- 0:00:00
4500 -- (-377.772) [-382.613] (-381.448) (-377.777) * (-384.307) [-376.831] (-390.622) (-380.575) -- 0:00:00
5000 -- [-378.681] (-380.426) (-388.714) (-383.566) * [-389.048] (-378.785) (-381.416) (-379.007) -- 0:00:00
Average standard deviation of split frequencies: 0.099995
5500 -- (-385.738) [-375.577] (-380.842) (-380.312) * (-376.108) (-389.091) (-387.800) [-382.676] -- 0:00:00
6000 -- (-382.749) (-381.985) (-387.242) [-385.681] * (-382.391) (-381.664) (-387.241) [-377.847] -- 0:00:00
6500 -- (-384.870) [-377.472] (-382.404) (-379.196) * (-388.846) (-387.818) [-394.222] (-382.546) -- 0:00:00
7000 -- (-388.360) (-388.709) (-385.821) [-378.777] * [-380.873] (-379.652) (-384.092) (-377.036) -- 0:00:00
7500 -- (-386.283) (-380.259) (-386.315) [-376.916] * (-381.747) (-398.470) [-376.419] (-379.192) -- 0:00:00
8000 -- (-383.414) (-378.734) [-379.576] (-386.572) * [-378.300] (-392.121) (-379.076) (-389.643) -- 0:00:00
8500 -- (-387.437) [-380.697] (-383.251) (-391.766) * (-390.569) [-373.141] (-389.414) (-383.232) -- 0:00:00
9000 -- (-380.850) (-383.578) [-381.453] (-388.017) * (-393.680) (-372.513) [-388.547] (-388.624) -- 0:00:00
9500 -- (-374.097) [-381.272] (-381.699) (-381.542) * (-388.293) (-373.124) (-383.234) [-380.104] -- 0:00:00
10000 -- (-375.033) [-380.271] (-387.411) (-379.477) * [-372.345] (-376.024) (-392.699) (-378.510) -- 0:00:00
Average standard deviation of split frequencies: 0.072106
10500 -- (-372.439) (-378.489) [-384.345] (-392.441) * (-374.328) (-371.464) (-388.785) [-385.529] -- 0:00:00
11000 -- [-372.856] (-378.594) (-390.013) (-377.346) * (-372.815) (-373.744) (-389.431) [-384.784] -- 0:00:00
11500 -- [-376.379] (-382.193) (-384.316) (-376.436) * (-372.126) (-373.144) [-381.858] (-387.780) -- 0:00:00
12000 -- (-373.358) (-379.422) [-382.229] (-373.202) * [-371.678] (-374.116) (-385.519) (-390.448) -- 0:00:00
12500 -- (-374.460) [-382.359] (-385.143) (-374.977) * (-372.992) (-373.942) (-383.612) [-379.922] -- 0:01:19
13000 -- (-375.380) [-384.706] (-379.320) (-374.137) * (-372.538) (-372.652) [-380.311] (-386.673) -- 0:01:15
13500 -- (-375.617) (-381.441) [-382.819] (-373.897) * (-373.772) (-373.110) (-386.994) [-379.376] -- 0:01:13
14000 -- (-373.995) (-386.359) [-382.881] (-372.426) * [-371.966] (-377.317) (-384.063) (-383.660) -- 0:01:10
14500 -- (-375.100) (-383.183) [-386.494] (-372.069) * (-372.419) [-371.490] (-385.974) (-394.621) -- 0:01:07
15000 -- (-372.105) (-378.137) [-384.353] (-372.719) * (-376.466) (-372.828) [-390.215] (-383.145) -- 0:01:05
Average standard deviation of split frequencies: 0.066291
15500 -- (-373.100) (-389.933) [-383.630] (-373.246) * (-372.041) [-373.114] (-382.581) (-383.734) -- 0:01:03
16000 -- (-373.184) (-374.925) (-380.749) [-372.461] * (-372.820) [-374.507] (-388.401) (-384.786) -- 0:01:01
16500 -- (-373.329) (-374.665) [-380.967] (-373.253) * (-373.426) (-374.290) (-388.613) [-383.304] -- 0:00:59
17000 -- (-373.256) (-374.640) [-382.875] (-373.056) * (-372.629) (-373.676) (-379.056) [-386.232] -- 0:00:57
17500 -- (-372.649) (-374.792) (-396.360) [-374.307] * (-373.267) [-373.635] (-389.360) (-380.287) -- 0:00:56
18000 -- (-373.445) (-375.291) [-387.885] (-380.194) * (-375.617) (-373.000) [-398.191] (-381.747) -- 0:00:54
18500 -- [-374.232] (-376.068) (-380.224) (-372.050) * [-373.405] (-374.468) (-378.729) (-387.853) -- 0:00:53
19000 -- (-375.329) (-375.782) (-386.942) [-375.943] * (-373.667) (-375.158) (-387.028) [-380.498] -- 0:00:51
19500 -- (-373.219) (-378.926) [-378.049] (-373.482) * (-371.904) [-375.213] (-383.986) (-382.823) -- 0:00:50
20000 -- [-372.825] (-372.650) (-383.975) (-372.138) * (-375.079) (-373.548) (-375.797) [-379.067] -- 0:00:49
Average standard deviation of split frequencies: 0.053603
20500 -- [-373.336] (-373.667) (-385.625) (-372.837) * [-371.963] (-373.258) (-383.559) (-387.423) -- 0:00:47
21000 -- [-371.992] (-374.388) (-384.090) (-371.742) * (-374.803) (-372.725) (-381.017) [-384.319] -- 0:00:46
21500 -- (-372.749) [-371.850] (-386.568) (-373.597) * (-373.185) (-373.035) (-381.011) [-379.654] -- 0:00:45
22000 -- (-373.795) (-371.612) (-389.770) [-374.049] * [-371.696] (-375.801) (-381.677) (-384.220) -- 0:00:44
22500 -- (-372.131) (-371.987) [-381.703] (-371.732) * (-377.522) [-373.782] (-380.257) (-395.381) -- 0:00:43
23000 -- (-372.992) (-374.852) (-381.194) [-372.700] * (-377.138) (-375.433) (-398.041) [-382.006] -- 0:00:42
23500 -- [-373.491] (-373.472) (-381.602) (-371.320) * (-373.958) (-373.958) (-397.555) [-381.698] -- 0:00:41
24000 -- (-373.595) (-372.623) (-389.663) [-372.828] * [-373.993] (-373.693) (-388.150) (-381.490) -- 0:00:40
24500 -- [-373.163] (-373.806) (-380.707) (-371.930) * (-376.112) (-373.682) (-387.465) [-385.288] -- 0:00:39
25000 -- (-375.413) [-374.411] (-385.837) (-375.504) * (-374.326) [-374.396] (-372.755) (-378.594) -- 0:00:39
Average standard deviation of split frequencies: 0.051803
25500 -- (-375.337) (-374.860) (-375.133) [-378.014] * (-372.783) (-374.571) [-371.914] (-383.514) -- 0:00:38
26000 -- (-373.023) [-374.824] (-375.519) (-377.229) * (-373.704) (-374.593) (-374.838) [-379.217] -- 0:00:37
26500 -- (-372.257) (-377.053) (-377.569) [-374.193] * [-371.342] (-373.328) (-373.520) (-390.616) -- 0:00:36
27000 -- (-372.388) (-377.775) (-382.018) [-373.437] * [-374.288] (-376.147) (-376.192) (-380.252) -- 0:00:36
27500 -- (-374.800) (-373.769) [-379.249] (-374.960) * (-371.392) (-373.702) (-373.926) [-384.439] -- 0:00:35
28000 -- (-372.870) [-373.047] (-383.990) (-374.179) * (-374.993) (-372.549) (-373.724) [-377.327] -- 0:00:34
28500 -- [-372.552] (-372.885) (-379.559) (-379.181) * (-374.413) (-372.119) [-372.668] (-384.312) -- 0:00:34
29000 -- [-373.975] (-372.236) (-387.875) (-378.301) * [-371.732] (-374.362) (-373.521) (-379.904) -- 0:00:33
29500 -- (-375.917) (-372.582) [-377.086] (-378.116) * (-372.204) [-372.818] (-376.202) (-387.066) -- 0:01:05
30000 -- [-374.753] (-372.059) (-385.879) (-372.287) * [-374.962] (-372.272) (-373.391) (-388.336) -- 0:01:04
Average standard deviation of split frequencies: 0.052704
30500 -- (-376.284) (-375.894) (-386.544) [-372.828] * (-372.138) (-372.053) (-372.368) [-389.991] -- 0:01:03
31000 -- (-374.636) (-375.752) [-385.687] (-374.046) * (-372.049) [-373.831] (-373.251) (-383.817) -- 0:01:02
31500 -- (-372.274) (-373.716) [-394.537] (-373.543) * (-372.605) (-373.820) [-371.684] (-387.080) -- 0:01:01
32000 -- (-372.195) [-377.703] (-389.430) (-373.129) * (-374.007) [-372.001] (-375.698) (-377.711) -- 0:01:00
32500 -- [-373.311] (-375.169) (-389.288) (-374.066) * [-373.045] (-371.918) (-377.249) (-386.459) -- 0:00:59
33000 -- (-377.902) (-375.206) (-385.395) [-372.499] * [-372.353] (-374.278) (-372.260) (-379.667) -- 0:00:58
33500 -- (-372.585) (-373.900) [-373.293] (-373.113) * (-373.646) (-373.864) (-375.032) [-384.764] -- 0:00:57
34000 -- (-372.830) (-376.175) [-372.613] (-372.877) * (-374.616) (-373.791) (-374.823) [-378.639] -- 0:00:56
34500 -- [-372.317] (-377.647) (-377.813) (-372.255) * (-373.931) (-375.386) (-378.525) [-391.218] -- 0:00:55
35000 -- (-374.391) (-373.076) [-371.475] (-377.441) * (-376.410) [-372.700] (-373.185) (-391.186) -- 0:00:55
Average standard deviation of split frequencies: 0.043450
35500 -- (-374.059) [-377.860] (-372.990) (-372.026) * [-372.269] (-374.062) (-372.960) (-385.916) -- 0:00:54
36000 -- (-375.217) (-375.345) (-373.902) [-373.628] * (-373.022) [-373.328] (-373.573) (-377.685) -- 0:00:53
36500 -- (-378.742) (-377.233) [-374.565] (-374.415) * [-372.603] (-374.588) (-373.082) (-388.281) -- 0:00:52
37000 -- (-376.932) [-372.381] (-374.309) (-372.913) * (-377.513) (-374.845) [-372.751] (-381.494) -- 0:00:52
37500 -- (-375.932) (-374.185) (-374.314) [-372.703] * (-372.809) [-374.004] (-373.168) (-389.768) -- 0:00:51
38000 -- (-373.406) [-374.196] (-372.747) (-374.045) * (-374.212) (-371.295) [-374.580] (-390.453) -- 0:00:50
38500 -- (-373.540) (-373.521) (-373.889) [-373.356] * (-372.787) (-373.818) (-373.846) [-376.328] -- 0:00:49
39000 -- (-375.029) (-373.070) [-372.076] (-374.529) * (-371.861) (-377.270) (-375.800) [-383.234] -- 0:00:49
39500 -- (-375.754) [-373.090] (-373.940) (-374.014) * [-376.603] (-372.987) (-375.352) (-379.628) -- 0:00:48
40000 -- (-379.058) (-371.878) [-374.223] (-373.618) * (-372.750) [-373.753] (-377.706) (-382.544) -- 0:00:48
Average standard deviation of split frequencies: 0.045788
40500 -- [-373.477] (-374.512) (-373.434) (-374.880) * (-375.890) (-374.165) (-374.478) [-383.107] -- 0:00:47
41000 -- (-373.698) (-372.870) [-373.267] (-374.787) * (-372.111) (-372.070) [-373.415] (-384.346) -- 0:00:46
41500 -- (-374.445) (-375.465) (-375.307) [-375.168] * (-374.049) (-378.088) [-373.955] (-383.212) -- 0:00:46
42000 -- (-371.372) (-374.787) [-373.995] (-372.762) * (-372.630) (-376.041) [-373.435] (-387.251) -- 0:00:45
42500 -- (-371.993) (-373.299) (-373.532) [-371.545] * (-373.287) (-372.036) (-379.013) [-381.166] -- 0:00:45
43000 -- [-372.714] (-377.462) (-371.897) (-371.880) * (-373.410) (-372.508) (-377.918) [-387.199] -- 0:00:44
43500 -- (-372.283) [-372.497] (-372.740) (-372.246) * (-374.083) [-373.011] (-373.823) (-371.502) -- 0:00:43
44000 -- (-372.361) [-374.400] (-372.927) (-372.498) * (-377.280) (-374.482) (-373.543) [-371.481] -- 0:00:43
44500 -- (-372.608) [-372.570] (-372.404) (-373.090) * (-372.636) (-375.684) (-373.266) [-372.700] -- 0:00:42
45000 -- [-371.735] (-374.314) (-373.410) (-374.153) * (-372.702) (-371.693) (-378.850) [-375.451] -- 0:01:03
Average standard deviation of split frequencies: 0.042774
45500 -- (-371.981) (-372.165) [-373.691] (-373.143) * (-373.971) (-378.189) (-375.842) [-373.433] -- 0:01:02
46000 -- [-372.822] (-371.321) (-371.701) (-372.512) * (-375.048) (-377.969) (-371.438) [-372.696] -- 0:01:02
46500 -- (-376.422) (-371.866) [-374.041] (-371.871) * (-374.812) [-376.452] (-376.489) (-374.001) -- 0:01:01
47000 -- (-378.452) [-373.177] (-376.977) (-371.454) * (-372.072) [-374.021] (-378.618) (-376.277) -- 0:01:00
47500 -- (-375.658) [-375.117] (-374.219) (-374.459) * (-372.561) [-374.787] (-376.908) (-374.754) -- 0:01:00
48000 -- (-371.298) [-373.001] (-379.548) (-374.268) * (-375.051) (-372.762) (-373.436) [-374.486] -- 0:00:59
48500 -- (-373.202) (-373.623) (-373.053) [-372.244] * (-374.259) (-372.277) (-373.715) [-375.675] -- 0:00:58
49000 -- (-372.212) (-374.475) (-373.178) [-372.715] * [-372.421] (-374.478) (-372.083) (-372.029) -- 0:00:58
49500 -- (-375.251) (-376.999) (-373.876) [-373.602] * (-373.970) (-375.555) (-372.769) [-372.653] -- 0:00:57
50000 -- [-376.000] (-374.648) (-374.051) (-373.550) * (-376.075) [-372.434] (-372.491) (-377.620) -- 0:00:57
Average standard deviation of split frequencies: 0.037216
50500 -- (-375.222) (-373.626) (-375.178) [-372.996] * (-371.506) [-372.874] (-371.602) (-372.633) -- 0:00:56
51000 -- (-373.481) (-372.896) (-373.534) [-373.362] * (-374.261) [-371.989] (-373.644) (-376.063) -- 0:00:55
51500 -- (-373.041) (-373.760) [-373.776] (-374.381) * (-372.173) (-374.688) (-373.781) [-373.480] -- 0:00:55
52000 -- (-371.959) (-373.310) (-371.536) [-376.558] * (-373.752) [-375.091] (-372.299) (-372.941) -- 0:00:54
52500 -- (-373.034) (-375.066) (-371.965) [-377.331] * (-374.843) [-373.298] (-372.792) (-374.002) -- 0:00:54
53000 -- (-373.606) (-372.821) (-375.556) [-372.067] * (-374.812) (-374.472) (-372.672) [-372.022] -- 0:00:53
53500 -- (-377.700) (-373.040) [-373.410] (-372.984) * [-371.688] (-371.853) (-374.569) (-376.914) -- 0:00:53
54000 -- [-372.245] (-375.484) (-375.457) (-373.886) * (-372.318) (-375.796) [-373.756] (-374.255) -- 0:00:52
54500 -- (-374.444) (-374.462) (-374.271) [-375.468] * (-373.852) [-373.085] (-376.677) (-371.527) -- 0:00:52
55000 -- (-373.533) (-372.026) (-374.829) [-372.736] * (-373.786) (-374.963) [-373.707] (-372.296) -- 0:00:51
Average standard deviation of split frequencies: 0.032830
55500 -- (-373.506) [-371.970] (-374.604) (-373.993) * (-372.974) (-376.811) [-374.522] (-372.585) -- 0:00:51
56000 -- (-371.913) [-374.313] (-374.801) (-376.681) * (-372.939) (-375.779) [-375.940] (-377.264) -- 0:00:50
56500 -- (-374.269) (-373.101) [-373.609] (-373.756) * [-371.745] (-372.192) (-371.965) (-376.550) -- 0:00:50
57000 -- (-375.223) [-374.497] (-374.330) (-372.363) * (-373.091) [-373.709] (-372.163) (-374.332) -- 0:00:49
57500 -- (-373.584) (-374.900) (-372.585) [-373.985] * (-372.575) [-373.060] (-371.861) (-374.309) -- 0:00:49
58000 -- (-373.536) (-377.428) (-374.932) [-373.807] * [-374.901] (-374.073) (-374.477) (-375.893) -- 0:00:48
58500 -- (-374.315) (-376.098) [-373.303] (-376.985) * (-376.645) [-372.437] (-375.016) (-373.097) -- 0:00:48
59000 -- (-372.182) [-374.878] (-372.387) (-375.232) * (-373.046) (-373.089) (-372.798) [-372.476] -- 0:00:47
59500 -- [-372.761] (-371.811) (-374.489) (-372.265) * (-372.568) [-373.340] (-374.082) (-373.636) -- 0:00:47
60000 -- (-373.351) (-373.648) [-372.997] (-374.902) * (-373.217) (-372.426) [-373.561] (-371.743) -- 0:00:47
Average standard deviation of split frequencies: 0.028219
60500 -- (-372.017) (-373.430) [-376.370] (-373.029) * (-373.062) (-372.694) (-375.771) [-371.852] -- 0:01:02
61000 -- (-371.999) (-372.338) (-373.020) [-374.797] * (-375.596) (-374.968) [-373.630] (-373.392) -- 0:01:01
61500 -- (-373.316) (-373.665) [-375.627] (-372.237) * [-371.524] (-372.789) (-378.793) (-375.827) -- 0:01:01
62000 -- (-379.627) [-374.396] (-376.099) (-372.762) * (-375.051) (-371.355) (-374.434) [-372.448] -- 0:01:00
62500 -- (-375.485) [-374.529] (-374.518) (-372.434) * (-372.893) (-381.294) [-375.936] (-371.770) -- 0:01:00
63000 -- (-373.838) [-373.500] (-371.982) (-372.921) * (-382.332) (-374.288) (-373.291) [-372.644] -- 0:00:59
63500 -- (-371.886) [-374.187] (-374.044) (-374.905) * (-375.567) (-374.963) [-373.912] (-373.710) -- 0:00:58
64000 -- [-372.544] (-374.715) (-372.206) (-373.215) * (-372.553) [-374.213] (-374.284) (-374.700) -- 0:00:58
64500 -- (-374.337) (-374.083) (-372.646) [-374.420] * (-372.919) (-375.082) (-377.154) [-374.835] -- 0:00:58
65000 -- (-379.054) [-374.805] (-373.124) (-372.144) * [-373.344] (-373.046) (-372.292) (-376.618) -- 0:00:57
Average standard deviation of split frequencies: 0.025154
65500 -- (-374.011) (-373.079) (-371.583) [-373.582] * (-373.822) (-372.135) [-372.475] (-375.656) -- 0:00:57
66000 -- (-373.635) (-374.138) [-372.306] (-374.395) * (-376.483) (-371.583) [-372.872] (-373.349) -- 0:00:56
66500 -- (-376.018) [-373.718] (-372.408) (-371.268) * (-373.974) (-373.948) (-375.053) [-377.216] -- 0:00:56
67000 -- (-375.104) [-372.102] (-371.721) (-372.282) * (-372.321) (-372.283) [-372.528] (-379.986) -- 0:00:55
67500 -- (-374.939) (-373.935) (-372.086) [-372.363] * (-372.564) [-373.508] (-373.209) (-374.199) -- 0:00:55
68000 -- (-371.737) (-377.973) [-372.485] (-372.953) * [-372.414] (-372.976) (-376.202) (-376.909) -- 0:00:54
68500 -- (-372.798) (-374.816) [-373.658] (-373.371) * (-377.667) (-373.827) [-373.001] (-372.983) -- 0:00:54
69000 -- (-374.006) (-374.947) (-373.356) [-372.037] * [-372.959] (-373.890) (-371.654) (-373.813) -- 0:00:53
69500 -- [-374.512] (-372.135) (-376.870) (-372.339) * (-372.404) (-372.552) [-374.745] (-372.850) -- 0:00:53
70000 -- [-373.302] (-372.197) (-373.235) (-379.101) * (-374.236) [-372.790] (-376.452) (-382.347) -- 0:00:53
Average standard deviation of split frequencies: 0.025294
70500 -- [-374.258] (-375.394) (-374.028) (-374.351) * (-371.485) (-373.905) [-372.979] (-388.541) -- 0:00:52
71000 -- (-375.034) (-373.369) (-375.124) [-375.071] * (-378.504) [-373.748] (-372.152) (-374.548) -- 0:00:52
71500 -- (-373.604) (-373.195) [-377.784] (-374.056) * (-371.984) (-373.255) [-371.222] (-375.160) -- 0:00:51
72000 -- [-374.415] (-377.087) (-373.589) (-373.962) * (-373.576) (-372.567) [-371.794] (-372.046) -- 0:00:51
72500 -- [-374.787] (-376.600) (-372.783) (-372.062) * (-372.241) (-373.172) (-373.752) [-372.894] -- 0:00:51
73000 -- [-377.354] (-373.747) (-372.332) (-372.932) * (-371.722) (-372.088) (-375.273) [-374.137] -- 0:00:50
73500 -- (-374.833) [-371.901] (-377.103) (-372.474) * (-374.144) (-373.258) [-374.786] (-374.472) -- 0:00:50
74000 -- (-376.786) [-374.769] (-373.530) (-374.635) * (-373.136) (-374.305) [-374.885] (-374.595) -- 0:00:50
74500 -- (-373.569) (-372.883) [-372.465] (-374.943) * (-376.979) (-373.142) (-372.626) [-375.706] -- 0:00:49
75000 -- (-372.824) (-373.918) (-375.706) [-374.589] * (-376.682) (-373.718) [-373.035] (-375.821) -- 0:00:49
Average standard deviation of split frequencies: 0.023570
75500 -- (-373.990) (-379.687) (-377.381) [-379.368] * [-373.946] (-372.782) (-373.369) (-379.894) -- 0:00:48
76000 -- (-372.842) [-372.828] (-372.684) (-373.592) * [-374.555] (-374.570) (-372.548) (-373.074) -- 0:00:48
76500 -- (-376.159) (-375.929) (-372.427) [-371.752] * (-372.478) (-373.096) [-374.415] (-374.196) -- 0:00:48
77000 -- (-372.863) [-372.749] (-373.057) (-376.598) * (-371.618) [-372.231] (-375.041) (-373.202) -- 0:00:47
77500 -- (-372.118) (-373.826) [-372.838] (-376.490) * (-372.539) [-371.868] (-375.210) (-373.109) -- 0:00:59
78000 -- (-371.639) [-374.396] (-371.781) (-373.014) * (-372.787) (-373.745) (-374.220) [-373.377] -- 0:00:59
78500 -- (-377.201) (-373.659) [-371.567] (-374.358) * (-373.088) [-372.366] (-376.820) (-373.498) -- 0:00:58
79000 -- (-371.589) [-372.122] (-380.951) (-375.894) * [-377.662] (-373.457) (-375.993) (-377.011) -- 0:00:58
79500 -- [-375.872] (-374.787) (-372.813) (-376.093) * [-372.772] (-372.776) (-374.089) (-371.864) -- 0:00:57
80000 -- (-373.753) (-372.661) (-371.899) [-373.419] * (-374.974) [-371.626] (-373.954) (-372.939) -- 0:00:57
Average standard deviation of split frequencies: 0.024767
80500 -- (-371.975) (-375.337) (-372.437) [-372.629] * [-375.544] (-374.499) (-374.592) (-372.676) -- 0:00:57
81000 -- (-371.299) [-376.651] (-372.683) (-374.025) * (-374.660) [-374.034] (-375.949) (-372.937) -- 0:00:56
81500 -- (-374.004) (-375.637) (-375.394) [-372.271] * (-372.534) [-371.302] (-378.216) (-373.135) -- 0:00:56
82000 -- [-372.657] (-375.624) (-374.522) (-372.355) * (-373.121) (-371.701) [-375.185] (-372.505) -- 0:00:55
82500 -- [-373.403] (-372.994) (-377.265) (-373.164) * (-372.841) [-372.396] (-372.900) (-373.209) -- 0:00:55
83000 -- (-372.122) [-376.823] (-374.314) (-377.705) * (-374.624) [-372.761] (-373.456) (-372.472) -- 0:00:55
83500 -- (-372.308) [-371.841] (-373.715) (-374.733) * [-374.683] (-371.523) (-377.113) (-372.159) -- 0:00:54
84000 -- (-373.851) (-371.797) (-373.491) [-371.559] * [-373.959] (-372.252) (-375.081) (-372.159) -- 0:00:54
84500 -- (-374.083) (-378.307) (-374.691) [-374.995] * (-373.706) (-371.911) [-377.768] (-373.286) -- 0:00:54
85000 -- (-372.864) [-372.866] (-374.681) (-373.523) * (-373.207) (-372.185) (-374.702) [-374.660] -- 0:00:53
Average standard deviation of split frequencies: 0.027407
85500 -- (-373.490) (-372.524) [-375.129] (-374.018) * (-373.417) (-373.410) [-371.740] (-377.791) -- 0:00:53
86000 -- [-372.926] (-372.353) (-372.315) (-374.214) * (-372.551) (-375.732) (-371.625) [-375.442] -- 0:00:53
86500 -- (-374.192) (-375.313) [-371.202] (-377.508) * (-374.265) [-376.901] (-372.289) (-377.500) -- 0:00:52
87000 -- (-373.499) (-376.218) [-371.398] (-374.107) * [-371.988] (-377.979) (-371.651) (-372.689) -- 0:00:52
87500 -- (-374.911) (-372.448) (-371.751) [-374.817] * (-373.128) (-373.879) (-372.404) [-373.443] -- 0:00:52
88000 -- (-374.310) [-374.200] (-373.306) (-374.995) * (-371.852) [-375.506] (-373.588) (-374.012) -- 0:00:51
88500 -- [-372.737] (-372.364) (-371.938) (-372.784) * (-371.404) (-374.825) [-373.610] (-377.847) -- 0:00:51
89000 -- [-375.554] (-371.886) (-374.466) (-375.456) * [-372.021] (-375.145) (-371.690) (-372.429) -- 0:00:51
89500 -- (-374.112) (-377.308) (-373.751) [-373.233] * (-371.841) (-371.922) [-372.022] (-374.311) -- 0:00:50
90000 -- (-377.948) (-377.633) (-371.488) [-376.694] * (-372.517) (-374.570) (-373.126) [-374.070] -- 0:00:50
Average standard deviation of split frequencies: 0.025760
90500 -- [-374.273] (-375.058) (-373.585) (-372.807) * (-372.524) (-374.512) [-375.181] (-373.164) -- 0:00:50
91000 -- (-373.379) [-373.819] (-374.331) (-371.929) * (-380.070) [-374.229] (-374.893) (-374.461) -- 0:00:49
91500 -- [-374.170] (-374.503) (-373.623) (-373.221) * (-376.340) (-374.053) [-375.565] (-372.233) -- 0:00:49
92000 -- (-372.400) (-373.111) [-374.989] (-374.727) * (-372.707) [-373.349] (-372.515) (-372.445) -- 0:00:49
92500 -- (-373.245) [-375.109] (-373.729) (-374.718) * (-373.113) (-372.042) (-373.229) [-375.090] -- 0:00:49
93000 -- [-376.218] (-374.420) (-373.972) (-375.671) * (-375.736) (-373.002) (-372.261) [-371.544] -- 0:00:48
93500 -- (-374.359) (-373.946) (-375.755) [-373.761] * (-376.963) (-376.693) (-374.330) [-373.677] -- 0:00:48
94000 -- [-372.274] (-373.750) (-376.464) (-373.297) * [-376.293] (-378.685) (-374.363) (-376.049) -- 0:00:48
94500 -- [-373.416] (-374.338) (-373.362) (-374.640) * (-373.964) (-375.273) (-374.930) [-373.738] -- 0:00:57
95000 -- [-373.027] (-375.737) (-374.758) (-377.545) * (-375.689) (-376.449) (-371.690) [-373.695] -- 0:00:57
Average standard deviation of split frequencies: 0.028527
95500 -- (-376.802) [-375.713] (-376.075) (-372.624) * [-374.561] (-373.923) (-372.521) (-376.867) -- 0:00:56
96000 -- (-373.612) [-372.055] (-376.379) (-372.221) * (-377.178) (-372.008) (-375.976) [-372.977] -- 0:00:56
96500 -- [-372.011] (-373.523) (-373.299) (-373.281) * (-372.291) [-372.982] (-374.590) (-375.260) -- 0:00:56
97000 -- (-373.944) [-375.268] (-372.136) (-372.711) * (-373.318) (-373.781) [-373.094] (-379.314) -- 0:00:55
97500 -- (-373.503) (-375.188) [-372.471] (-371.999) * [-371.917] (-376.486) (-375.648) (-372.109) -- 0:00:55
98000 -- [-374.208] (-373.899) (-373.976) (-373.799) * [-372.373] (-372.296) (-371.698) (-374.291) -- 0:00:55
98500 -- (-374.979) [-373.290] (-375.344) (-379.269) * (-371.598) (-373.790) [-373.997] (-372.789) -- 0:00:54
99000 -- (-379.057) (-375.157) [-374.677] (-375.093) * (-372.745) (-372.610) (-373.839) [-373.751] -- 0:00:54
99500 -- (-374.135) (-374.130) [-381.075] (-372.653) * (-373.614) (-372.328) (-375.166) [-372.125] -- 0:00:54
100000 -- (-376.188) (-372.946) [-381.294] (-373.179) * (-373.254) (-373.798) [-371.920] (-373.251) -- 0:00:54
Average standard deviation of split frequencies: 0.030226
100500 -- (-378.788) (-374.389) (-377.210) [-375.393] * (-374.814) (-371.923) [-372.026] (-371.691) -- 0:00:53
101000 -- (-375.170) (-373.417) [-372.601] (-374.343) * (-375.103) (-373.173) (-372.388) [-378.085] -- 0:00:53
101500 -- [-372.890] (-371.186) (-374.481) (-373.104) * [-374.519] (-372.122) (-373.500) (-372.621) -- 0:00:53
102000 -- (-375.333) [-373.055] (-372.790) (-377.908) * (-373.842) (-373.762) [-371.470] (-372.396) -- 0:00:52
102500 -- (-376.122) [-372.481] (-372.867) (-374.328) * (-371.692) [-377.260] (-372.981) (-374.518) -- 0:00:52
103000 -- (-375.731) (-376.403) (-372.269) [-375.249] * (-373.263) (-373.611) (-374.847) [-372.213] -- 0:00:52
103500 -- (-372.127) [-374.079] (-373.328) (-374.316) * (-372.175) [-375.334] (-373.858) (-372.035) -- 0:00:51
104000 -- [-371.475] (-373.186) (-373.354) (-376.599) * (-374.224) (-372.327) (-373.539) [-375.158] -- 0:00:51
104500 -- (-371.708) (-373.615) [-372.984] (-373.932) * (-374.933) (-372.765) [-373.856] (-373.279) -- 0:00:51
105000 -- [-372.559] (-374.110) (-374.824) (-372.527) * (-372.793) (-372.495) [-372.142] (-378.251) -- 0:00:51
Average standard deviation of split frequencies: 0.030524
105500 -- (-376.638) [-373.256] (-375.248) (-372.333) * (-374.174) [-374.805] (-379.842) (-371.829) -- 0:00:50
106000 -- (-378.459) (-373.131) (-374.953) [-372.452] * (-374.006) (-374.732) (-373.172) [-373.465] -- 0:00:50
106500 -- (-373.915) (-372.454) [-371.443] (-375.461) * (-377.227) [-371.938] (-374.201) (-371.843) -- 0:00:50
107000 -- (-373.158) [-375.326] (-375.137) (-373.075) * (-372.244) [-372.807] (-375.463) (-375.019) -- 0:00:50
107500 -- [-372.026] (-374.692) (-375.744) (-373.354) * (-373.918) (-374.444) (-373.469) [-374.328] -- 0:00:49
108000 -- (-373.642) [-372.729] (-373.327) (-372.992) * (-374.116) (-377.110) (-371.711) [-376.394] -- 0:00:49
108500 -- (-374.228) [-372.470] (-372.485) (-375.375) * [-372.190] (-373.548) (-374.288) (-376.005) -- 0:00:49
109000 -- (-373.353) [-372.168] (-376.154) (-372.873) * (-372.649) [-374.726] (-374.555) (-372.732) -- 0:00:49
109500 -- (-373.103) (-374.423) [-373.796] (-373.870) * (-374.558) (-374.147) (-373.550) [-373.849] -- 0:00:48
110000 -- (-373.035) (-373.732) [-373.019] (-372.866) * (-374.108) (-374.441) (-374.751) [-372.579] -- 0:00:48
Average standard deviation of split frequencies: 0.026572
110500 -- [-371.903] (-372.183) (-372.443) (-372.625) * (-373.382) [-373.262] (-372.629) (-373.871) -- 0:00:48
111000 -- (-372.027) [-375.111] (-375.286) (-374.303) * (-372.795) [-372.680] (-374.704) (-379.012) -- 0:00:56
111500 -- (-372.551) [-374.778] (-372.240) (-371.857) * (-374.582) [-372.626] (-374.413) (-376.323) -- 0:00:55
112000 -- [-372.494] (-375.221) (-372.835) (-371.608) * (-373.031) (-374.552) (-372.414) [-381.033] -- 0:00:55
112500 -- [-372.999] (-374.222) (-373.809) (-373.086) * [-374.745] (-374.328) (-372.966) (-376.316) -- 0:00:55
113000 -- (-374.158) (-372.682) [-372.090] (-374.209) * (-372.965) (-372.302) (-371.540) [-376.136] -- 0:00:54
113500 -- [-371.448] (-373.487) (-373.310) (-373.147) * (-375.393) (-371.751) (-372.685) [-373.422] -- 0:00:54
114000 -- [-371.908] (-375.115) (-372.985) (-377.282) * [-375.633] (-373.676) (-373.757) (-372.152) -- 0:00:54
114500 -- (-375.997) (-374.379) (-373.131) [-377.315] * (-373.386) (-373.360) (-372.317) [-375.992] -- 0:00:54
115000 -- (-371.405) (-380.555) (-374.431) [-372.214] * [-372.542] (-371.619) (-372.518) (-373.546) -- 0:00:53
Average standard deviation of split frequencies: 0.026512
115500 -- [-373.242] (-378.545) (-371.596) (-373.513) * (-373.053) (-374.663) (-374.155) [-372.385] -- 0:00:53
116000 -- (-371.998) (-379.874) [-371.850] (-372.448) * (-373.626) (-376.223) [-373.268] (-371.688) -- 0:00:53
116500 -- [-377.715] (-373.062) (-371.898) (-373.481) * (-371.923) [-372.625] (-373.391) (-373.098) -- 0:00:53
117000 -- (-381.887) [-373.082] (-376.633) (-374.234) * [-372.321] (-373.772) (-374.267) (-373.863) -- 0:00:52
117500 -- (-373.794) [-372.413] (-374.140) (-371.608) * [-374.373] (-372.869) (-375.028) (-371.418) -- 0:00:52
118000 -- (-373.549) [-371.869] (-372.323) (-372.777) * (-376.897) (-373.314) [-372.551] (-371.940) -- 0:00:52
118500 -- [-372.294] (-373.621) (-374.891) (-376.896) * [-371.738] (-374.948) (-372.563) (-372.189) -- 0:00:52
119000 -- (-372.468) (-373.709) [-373.515] (-375.219) * (-372.468) (-375.672) (-372.785) [-373.999] -- 0:00:51
119500 -- (-375.494) (-373.626) (-374.246) [-375.512] * [-374.726] (-373.437) (-372.891) (-373.510) -- 0:00:51
120000 -- (-372.632) (-373.330) (-374.618) [-373.464] * (-372.976) [-372.131] (-375.559) (-375.001) -- 0:00:51
Average standard deviation of split frequencies: 0.028323
120500 -- (-374.072) (-372.094) [-377.410] (-372.742) * (-373.922) [-372.303] (-373.508) (-372.736) -- 0:00:51
121000 -- (-374.207) [-371.689] (-373.531) (-374.207) * (-374.269) (-374.162) (-372.904) [-373.410] -- 0:00:50
121500 -- (-372.553) (-374.638) [-374.079] (-373.981) * (-373.526) [-372.449] (-374.252) (-379.772) -- 0:00:50
122000 -- (-374.004) (-373.084) (-376.304) [-371.713] * (-371.759) [-371.985] (-373.501) (-374.587) -- 0:00:50
122500 -- (-372.431) (-372.314) (-371.531) [-376.178] * (-378.972) (-372.157) (-372.923) [-374.781] -- 0:00:50
123000 -- (-375.024) [-371.947] (-373.800) (-373.484) * [-372.295] (-372.384) (-373.299) (-372.248) -- 0:00:49
123500 -- (-372.435) (-372.068) [-374.534] (-372.986) * [-378.058] (-371.839) (-373.717) (-377.526) -- 0:00:49
124000 -- (-371.941) (-372.594) (-373.379) [-372.240] * (-373.497) (-374.064) [-373.452] (-373.297) -- 0:00:49
124500 -- (-377.031) (-371.776) (-376.614) [-371.956] * (-376.149) [-374.058] (-377.044) (-372.806) -- 0:00:49
125000 -- (-372.977) [-371.914] (-373.452) (-373.842) * (-374.355) (-372.557) [-373.925] (-374.406) -- 0:00:49
Average standard deviation of split frequencies: 0.024764
125500 -- [-373.674] (-371.698) (-376.296) (-376.068) * [-374.917] (-376.297) (-373.475) (-374.983) -- 0:00:48
126000 -- (-375.622) (-374.205) (-374.916) [-374.425] * (-375.440) (-371.894) (-373.602) [-373.377] -- 0:00:48
126500 -- (-374.243) (-372.898) (-374.342) [-373.674] * [-373.685] (-379.391) (-372.938) (-373.187) -- 0:00:48
127000 -- (-372.073) (-373.627) (-378.329) [-377.191] * (-373.216) [-372.496] (-372.643) (-371.463) -- 0:00:48
127500 -- (-377.952) (-372.874) [-376.764] (-373.529) * [-371.745] (-372.646) (-372.190) (-372.970) -- 0:00:47
128000 -- (-377.365) (-372.499) (-376.939) [-374.696] * (-372.269) (-375.252) (-373.703) [-373.691] -- 0:00:54
128500 -- (-374.983) (-374.463) (-371.748) [-374.229] * (-372.481) [-373.110] (-373.928) (-372.630) -- 0:00:54
129000 -- [-373.598] (-374.328) (-373.500) (-372.067) * (-372.659) (-373.892) (-374.849) [-374.217] -- 0:00:54
129500 -- [-376.963] (-374.112) (-372.893) (-372.863) * (-371.500) (-374.621) (-374.614) [-373.724] -- 0:00:53
130000 -- [-372.968] (-374.560) (-372.485) (-373.569) * (-376.696) [-376.896] (-374.296) (-373.429) -- 0:00:53
Average standard deviation of split frequencies: 0.023020
130500 -- (-372.823) (-375.173) (-373.380) [-372.286] * (-376.950) [-379.392] (-373.667) (-374.063) -- 0:00:53
131000 -- (-372.612) (-373.394) [-374.838] (-372.303) * (-374.448) (-373.083) (-377.499) [-372.184] -- 0:00:53
131500 -- [-374.095] (-374.860) (-373.522) (-371.458) * (-371.749) (-372.353) (-376.041) [-373.636] -- 0:00:52
132000 -- (-376.131) [-373.438] (-371.902) (-373.607) * (-371.489) (-371.662) (-375.691) [-373.669] -- 0:00:52
132500 -- (-374.661) (-373.527) [-377.924] (-375.367) * [-375.133] (-373.112) (-375.165) (-372.803) -- 0:00:52
133000 -- (-374.985) (-372.574) [-374.993] (-373.679) * (-372.452) (-373.303) (-376.385) [-373.985] -- 0:00:52
133500 -- (-375.603) [-376.692] (-372.369) (-371.371) * (-373.141) (-372.195) (-372.688) [-374.781] -- 0:00:51
134000 -- (-376.536) (-371.790) [-376.219] (-374.388) * (-373.338) (-377.360) (-373.820) [-373.499] -- 0:00:51
134500 -- (-373.726) [-372.654] (-374.365) (-371.741) * [-371.579] (-374.788) (-373.260) (-375.096) -- 0:00:51
135000 -- (-375.391) (-373.836) (-376.670) [-372.283] * (-374.475) [-375.318] (-372.618) (-374.182) -- 0:00:51
Average standard deviation of split frequencies: 0.023273
135500 -- (-373.912) (-371.935) (-373.391) [-371.841] * [-372.426] (-378.691) (-372.928) (-371.277) -- 0:00:51
136000 -- (-373.402) (-373.872) [-373.160] (-374.410) * (-371.975) (-374.045) [-373.282] (-372.713) -- 0:00:50
136500 -- (-378.497) [-372.713] (-372.496) (-374.739) * (-373.432) [-371.960] (-374.156) (-373.207) -- 0:00:50
137000 -- (-381.010) (-374.301) [-372.101] (-375.775) * (-375.017) [-374.591] (-372.237) (-373.235) -- 0:00:50
137500 -- (-377.136) (-375.403) (-374.882) [-372.220] * [-372.458] (-372.439) (-375.929) (-373.149) -- 0:00:50
138000 -- [-376.542] (-371.937) (-373.943) (-372.141) * [-371.639] (-372.409) (-372.396) (-376.074) -- 0:00:49
138500 -- (-373.965) (-376.019) (-373.142) [-373.588] * (-372.554) [-374.520] (-376.042) (-373.170) -- 0:00:49
139000 -- (-375.840) (-373.458) (-373.738) [-373.155] * [-375.417] (-375.958) (-375.487) (-372.651) -- 0:00:49
139500 -- [-371.725] (-372.099) (-374.247) (-373.501) * (-371.544) (-372.540) [-375.394] (-373.378) -- 0:00:49
140000 -- (-373.280) (-373.771) (-373.287) [-373.001] * [-374.136] (-374.644) (-379.083) (-374.832) -- 0:00:49
Average standard deviation of split frequencies: 0.022956
140500 -- (-375.584) (-374.824) (-371.297) [-374.651] * (-378.553) [-374.236] (-375.079) (-373.277) -- 0:00:48
141000 -- (-373.280) (-372.167) (-372.200) [-374.907] * (-374.624) [-372.975] (-375.169) (-375.369) -- 0:00:48
141500 -- (-374.606) [-371.601] (-371.805) (-373.083) * (-371.388) (-374.306) [-372.945] (-375.031) -- 0:00:48
142000 -- (-380.717) (-375.315) [-373.331] (-372.946) * [-373.636] (-373.983) (-374.342) (-373.375) -- 0:00:48
142500 -- (-377.710) (-373.398) [-375.844] (-373.210) * [-374.906] (-373.464) (-373.378) (-376.317) -- 0:00:48
143000 -- (-374.374) [-373.241] (-374.808) (-373.557) * [-372.310] (-376.780) (-377.039) (-375.364) -- 0:00:47
143500 -- (-376.213) [-376.140] (-377.600) (-372.591) * (-375.461) (-374.866) [-373.174] (-374.517) -- 0:00:47
144000 -- [-373.218] (-377.580) (-375.859) (-372.436) * (-376.116) [-375.185] (-374.627) (-372.530) -- 0:00:47
144500 -- [-375.223] (-373.026) (-371.902) (-377.147) * [-372.578] (-373.014) (-375.397) (-372.633) -- 0:00:47
145000 -- (-371.765) [-374.115] (-372.083) (-372.465) * (-373.319) [-372.604] (-374.832) (-373.671) -- 0:00:53
Average standard deviation of split frequencies: 0.024539
145500 -- [-373.312] (-374.480) (-372.659) (-372.495) * (-376.472) [-377.241] (-373.050) (-374.105) -- 0:00:52
146000 -- (-376.546) (-371.492) (-373.356) [-373.235] * (-376.283) (-373.271) [-371.534] (-373.428) -- 0:00:52
146500 -- (-374.307) (-373.728) [-371.915] (-374.812) * (-372.319) [-372.636] (-374.943) (-372.980) -- 0:00:52
147000 -- [-374.453] (-373.850) (-373.816) (-372.492) * [-374.175] (-374.044) (-373.682) (-372.318) -- 0:00:52
147500 -- [-373.209] (-376.070) (-373.060) (-371.784) * [-373.713] (-373.690) (-373.577) (-378.085) -- 0:00:52
148000 -- (-373.351) [-373.864] (-372.423) (-373.966) * (-373.445) [-371.954] (-375.098) (-372.460) -- 0:00:51
148500 -- (-372.681) [-372.903] (-372.756) (-375.921) * (-373.527) [-371.919] (-373.614) (-377.073) -- 0:00:51
149000 -- (-372.477) (-371.920) [-373.841] (-374.098) * (-373.522) (-373.923) [-373.975] (-374.429) -- 0:00:51
149500 -- [-372.434] (-372.663) (-375.092) (-373.802) * (-374.537) [-371.899] (-375.475) (-375.881) -- 0:00:51
150000 -- (-373.953) (-373.795) [-374.978] (-375.147) * [-371.885] (-374.568) (-377.514) (-372.868) -- 0:00:51
Average standard deviation of split frequencies: 0.023054
150500 -- [-372.135] (-372.313) (-375.521) (-371.958) * (-374.128) (-373.685) [-374.961] (-373.027) -- 0:00:50
151000 -- (-372.020) (-374.846) (-373.096) [-373.480] * (-373.474) [-373.136] (-372.288) (-374.663) -- 0:00:50
151500 -- (-372.294) (-372.601) (-372.855) [-374.093] * [-372.879] (-371.610) (-373.830) (-373.216) -- 0:00:50
152000 -- [-372.613] (-371.706) (-376.586) (-374.086) * (-374.417) (-371.953) [-377.213] (-377.318) -- 0:00:50
152500 -- [-372.643] (-376.356) (-373.336) (-373.945) * (-373.406) (-371.552) [-372.881] (-377.165) -- 0:00:50
153000 -- (-373.827) (-376.281) [-374.566] (-372.211) * (-374.124) [-376.261] (-375.164) (-372.552) -- 0:00:49
153500 -- [-372.378] (-371.538) (-374.373) (-372.830) * [-371.872] (-376.269) (-374.267) (-380.881) -- 0:00:49
154000 -- (-371.975) (-372.207) (-376.632) [-372.675] * (-373.330) (-374.071) [-372.564] (-373.246) -- 0:00:49
154500 -- [-373.441] (-372.922) (-372.153) (-371.944) * (-372.071) (-375.893) (-373.768) [-372.545] -- 0:00:49
155000 -- (-372.818) (-372.092) (-372.498) [-372.740] * [-376.444] (-378.224) (-371.768) (-371.662) -- 0:00:49
Average standard deviation of split frequencies: 0.022930
155500 -- [-372.888] (-378.657) (-372.263) (-375.513) * [-371.513] (-373.417) (-372.612) (-373.286) -- 0:00:48
156000 -- [-372.013] (-375.400) (-373.690) (-371.470) * [-372.167] (-374.073) (-373.761) (-375.084) -- 0:00:48
156500 -- [-382.481] (-373.428) (-372.245) (-374.709) * (-372.374) (-373.962) [-372.132] (-381.307) -- 0:00:48
157000 -- (-375.126) (-373.663) (-379.363) [-371.944] * (-374.248) [-376.241] (-375.888) (-375.011) -- 0:00:48
157500 -- (-376.222) (-372.640) (-373.773) [-373.496] * (-372.810) [-372.798] (-371.734) (-373.895) -- 0:00:48
158000 -- (-374.346) (-372.371) [-372.736] (-372.351) * (-373.025) (-373.935) (-373.903) [-374.478] -- 0:00:47
158500 -- (-374.987) (-371.615) [-373.139] (-376.088) * [-372.894] (-373.496) (-374.173) (-380.587) -- 0:00:47
159000 -- (-372.462) [-376.801] (-373.356) (-371.579) * (-373.865) (-376.135) [-373.681] (-378.462) -- 0:00:47
159500 -- [-372.398] (-373.554) (-375.590) (-374.119) * (-374.238) (-372.141) [-375.459] (-372.383) -- 0:00:47
160000 -- (-373.868) (-374.929) [-373.087] (-375.612) * (-372.216) (-372.491) (-372.300) [-371.599] -- 0:00:47
Average standard deviation of split frequencies: 0.022855
160500 -- (-373.455) [-372.288] (-372.720) (-372.555) * (-371.895) (-372.805) (-371.527) [-372.640] -- 0:00:47
161000 -- (-374.237) (-377.400) (-374.334) [-375.999] * (-372.016) (-373.426) (-372.860) [-374.727] -- 0:00:46
161500 -- [-372.093] (-376.803) (-374.256) (-371.559) * (-371.711) (-372.978) (-374.824) [-373.479] -- 0:00:46
162000 -- (-372.483) (-377.064) (-379.804) [-372.610] * [-373.337] (-371.562) (-373.454) (-374.504) -- 0:00:51
162500 -- (-371.797) (-376.160) (-374.554) [-373.366] * (-371.995) [-374.010] (-372.464) (-376.951) -- 0:00:51
163000 -- [-373.129] (-380.850) (-378.118) (-377.580) * (-372.894) (-373.823) (-373.598) [-375.305] -- 0:00:51
163500 -- (-372.497) (-372.053) (-373.342) [-375.474] * (-373.423) (-375.232) [-375.503] (-373.788) -- 0:00:51
164000 -- (-373.341) [-374.959] (-374.656) (-372.796) * [-374.652] (-373.942) (-375.956) (-371.462) -- 0:00:50
164500 -- (-372.847) (-373.636) (-375.392) [-374.182] * (-372.741) [-373.568] (-371.432) (-372.736) -- 0:00:50
165000 -- (-371.579) (-376.625) (-376.423) [-373.249] * (-372.377) (-375.064) (-371.932) [-372.493] -- 0:00:50
Average standard deviation of split frequencies: 0.024362
165500 -- (-376.280) [-373.216] (-375.077) (-373.126) * (-372.884) (-372.223) [-374.108] (-372.625) -- 0:00:50
166000 -- (-374.112) [-374.043] (-373.658) (-373.560) * (-372.739) (-373.278) [-372.904] (-373.512) -- 0:00:50
166500 -- (-373.903) [-371.526] (-375.471) (-374.359) * (-372.943) (-373.085) [-372.238] (-373.164) -- 0:00:50
167000 -- [-378.698] (-373.037) (-372.507) (-373.702) * (-373.468) (-376.119) (-375.175) [-371.733] -- 0:00:49
167500 -- (-374.848) [-372.604] (-374.594) (-372.581) * (-372.258) (-379.769) [-373.977] (-374.568) -- 0:00:49
168000 -- (-373.697) [-373.441] (-378.070) (-374.894) * (-373.137) [-373.210] (-371.372) (-375.947) -- 0:00:49
168500 -- (-373.666) (-372.460) [-374.889] (-376.412) * (-372.497) [-374.479] (-372.805) (-375.791) -- 0:00:49
169000 -- (-372.492) (-372.373) (-372.101) [-376.490] * [-372.866] (-375.161) (-372.080) (-377.957) -- 0:00:49
169500 -- (-373.202) [-373.108] (-371.601) (-377.618) * (-372.453) (-375.005) [-375.309] (-373.364) -- 0:00:48
170000 -- (-373.459) (-372.228) [-371.372] (-376.125) * (-375.194) (-371.769) (-372.747) [-372.117] -- 0:00:48
Average standard deviation of split frequencies: 0.021952
170500 -- [-375.364] (-372.913) (-372.830) (-374.700) * (-376.648) [-371.736] (-377.339) (-374.544) -- 0:00:48
171000 -- (-372.829) [-374.519] (-372.246) (-373.758) * [-374.572] (-376.520) (-372.217) (-374.317) -- 0:00:48
171500 -- [-372.336] (-373.317) (-374.473) (-372.746) * (-375.570) (-374.378) [-373.650] (-372.129) -- 0:00:48
172000 -- (-372.710) (-372.572) [-372.296] (-373.072) * (-375.599) (-372.830) [-373.272] (-373.434) -- 0:00:48
172500 -- (-380.448) [-373.679] (-373.218) (-372.395) * (-377.421) (-372.227) (-372.349) [-372.760] -- 0:00:47
173000 -- (-375.280) (-372.271) (-372.108) [-372.745] * (-374.741) (-372.863) [-373.236] (-373.373) -- 0:00:47
173500 -- [-375.238] (-374.057) (-374.874) (-371.742) * (-378.923) (-380.287) [-373.477] (-373.864) -- 0:00:47
174000 -- (-373.284) [-373.276] (-373.425) (-373.181) * (-374.809) (-382.968) (-374.732) [-373.509] -- 0:00:47
174500 -- (-373.111) [-375.327] (-372.291) (-372.025) * [-373.757] (-374.267) (-376.440) (-374.785) -- 0:00:47
175000 -- [-371.965] (-372.265) (-374.143) (-372.954) * [-374.365] (-371.421) (-372.284) (-373.948) -- 0:00:47
Average standard deviation of split frequencies: 0.023683
175500 -- (-372.371) [-374.089] (-373.660) (-372.734) * (-375.268) (-373.822) [-373.122] (-373.430) -- 0:00:46
176000 -- (-371.991) [-376.310] (-371.922) (-373.204) * (-375.156) (-373.868) (-375.203) [-372.097] -- 0:00:46
176500 -- (-371.974) (-375.175) [-372.847] (-373.271) * (-375.895) (-372.487) (-376.538) [-373.032] -- 0:00:46
177000 -- [-373.831] (-375.695) (-372.252) (-374.448) * (-381.867) [-373.371] (-378.638) (-374.518) -- 0:00:46
177500 -- (-371.993) (-375.307) [-375.407] (-375.719) * (-374.663) (-373.295) [-372.541] (-376.127) -- 0:00:46
178000 -- (-373.144) [-371.515] (-373.951) (-377.748) * (-373.807) (-374.730) (-374.328) [-374.795] -- 0:00:46
178500 -- (-371.323) (-371.853) [-376.104] (-372.020) * (-373.776) [-372.403] (-373.677) (-372.383) -- 0:00:46
179000 -- (-371.550) (-376.389) (-376.718) [-378.298] * (-377.479) [-372.657] (-376.279) (-373.071) -- 0:00:50
179500 -- (-371.809) (-372.536) (-375.461) [-374.771] * [-374.591] (-378.349) (-372.159) (-373.978) -- 0:00:50
180000 -- (-378.758) (-373.323) [-374.978] (-375.252) * (-375.577) [-375.501] (-373.333) (-372.954) -- 0:00:50
Average standard deviation of split frequencies: 0.024445
180500 -- [-372.851] (-375.840) (-371.688) (-375.085) * [-377.944] (-373.868) (-373.255) (-373.343) -- 0:00:49
181000 -- (-372.170) [-372.829] (-378.298) (-373.593) * (-376.950) [-372.171] (-373.241) (-375.307) -- 0:00:49
181500 -- (-372.361) [-374.391] (-372.247) (-372.378) * [-375.469] (-373.930) (-371.712) (-373.426) -- 0:00:49
182000 -- (-371.867) (-372.875) [-372.161] (-372.403) * [-374.058] (-373.463) (-374.527) (-372.170) -- 0:00:49
182500 -- (-375.095) (-372.658) [-375.881] (-375.563) * (-379.033) (-372.827) [-377.310] (-371.622) -- 0:00:49
183000 -- (-372.265) (-372.313) [-372.947] (-372.426) * (-372.287) (-373.547) [-380.633] (-376.870) -- 0:00:49
183500 -- (-377.249) (-373.450) (-374.756) [-371.816] * (-375.020) [-375.168] (-374.285) (-376.821) -- 0:00:48
184000 -- (-372.650) (-371.633) (-374.780) [-373.768] * (-371.688) [-372.299] (-372.381) (-377.834) -- 0:00:48
184500 -- (-374.484) (-372.911) [-371.597] (-374.162) * (-377.018) [-372.361] (-375.030) (-376.873) -- 0:00:48
185000 -- [-374.026] (-373.140) (-372.747) (-372.115) * (-373.083) (-372.744) [-375.063] (-373.005) -- 0:00:48
Average standard deviation of split frequencies: 0.024411
185500 -- (-372.530) [-372.265] (-372.468) (-374.634) * [-372.879] (-374.794) (-379.350) (-375.311) -- 0:00:48
186000 -- [-376.267] (-371.297) (-374.285) (-372.694) * (-372.895) [-375.664] (-373.903) (-372.523) -- 0:00:48
186500 -- (-375.022) (-378.856) (-371.754) [-374.869] * [-372.539] (-372.233) (-377.094) (-373.851) -- 0:00:47
187000 -- (-372.955) [-373.592] (-372.347) (-372.875) * (-376.428) [-371.526] (-373.220) (-375.762) -- 0:00:47
187500 -- (-373.047) (-373.093) (-373.003) [-373.019] * (-375.442) (-372.865) [-373.037] (-371.764) -- 0:00:47
188000 -- (-372.345) [-372.363] (-373.222) (-373.853) * (-373.475) (-371.891) [-372.126] (-373.577) -- 0:00:47
188500 -- (-374.133) (-372.852) (-375.600) [-373.749] * (-374.283) (-372.950) [-375.345] (-371.943) -- 0:00:47
189000 -- (-372.309) [-375.200] (-372.192) (-372.892) * (-372.098) (-374.131) (-372.895) [-374.649] -- 0:00:47
189500 -- [-372.154] (-373.770) (-375.490) (-372.504) * (-373.672) (-374.091) [-372.369] (-372.945) -- 0:00:47
190000 -- [-373.097] (-374.122) (-375.134) (-373.975) * [-374.318] (-372.240) (-373.578) (-376.340) -- 0:00:46
Average standard deviation of split frequencies: 0.022772
190500 -- [-372.605] (-373.928) (-373.226) (-374.479) * (-373.865) [-374.331] (-377.607) (-374.548) -- 0:00:46
191000 -- (-373.178) (-372.358) (-371.180) [-373.045] * [-373.444] (-372.325) (-375.172) (-373.007) -- 0:00:46
191500 -- (-374.899) (-375.015) (-374.682) [-373.579] * (-380.174) [-373.285] (-374.387) (-373.204) -- 0:00:46
192000 -- (-375.027) [-376.636] (-375.080) (-372.982) * (-388.336) [-372.621] (-372.777) (-378.462) -- 0:00:46
192500 -- (-374.249) (-374.936) (-374.374) [-376.374] * (-373.132) (-373.324) [-374.436] (-373.275) -- 0:00:46
193000 -- (-372.482) (-373.625) (-373.556) [-372.799] * (-372.537) (-373.298) (-373.292) [-374.615] -- 0:00:45
193500 -- (-372.605) [-372.871] (-373.610) (-376.186) * [-371.913] (-372.665) (-372.526) (-374.505) -- 0:00:45
194000 -- (-373.509) [-372.213] (-371.864) (-372.241) * (-375.561) (-373.938) [-371.678] (-376.205) -- 0:00:45
194500 -- (-372.417) [-375.168] (-372.249) (-371.797) * (-372.519) (-372.671) [-372.449] (-376.326) -- 0:00:45
195000 -- (-372.890) (-379.455) [-374.085] (-372.074) * (-373.473) (-374.178) [-371.416] (-371.891) -- 0:00:45
Average standard deviation of split frequencies: 0.023545
195500 -- (-377.172) (-377.363) [-372.019] (-373.604) * (-383.461) (-373.268) (-371.502) [-372.919] -- 0:00:49
196000 -- [-374.750] (-373.455) (-371.703) (-374.591) * (-374.626) (-375.550) [-372.013] (-371.761) -- 0:00:49
196500 -- [-371.768] (-373.698) (-372.123) (-373.563) * [-379.881] (-375.825) (-372.265) (-372.308) -- 0:00:49
197000 -- (-372.966) (-373.973) [-371.952] (-376.101) * (-376.380) [-372.850] (-372.791) (-375.112) -- 0:00:48
197500 -- (-372.102) (-374.305) (-376.567) [-372.543] * (-373.101) [-371.946] (-373.692) (-373.493) -- 0:00:48
198000 -- [-372.607] (-374.179) (-372.122) (-372.128) * (-373.743) [-371.656] (-374.328) (-373.289) -- 0:00:48
198500 -- (-372.260) (-375.224) [-372.903] (-373.223) * [-372.870] (-371.640) (-379.637) (-376.961) -- 0:00:48
199000 -- (-373.229) (-374.852) [-374.858] (-374.985) * (-371.643) [-372.617] (-374.689) (-374.065) -- 0:00:48
199500 -- [-372.099] (-373.943) (-373.439) (-374.565) * [-373.931] (-372.727) (-372.654) (-372.687) -- 0:00:48
200000 -- [-373.399] (-374.390) (-375.314) (-374.421) * [-372.311] (-373.791) (-374.256) (-373.876) -- 0:00:48
Average standard deviation of split frequencies: 0.023492
200500 -- [-373.140] (-373.973) (-374.184) (-372.192) * (-371.463) (-372.365) [-372.816] (-376.276) -- 0:00:47
201000 -- (-371.227) (-373.157) (-374.870) [-371.967] * (-375.321) (-372.792) (-373.047) [-372.968] -- 0:00:47
201500 -- (-372.405) (-374.341) [-372.936] (-374.487) * (-373.622) (-373.548) (-373.446) [-375.335] -- 0:00:47
202000 -- [-372.689] (-378.619) (-375.394) (-372.729) * [-372.679] (-373.199) (-375.821) (-372.181) -- 0:00:47
202500 -- (-375.054) (-371.989) (-375.017) [-375.915] * [-371.966] (-375.748) (-375.041) (-376.582) -- 0:00:47
203000 -- [-373.285] (-372.945) (-373.651) (-376.236) * (-373.694) (-373.424) [-375.099] (-373.851) -- 0:00:47
203500 -- (-374.811) (-374.649) (-375.102) [-373.245] * (-374.563) [-374.314] (-376.322) (-372.771) -- 0:00:46
204000 -- [-373.798] (-375.180) (-374.817) (-374.054) * [-372.167] (-376.517) (-372.767) (-373.663) -- 0:00:46
204500 -- (-372.313) (-377.823) (-374.945) [-374.059] * (-373.699) (-372.022) (-372.929) [-372.619] -- 0:00:46
205000 -- (-375.411) (-372.778) (-374.637) [-374.267] * (-373.099) (-372.777) (-375.557) [-373.681] -- 0:00:46
Average standard deviation of split frequencies: 0.020939
205500 -- (-372.183) [-374.176] (-372.509) (-381.523) * (-376.325) (-373.382) (-372.692) [-373.183] -- 0:00:46
206000 -- [-373.734] (-374.902) (-373.837) (-382.949) * (-373.393) [-374.180] (-374.644) (-374.617) -- 0:00:46
206500 -- [-372.449] (-375.957) (-373.100) (-380.524) * (-372.379) (-376.118) (-375.323) [-375.552] -- 0:00:46
207000 -- (-373.621) [-373.046] (-374.092) (-373.279) * (-373.554) (-376.114) [-374.844] (-374.081) -- 0:00:45
207500 -- (-374.111) [-371.382] (-371.788) (-372.895) * (-373.902) [-374.955] (-373.631) (-371.997) -- 0:00:45
208000 -- (-372.625) (-372.714) [-372.180] (-376.070) * (-372.446) (-375.730) [-371.440] (-378.401) -- 0:00:45
208500 -- [-373.023] (-379.054) (-373.556) (-372.413) * (-374.741) [-375.395] (-372.782) (-373.422) -- 0:00:45
209000 -- [-374.297] (-373.194) (-372.088) (-372.656) * (-371.543) (-376.710) [-372.641] (-372.416) -- 0:00:45
209500 -- [-372.838] (-379.583) (-379.129) (-371.829) * [-371.627] (-375.262) (-375.315) (-373.681) -- 0:00:45
210000 -- (-375.869) (-378.344) (-373.358) [-375.112] * (-374.276) (-377.143) [-371.964] (-374.446) -- 0:00:45
Average standard deviation of split frequencies: 0.019197
210500 -- (-376.105) (-374.038) (-373.466) [-374.286] * [-376.106] (-380.302) (-374.580) (-372.697) -- 0:00:45
211000 -- (-374.479) [-371.992] (-373.131) (-375.571) * (-372.710) [-372.311] (-374.971) (-374.137) -- 0:00:44
211500 -- (-374.748) (-372.180) (-372.254) [-372.053] * (-375.156) (-377.781) [-374.995] (-372.405) -- 0:00:44
212000 -- (-372.036) (-372.644) (-375.333) [-373.349] * (-374.103) [-372.422] (-373.340) (-373.077) -- 0:00:44
212500 -- (-375.491) (-374.287) (-375.290) [-374.618] * [-373.857] (-373.463) (-373.152) (-371.415) -- 0:00:48
213000 -- (-372.500) (-384.438) [-373.066] (-372.116) * (-372.781) (-372.460) (-372.939) [-373.287] -- 0:00:48
213500 -- [-372.401] (-375.820) (-380.078) (-371.772) * (-374.290) (-374.299) [-372.415] (-371.689) -- 0:00:47
214000 -- (-372.733) [-375.441] (-374.574) (-372.993) * (-372.774) (-372.183) (-373.735) [-371.794] -- 0:00:47
214500 -- (-376.679) [-374.735] (-376.234) (-371.851) * (-375.787) (-374.484) [-373.528] (-371.639) -- 0:00:47
215000 -- (-371.789) (-374.050) [-372.189] (-373.869) * [-376.820] (-373.433) (-375.156) (-373.864) -- 0:00:47
Average standard deviation of split frequencies: 0.018793
215500 -- (-376.060) (-373.619) [-372.557] (-374.521) * [-373.204] (-374.556) (-374.639) (-374.637) -- 0:00:47
216000 -- (-373.025) [-371.850] (-374.402) (-374.275) * [-372.015] (-371.613) (-374.563) (-373.872) -- 0:00:47
216500 -- (-371.745) [-372.148] (-372.908) (-373.663) * (-374.640) (-373.746) (-373.702) [-372.121] -- 0:00:47
217000 -- [-372.963] (-372.655) (-377.684) (-372.503) * (-380.251) (-373.206) [-375.184] (-372.660) -- 0:00:46
217500 -- (-375.375) (-373.462) [-374.370] (-374.641) * (-375.001) (-374.300) (-372.113) [-373.937] -- 0:00:46
218000 -- (-377.350) (-375.692) [-375.730] (-375.312) * (-371.760) (-372.753) (-375.242) [-375.422] -- 0:00:46
218500 -- (-374.885) [-372.888] (-377.425) (-376.986) * (-375.827) (-372.792) (-375.138) [-372.376] -- 0:00:46
219000 -- (-374.997) (-373.438) (-372.599) [-375.657] * (-376.507) (-371.510) (-373.195) [-371.348] -- 0:00:46
219500 -- (-375.565) (-374.526) (-373.555) [-374.939] * [-373.527] (-372.442) (-375.222) (-372.884) -- 0:00:46
220000 -- (-374.007) (-372.064) [-373.392] (-373.589) * (-373.988) [-371.531] (-381.342) (-372.974) -- 0:00:46
Average standard deviation of split frequencies: 0.017328
220500 -- (-376.431) (-374.396) (-372.928) [-374.899] * (-372.874) (-374.005) (-380.396) [-373.638] -- 0:00:45
221000 -- (-371.889) (-373.440) [-373.554] (-376.168) * [-373.441] (-373.367) (-374.160) (-372.261) -- 0:00:45
221500 -- (-379.572) [-376.425] (-372.305) (-371.567) * (-373.242) (-374.798) (-373.912) [-373.152] -- 0:00:45
222000 -- (-371.801) [-373.958] (-376.005) (-372.867) * (-373.103) [-373.582] (-373.931) (-372.449) -- 0:00:45
222500 -- (-374.696) (-371.700) [-373.529] (-374.744) * (-375.364) (-372.928) [-374.523] (-373.499) -- 0:00:45
223000 -- [-377.666] (-374.227) (-372.730) (-374.212) * (-374.822) (-372.534) [-373.469] (-372.691) -- 0:00:45
223500 -- [-378.086] (-374.358) (-374.942) (-374.119) * (-372.779) [-372.687] (-373.971) (-376.595) -- 0:00:45
224000 -- (-376.714) (-372.074) (-372.666) [-371.718] * (-375.161) [-373.969] (-372.090) (-378.311) -- 0:00:45
224500 -- (-372.728) [-373.189] (-371.765) (-373.949) * [-375.947] (-373.786) (-373.262) (-373.856) -- 0:00:44
225000 -- (-372.809) (-372.395) (-375.522) [-373.683] * (-376.176) [-383.544] (-376.046) (-371.742) -- 0:00:44
Average standard deviation of split frequencies: 0.017016
225500 -- (-371.515) [-372.989] (-374.639) (-375.397) * (-373.624) [-376.495] (-375.101) (-373.417) -- 0:00:44
226000 -- (-378.302) [-375.332] (-373.885) (-373.746) * (-373.422) (-373.069) [-372.168] (-372.444) -- 0:00:44
226500 -- (-372.930) (-373.043) (-377.684) [-373.302] * [-372.935] (-374.483) (-373.367) (-373.278) -- 0:00:44
227000 -- [-372.532] (-372.836) (-373.433) (-371.833) * (-372.745) (-374.710) [-371.417] (-374.759) -- 0:00:44
227500 -- (-372.304) [-371.921] (-374.556) (-372.100) * [-373.523] (-372.593) (-371.632) (-372.139) -- 0:00:44
228000 -- (-374.819) (-375.523) (-372.805) [-374.167] * [-375.327] (-373.423) (-372.861) (-374.026) -- 0:00:44
228500 -- [-376.173] (-373.557) (-372.639) (-371.864) * (-375.265) (-373.756) (-372.167) [-376.058] -- 0:00:43
229000 -- (-375.903) (-374.384) (-373.213) [-374.201] * [-374.760] (-373.224) (-373.383) (-373.078) -- 0:00:43
229500 -- (-371.723) (-373.027) (-373.781) [-373.888] * [-372.872] (-372.197) (-372.960) (-376.369) -- 0:00:47
230000 -- (-374.689) (-376.404) [-376.402] (-373.000) * (-372.818) (-371.661) (-375.900) [-373.508] -- 0:00:46
Average standard deviation of split frequencies: 0.017371
230500 -- (-374.790) (-373.110) (-374.302) [-372.432] * (-373.185) [-373.434] (-374.263) (-373.858) -- 0:00:46
231000 -- (-374.538) (-374.870) (-373.655) [-373.136] * (-373.403) (-374.487) (-371.691) [-372.615] -- 0:00:46
231500 -- (-372.703) [-371.895] (-371.879) (-373.735) * (-374.272) [-376.883] (-373.134) (-373.499) -- 0:00:46
232000 -- [-371.808] (-374.265) (-376.334) (-374.050) * (-372.597) (-373.235) (-372.230) [-372.445] -- 0:00:46
232500 -- (-372.010) [-371.875] (-375.649) (-378.041) * (-372.294) (-373.238) (-374.072) [-372.318] -- 0:00:46
233000 -- (-372.312) [-373.141] (-372.855) (-373.995) * (-374.366) (-371.878) (-373.663) [-372.471] -- 0:00:46
233500 -- (-372.456) (-372.602) [-374.190] (-371.748) * (-374.622) [-372.387] (-374.272) (-371.775) -- 0:00:45
234000 -- [-372.240] (-373.486) (-376.535) (-372.938) * (-373.499) [-374.119] (-373.150) (-371.175) -- 0:00:45
234500 -- (-376.002) [-373.627] (-375.621) (-376.413) * (-372.221) (-377.209) [-375.485] (-371.770) -- 0:00:45
235000 -- (-374.783) [-372.508] (-373.859) (-374.094) * (-374.886) (-375.086) (-372.832) [-371.610] -- 0:00:45
Average standard deviation of split frequencies: 0.016757
235500 -- (-374.949) [-372.509] (-373.907) (-377.457) * (-379.327) (-375.863) [-373.504] (-371.525) -- 0:00:45
236000 -- (-373.567) (-373.066) [-372.881] (-375.413) * (-377.841) (-375.140) [-374.362] (-372.833) -- 0:00:45
236500 -- (-375.646) (-375.527) (-371.502) [-373.554] * [-374.463] (-372.543) (-372.612) (-372.612) -- 0:00:45
237000 -- (-373.833) [-371.638] (-372.842) (-374.093) * [-371.264] (-374.864) (-372.624) (-371.964) -- 0:00:45
237500 -- (-374.289) (-373.157) (-373.775) [-373.494] * (-372.574) [-372.631] (-374.807) (-376.075) -- 0:00:44
238000 -- [-372.877] (-373.792) (-371.420) (-372.518) * [-375.702] (-375.736) (-374.219) (-372.440) -- 0:00:44
238500 -- (-372.906) (-373.524) [-373.561] (-376.926) * (-372.090) [-374.476] (-372.822) (-372.480) -- 0:00:44
239000 -- [-373.638] (-372.683) (-372.004) (-373.516) * (-374.505) [-374.833] (-373.185) (-372.551) -- 0:00:44
239500 -- (-373.373) [-372.441] (-374.573) (-371.916) * (-374.808) (-371.565) [-374.387] (-371.685) -- 0:00:44
240000 -- (-376.552) (-375.253) (-376.170) [-374.053] * (-372.189) [-373.530] (-375.196) (-372.309) -- 0:00:44
Average standard deviation of split frequencies: 0.015996
240500 -- [-373.695] (-373.219) (-374.226) (-372.678) * (-372.229) [-372.180] (-375.495) (-372.221) -- 0:00:44
241000 -- [-374.660] (-373.312) (-374.702) (-373.239) * (-372.221) (-373.834) (-372.705) [-372.533] -- 0:00:44
241500 -- (-374.353) (-372.928) [-374.670] (-372.438) * [-371.884] (-372.504) (-372.352) (-377.234) -- 0:00:43
242000 -- (-372.943) (-377.699) [-374.903] (-374.156) * [-372.500] (-373.436) (-371.938) (-374.776) -- 0:00:43
242500 -- (-371.512) (-374.670) [-372.968] (-372.171) * (-381.106) (-375.570) (-371.370) [-371.761] -- 0:00:43
243000 -- (-373.588) (-374.908) [-372.256] (-374.883) * [-372.423] (-372.019) (-371.892) (-373.313) -- 0:00:43
243500 -- (-374.906) [-371.755] (-374.306) (-375.433) * (-372.928) (-373.646) [-373.476] (-375.518) -- 0:00:43
244000 -- (-373.610) (-373.102) [-372.112] (-374.881) * [-371.951] (-374.647) (-375.841) (-374.659) -- 0:00:43
244500 -- (-372.516) [-373.177] (-371.992) (-372.468) * (-375.431) [-372.712] (-371.495) (-373.185) -- 0:00:43
245000 -- [-372.930] (-372.779) (-372.954) (-374.996) * (-373.885) [-374.258] (-373.310) (-374.665) -- 0:00:43
Average standard deviation of split frequencies: 0.015756
245500 -- (-372.665) (-372.301) [-372.041] (-375.694) * (-371.460) [-371.989] (-372.171) (-376.333) -- 0:00:46
246000 -- (-374.294) (-373.005) [-373.041] (-372.647) * [-371.666] (-376.547) (-376.592) (-374.465) -- 0:00:45
246500 -- (-374.783) [-371.682] (-373.021) (-378.492) * (-372.804) [-380.153] (-380.079) (-376.018) -- 0:00:45
247000 -- (-373.739) [-372.314] (-377.182) (-377.200) * [-374.268] (-378.871) (-376.474) (-374.672) -- 0:00:45
247500 -- (-372.644) (-373.234) [-374.725] (-374.426) * (-373.547) [-374.525] (-372.805) (-372.265) -- 0:00:45
248000 -- (-373.811) [-372.591] (-373.553) (-374.339) * (-374.033) (-374.491) (-374.119) [-372.776] -- 0:00:45
248500 -- [-373.711] (-378.077) (-376.139) (-373.818) * [-377.265] (-375.076) (-376.105) (-373.040) -- 0:00:45
249000 -- (-372.040) (-373.899) [-373.442] (-374.007) * [-373.684] (-375.518) (-373.443) (-374.198) -- 0:00:45
249500 -- [-371.597] (-378.532) (-372.895) (-373.711) * (-374.431) (-376.596) (-374.029) [-371.954] -- 0:00:45
250000 -- (-371.869) [-373.235] (-373.418) (-374.358) * (-376.341) (-374.465) (-371.851) [-375.424] -- 0:00:45
Average standard deviation of split frequencies: 0.016299
250500 -- (-373.793) (-374.844) [-373.655] (-374.295) * (-373.362) (-373.161) (-373.154) [-376.336] -- 0:00:44
251000 -- (-375.875) (-372.772) (-372.432) [-376.457] * (-375.526) (-371.749) (-373.319) [-374.396] -- 0:00:44
251500 -- [-374.540] (-372.113) (-372.601) (-374.123) * [-375.064] (-373.311) (-372.682) (-374.865) -- 0:00:44
252000 -- (-373.581) (-374.529) [-374.977] (-371.640) * (-372.474) (-380.050) (-372.383) [-372.097] -- 0:00:44
252500 -- (-375.819) [-374.241] (-377.308) (-372.049) * [-373.552] (-379.301) (-372.411) (-372.075) -- 0:00:44
253000 -- (-379.098) [-371.879] (-374.460) (-372.313) * [-374.699] (-372.790) (-373.666) (-376.082) -- 0:00:44
253500 -- [-372.843] (-372.125) (-375.113) (-372.314) * (-374.359) [-373.011] (-375.235) (-372.763) -- 0:00:44
254000 -- (-372.659) [-371.631] (-374.006) (-372.337) * (-372.947) [-372.738] (-376.823) (-372.800) -- 0:00:44
254500 -- [-372.266] (-371.337) (-373.358) (-371.807) * (-371.955) (-372.107) (-375.528) [-371.968] -- 0:00:43
255000 -- (-375.900) [-371.504] (-373.450) (-373.123) * (-374.012) (-372.432) [-372.701] (-373.669) -- 0:00:43
Average standard deviation of split frequencies: 0.016185
255500 -- (-372.400) [-374.458] (-372.830) (-375.424) * (-376.516) (-373.729) [-373.254] (-374.921) -- 0:00:43
256000 -- (-372.912) [-373.463] (-372.335) (-376.871) * (-372.871) (-373.260) [-372.256] (-379.444) -- 0:00:43
256500 -- (-377.710) (-372.802) [-371.277] (-373.113) * (-373.750) (-376.972) [-374.783] (-376.867) -- 0:00:43
257000 -- [-374.984] (-372.507) (-375.858) (-375.078) * (-371.871) (-373.309) (-376.716) [-373.071] -- 0:00:43
257500 -- (-373.765) [-374.080] (-380.657) (-373.492) * (-374.078) (-373.670) (-372.432) [-372.736] -- 0:00:43
258000 -- (-372.775) [-372.541] (-378.035) (-372.679) * (-374.109) [-375.615] (-373.473) (-373.656) -- 0:00:43
258500 -- (-372.007) [-374.080] (-378.427) (-372.921) * [-373.323] (-374.395) (-371.658) (-378.708) -- 0:00:43
259000 -- [-377.520] (-374.783) (-381.349) (-376.028) * (-374.858) [-374.330] (-375.904) (-379.959) -- 0:00:42
259500 -- (-374.395) (-377.971) [-373.756] (-374.098) * [-374.632] (-380.743) (-373.644) (-372.715) -- 0:00:42
260000 -- (-377.020) (-374.929) [-372.225] (-374.071) * [-373.913] (-374.003) (-374.863) (-374.715) -- 0:00:42
Average standard deviation of split frequencies: 0.015673
260500 -- [-371.768] (-375.852) (-374.577) (-372.627) * (-375.626) [-381.161] (-376.364) (-376.245) -- 0:00:42
261000 -- (-372.676) (-375.552) (-373.189) [-372.498] * (-373.699) (-375.040) (-373.838) [-373.723] -- 0:00:42
261500 -- (-375.666) (-374.356) [-376.257] (-373.297) * (-373.135) (-374.483) (-373.608) [-371.924] -- 0:00:42
262000 -- [-373.781] (-373.659) (-372.662) (-372.280) * (-371.826) (-374.303) [-373.318] (-375.701) -- 0:00:45
262500 -- (-378.672) [-374.645] (-371.616) (-373.312) * (-372.936) (-373.164) [-375.896] (-375.076) -- 0:00:44
263000 -- (-372.636) (-373.111) (-372.465) [-371.905] * (-373.914) [-373.063] (-372.111) (-380.326) -- 0:00:44
263500 -- (-372.179) (-372.957) (-373.608) [-376.280] * (-372.948) (-373.666) [-372.612] (-371.746) -- 0:00:44
264000 -- (-375.539) (-377.625) [-374.828] (-373.788) * [-372.018] (-376.272) (-372.626) (-373.321) -- 0:00:44
264500 -- (-376.663) (-380.391) (-374.334) [-374.518] * [-372.341] (-374.744) (-373.423) (-373.751) -- 0:00:44
265000 -- (-371.505) (-373.374) [-374.732] (-374.839) * (-372.261) (-377.295) (-372.612) [-376.407] -- 0:00:44
Average standard deviation of split frequencies: 0.015017
265500 -- (-372.081) (-376.356) (-374.838) [-374.241] * (-374.079) (-376.384) (-376.795) [-373.244] -- 0:00:44
266000 -- (-374.997) (-373.822) (-371.479) [-373.038] * (-373.028) (-375.139) (-372.886) [-373.090] -- 0:00:44
266500 -- [-371.690] (-375.437) (-374.503) (-373.129) * (-374.234) (-377.167) [-374.656] (-375.985) -- 0:00:44
267000 -- (-373.020) (-376.493) (-376.371) [-374.056] * (-372.413) [-373.231] (-373.375) (-375.547) -- 0:00:43
267500 -- [-372.584] (-376.672) (-374.292) (-372.987) * (-373.496) (-380.194) [-373.895] (-373.171) -- 0:00:43
268000 -- (-374.471) (-380.076) [-372.073] (-373.730) * (-374.809) (-375.630) (-373.942) [-371.901] -- 0:00:43
268500 -- (-377.716) (-375.111) (-377.893) [-374.952] * [-374.221] (-375.748) (-372.708) (-372.370) -- 0:00:43
269000 -- (-372.164) (-372.524) (-374.681) [-372.635] * (-374.173) (-375.611) (-373.660) [-371.997] -- 0:00:43
269500 -- (-372.689) (-372.641) [-373.065] (-374.860) * (-374.307) (-376.294) [-372.575] (-375.443) -- 0:00:43
270000 -- (-373.933) [-380.768] (-379.971) (-375.450) * (-372.334) (-379.182) [-374.365] (-372.069) -- 0:00:43
Average standard deviation of split frequencies: 0.013353
270500 -- (-373.521) (-372.532) [-373.666] (-374.780) * [-371.318] (-378.324) (-373.417) (-372.248) -- 0:00:43
271000 -- (-373.708) (-371.905) (-371.443) [-372.813] * (-373.838) (-376.194) [-372.492] (-374.071) -- 0:00:43
271500 -- (-373.762) (-371.504) (-371.741) [-372.615] * (-374.758) [-374.380] (-373.705) (-372.401) -- 0:00:42
272000 -- (-373.029) (-372.652) [-377.139] (-376.223) * (-373.818) (-376.423) [-373.315] (-375.938) -- 0:00:42
272500 -- (-378.661) (-373.461) [-374.940] (-372.619) * (-373.322) [-374.623] (-372.911) (-372.869) -- 0:00:42
273000 -- [-374.082] (-372.730) (-373.261) (-375.383) * (-372.366) (-377.839) [-372.437] (-376.589) -- 0:00:42
273500 -- (-379.931) (-372.375) (-378.206) [-371.743] * (-372.239) (-375.815) [-373.754] (-373.030) -- 0:00:42
274000 -- (-377.947) [-371.465] (-374.255) (-373.502) * (-376.680) (-373.629) [-376.565] (-372.527) -- 0:00:42
274500 -- [-374.554] (-377.354) (-380.073) (-376.594) * (-374.007) [-374.665] (-377.166) (-375.636) -- 0:00:42
275000 -- (-372.694) (-376.072) (-376.391) [-373.625] * [-374.829] (-376.125) (-373.918) (-380.553) -- 0:00:42
Average standard deviation of split frequencies: 0.013764
275500 -- (-375.279) (-375.583) [-374.330] (-374.194) * [-372.132] (-374.027) (-375.728) (-373.183) -- 0:00:42
276000 -- (-372.998) [-372.614] (-371.563) (-373.910) * [-374.366] (-374.036) (-377.699) (-372.748) -- 0:00:41
276500 -- (-373.163) [-372.204] (-376.544) (-372.176) * (-376.644) (-371.978) (-373.611) [-372.412] -- 0:00:41
277000 -- (-375.172) (-372.820) (-374.409) [-375.544] * (-377.006) (-375.052) (-373.852) [-371.281] -- 0:00:41
277500 -- (-374.956) (-373.106) (-373.154) [-374.817] * (-375.500) [-373.555] (-376.001) (-371.755) -- 0:00:41
278000 -- (-376.499) (-372.133) (-373.234) [-375.011] * (-373.850) (-374.034) (-382.345) [-373.929] -- 0:00:41
278500 -- (-377.432) (-376.269) (-372.866) [-373.352] * (-373.775) (-371.816) [-372.578] (-378.170) -- 0:00:41
279000 -- (-373.623) (-373.393) (-372.678) [-374.447] * [-375.920] (-372.736) (-371.899) (-372.645) -- 0:00:43
279500 -- [-372.105] (-380.789) (-371.374) (-373.766) * [-373.440] (-374.080) (-375.229) (-373.470) -- 0:00:43
280000 -- (-373.190) (-372.556) [-374.177] (-372.695) * (-373.251) (-372.798) (-373.195) [-372.269] -- 0:00:43
Average standard deviation of split frequencies: 0.012943
280500 -- [-371.683] (-372.557) (-371.700) (-372.849) * [-372.131] (-371.747) (-378.054) (-372.877) -- 0:00:43
281000 -- (-372.642) (-374.016) [-374.963] (-372.443) * (-374.823) [-375.656] (-373.740) (-373.347) -- 0:00:43
281500 -- (-375.549) [-372.269] (-371.542) (-372.984) * (-375.265) [-375.885] (-373.727) (-372.384) -- 0:00:43
282000 -- [-374.275] (-372.404) (-371.871) (-374.447) * (-373.743) (-371.764) (-372.422) [-372.475] -- 0:00:43
282500 -- (-375.624) (-374.923) (-373.849) [-372.673] * (-376.895) [-376.780] (-374.126) (-375.728) -- 0:00:43
283000 -- (-376.255) (-374.280) [-373.307] (-374.972) * (-372.780) (-372.989) [-374.905] (-375.712) -- 0:00:43
283500 -- [-373.928] (-375.159) (-378.440) (-373.175) * [-374.180] (-376.362) (-374.231) (-373.832) -- 0:00:42
284000 -- (-371.606) (-375.764) [-373.839] (-373.844) * (-372.383) (-374.126) [-378.018] (-372.910) -- 0:00:42
284500 -- (-373.622) (-373.874) (-377.845) [-373.317] * (-372.629) (-372.395) [-377.964] (-374.347) -- 0:00:42
285000 -- [-378.148] (-371.983) (-381.762) (-372.964) * [-373.314] (-371.767) (-374.341) (-375.324) -- 0:00:42
Average standard deviation of split frequencies: 0.012545
285500 -- (-372.824) [-372.945] (-378.345) (-371.846) * [-371.377] (-372.802) (-374.020) (-373.756) -- 0:00:42
286000 -- (-375.080) [-372.788] (-374.122) (-376.289) * (-374.309) (-374.229) (-376.563) [-375.847] -- 0:00:42
286500 -- [-372.399] (-375.137) (-374.063) (-375.834) * [-372.820] (-373.846) (-374.438) (-373.538) -- 0:00:42
287000 -- (-374.175) [-375.831] (-372.893) (-376.954) * (-373.482) (-373.486) (-374.872) [-372.201] -- 0:00:42
287500 -- [-372.958] (-374.731) (-376.197) (-374.543) * [-372.349] (-374.525) (-376.424) (-372.892) -- 0:00:42
288000 -- (-375.680) (-372.865) [-372.464] (-374.054) * [-372.007] (-372.695) (-371.646) (-372.021) -- 0:00:42
288500 -- [-372.128] (-373.848) (-372.184) (-378.402) * [-375.606] (-375.295) (-373.932) (-371.696) -- 0:00:41
289000 -- (-371.428) [-372.084] (-372.668) (-373.794) * (-372.714) [-374.160] (-373.072) (-375.677) -- 0:00:41
289500 -- (-377.306) (-372.489) [-373.869] (-372.715) * (-372.830) [-373.515] (-372.383) (-374.231) -- 0:00:41
290000 -- (-372.446) (-372.393) [-374.381] (-373.125) * (-377.284) [-373.778] (-373.748) (-376.518) -- 0:00:41
Average standard deviation of split frequencies: 0.012497
290500 -- (-373.622) [-375.055] (-373.499) (-379.101) * (-373.050) (-372.942) (-372.674) [-372.157] -- 0:00:41
291000 -- (-372.565) (-378.879) [-375.679] (-376.160) * (-374.053) [-372.388] (-372.446) (-374.177) -- 0:00:41
291500 -- (-373.958) (-374.459) [-374.899] (-377.804) * (-374.424) (-374.812) (-373.123) [-373.723] -- 0:00:41
292000 -- (-372.274) (-377.176) (-371.554) [-375.063] * (-376.686) (-372.302) [-373.078] (-372.986) -- 0:00:41
292500 -- [-373.064] (-375.645) (-371.966) (-371.971) * (-372.082) [-372.734] (-373.059) (-373.711) -- 0:00:41
293000 -- (-374.089) (-372.597) (-373.755) [-372.474] * [-372.509] (-373.372) (-374.562) (-372.437) -- 0:00:41
293500 -- (-375.280) (-375.640) (-373.115) [-373.134] * [-377.840] (-373.784) (-374.369) (-375.983) -- 0:00:40
294000 -- [-372.276] (-373.414) (-372.108) (-374.192) * (-372.240) (-372.820) (-376.478) [-372.200] -- 0:00:40
294500 -- (-373.591) [-374.566] (-372.857) (-374.661) * (-373.341) (-373.107) (-373.588) [-372.918] -- 0:00:40
295000 -- [-372.649] (-373.643) (-374.970) (-375.503) * [-371.988] (-371.463) (-377.585) (-372.178) -- 0:00:40
Average standard deviation of split frequencies: 0.012564
295500 -- (-375.093) (-375.984) [-374.272] (-372.350) * (-374.594) [-372.546] (-376.574) (-373.021) -- 0:00:40
296000 -- (-380.935) (-371.325) (-373.290) [-372.486] * [-373.302] (-374.721) (-376.722) (-371.345) -- 0:00:42
296500 -- [-373.020] (-371.337) (-373.856) (-372.487) * (-372.256) [-372.455] (-372.445) (-372.331) -- 0:00:42
297000 -- (-376.515) [-371.333] (-372.119) (-372.475) * (-374.459) (-371.949) [-374.256] (-373.385) -- 0:00:42
297500 -- (-375.076) (-373.677) (-377.467) [-372.597] * [-373.321] (-372.119) (-373.149) (-371.735) -- 0:00:42
298000 -- (-377.315) [-372.693] (-372.474) (-373.467) * (-375.246) [-374.282] (-375.778) (-373.075) -- 0:00:42
298500 -- (-371.831) (-373.494) (-379.782) [-373.166] * (-372.201) (-371.690) (-374.732) [-372.118] -- 0:00:42
299000 -- [-377.689] (-373.389) (-380.508) (-375.675) * (-377.254) (-371.242) [-374.632] (-373.035) -- 0:00:42
299500 -- (-373.639) (-374.377) [-372.231] (-371.519) * (-375.712) [-377.447] (-371.452) (-372.861) -- 0:00:42
300000 -- (-376.608) (-376.200) [-373.599] (-372.109) * [-374.589] (-379.546) (-373.323) (-373.252) -- 0:00:42
Average standard deviation of split frequencies: 0.012978
300500 -- (-376.782) [-372.892] (-374.817) (-375.472) * (-373.350) (-373.189) (-372.019) [-371.955] -- 0:00:41
301000 -- (-374.564) (-371.639) [-375.461] (-373.939) * (-372.022) (-373.019) [-373.835] (-372.652) -- 0:00:41
301500 -- (-373.324) (-371.672) [-372.327] (-375.315) * [-372.086] (-372.320) (-375.284) (-372.327) -- 0:00:41
302000 -- (-375.991) (-374.614) (-373.584) [-374.840] * (-374.776) [-372.241] (-375.020) (-372.423) -- 0:00:41
302500 -- (-373.880) (-375.508) [-371.722] (-373.872) * (-378.920) (-372.055) (-373.437) [-372.011] -- 0:00:41
303000 -- (-371.881) (-374.611) [-373.439] (-372.996) * (-373.453) (-372.767) (-377.462) [-373.952] -- 0:00:41
303500 -- (-373.168) (-375.678) (-373.130) [-372.582] * (-372.901) [-374.051] (-372.222) (-373.898) -- 0:00:41
304000 -- (-372.543) (-373.920) (-372.611) [-375.423] * (-375.252) (-373.336) [-374.286] (-375.800) -- 0:00:41
304500 -- (-374.533) (-374.003) [-372.029] (-373.048) * (-376.089) [-373.786] (-376.344) (-379.836) -- 0:00:41
305000 -- (-373.105) [-372.906] (-373.407) (-372.654) * [-371.880] (-371.565) (-372.902) (-373.373) -- 0:00:41
Average standard deviation of split frequencies: 0.013095
305500 -- (-372.470) (-373.245) (-375.721) [-372.893] * (-371.659) [-371.686] (-375.958) (-373.407) -- 0:00:40
306000 -- (-373.302) (-375.263) (-376.413) [-371.827] * (-371.673) (-372.198) [-372.941] (-373.856) -- 0:00:40
306500 -- (-371.981) (-372.435) [-372.500] (-373.210) * [-374.559] (-375.594) (-372.117) (-371.877) -- 0:00:40
307000 -- (-371.915) (-375.091) [-373.305] (-376.071) * (-373.245) [-375.140] (-373.327) (-371.281) -- 0:00:40
307500 -- (-372.790) (-374.318) (-372.551) [-377.180] * [-372.561] (-376.225) (-372.898) (-373.575) -- 0:00:40
308000 -- (-371.355) [-372.880] (-372.726) (-378.050) * (-373.031) (-372.869) (-373.282) [-374.949] -- 0:00:40
308500 -- (-371.840) (-375.092) (-374.109) [-372.780] * (-373.518) (-372.597) (-375.248) [-373.689] -- 0:00:40
309000 -- (-373.655) (-374.898) (-375.755) [-373.897] * [-371.583] (-373.344) (-375.421) (-376.579) -- 0:00:40
309500 -- (-375.511) (-375.105) [-373.118] (-377.168) * [-371.581] (-373.338) (-374.621) (-375.575) -- 0:00:40
310000 -- (-376.118) (-372.317) (-373.244) [-372.024] * (-377.244) [-374.071] (-376.036) (-378.813) -- 0:00:40
Average standard deviation of split frequencies: 0.014103
310500 -- (-371.938) [-373.408] (-373.728) (-371.918) * (-373.335) (-379.864) (-373.904) [-374.929] -- 0:00:39
311000 -- [-371.458] (-374.135) (-373.279) (-372.772) * [-372.825] (-374.410) (-376.080) (-372.391) -- 0:00:39
311500 -- [-373.874] (-375.495) (-375.446) (-372.441) * (-371.989) [-372.405] (-371.586) (-373.247) -- 0:00:39
312000 -- [-372.411] (-372.585) (-375.756) (-372.276) * [-373.830] (-373.450) (-372.007) (-375.968) -- 0:00:39
312500 -- (-377.255) (-374.030) (-376.716) [-371.962] * [-371.522] (-372.964) (-377.062) (-373.027) -- 0:00:41
313000 -- (-375.432) (-373.039) [-372.727] (-377.093) * (-375.373) (-371.970) [-375.221] (-373.314) -- 0:00:41
313500 -- [-373.943] (-372.991) (-373.913) (-372.714) * (-376.574) [-371.755] (-377.810) (-375.776) -- 0:00:41
314000 -- (-372.431) (-373.640) (-373.122) [-374.106] * (-377.413) (-372.540) (-377.125) [-374.477] -- 0:00:41
314500 -- (-372.675) (-374.580) (-374.528) [-373.150] * [-373.392] (-372.040) (-377.594) (-372.897) -- 0:00:41
315000 -- (-371.651) (-371.763) (-373.531) [-373.463] * [-374.568] (-372.255) (-372.744) (-372.972) -- 0:00:41
Average standard deviation of split frequencies: 0.013675
315500 -- [-372.002] (-374.047) (-373.408) (-373.312) * (-375.064) (-371.914) (-375.389) [-373.455] -- 0:00:41
316000 -- (-371.322) (-373.411) [-371.836] (-372.428) * (-375.523) [-373.294] (-374.780) (-374.127) -- 0:00:41
316500 -- (-372.088) [-372.601] (-372.172) (-371.849) * (-375.818) (-375.853) [-374.600] (-374.928) -- 0:00:41
317000 -- (-374.225) (-374.537) [-374.259] (-374.226) * (-377.779) (-371.455) (-373.069) [-372.626] -- 0:00:40
317500 -- (-372.176) [-375.436] (-374.720) (-384.238) * (-374.222) [-371.725] (-373.287) (-375.308) -- 0:00:40
318000 -- (-374.447) (-374.867) [-374.078] (-373.776) * [-375.749] (-372.941) (-375.402) (-374.236) -- 0:00:40
318500 -- [-373.206] (-373.576) (-374.129) (-374.984) * [-374.234] (-378.101) (-372.448) (-374.220) -- 0:00:40
319000 -- (-376.631) (-374.009) (-374.133) [-375.070] * (-374.985) (-372.948) [-373.687] (-374.439) -- 0:00:40
319500 -- (-372.914) [-372.062] (-373.617) (-374.146) * (-374.811) (-376.793) (-375.721) [-377.172] -- 0:00:40
320000 -- (-372.607) (-373.201) (-379.120) [-373.621] * (-377.384) (-372.565) (-375.992) [-374.977] -- 0:00:40
Average standard deviation of split frequencies: 0.013404
320500 -- [-374.978] (-373.179) (-374.009) (-372.333) * (-373.864) (-378.944) [-373.807] (-371.903) -- 0:00:40
321000 -- (-374.839) (-376.242) (-374.239) [-371.864] * [-375.001] (-373.513) (-372.852) (-381.331) -- 0:00:40
321500 -- [-372.966] (-374.219) (-372.055) (-377.637) * (-374.766) (-371.394) [-373.176] (-381.706) -- 0:00:40
322000 -- [-372.725] (-372.079) (-372.579) (-375.939) * (-373.521) (-372.236) (-375.589) [-377.170] -- 0:00:40
322500 -- (-375.531) (-376.681) [-372.636] (-374.934) * [-372.987] (-376.305) (-372.762) (-375.392) -- 0:00:39
323000 -- (-375.260) (-376.366) (-371.667) [-371.514] * (-372.471) [-376.121] (-374.799) (-376.439) -- 0:00:39
323500 -- [-373.390] (-378.846) (-372.102) (-372.119) * (-375.595) (-372.461) [-371.609] (-372.965) -- 0:00:39
324000 -- [-373.092] (-376.223) (-372.045) (-377.767) * (-374.076) [-371.602] (-373.079) (-373.794) -- 0:00:39
324500 -- (-373.092) (-379.766) (-371.776) [-373.448] * (-375.008) (-374.583) (-372.135) [-374.922] -- 0:00:39
325000 -- (-372.577) (-373.833) [-372.688] (-371.666) * (-378.225) (-376.722) (-371.838) [-372.334] -- 0:00:39
Average standard deviation of split frequencies: 0.013175
325500 -- (-371.962) (-374.956) (-371.455) [-373.326] * (-374.299) (-375.948) [-372.683] (-378.007) -- 0:00:39
326000 -- [-371.454] (-373.926) (-372.401) (-373.412) * (-371.354) (-377.474) [-373.117] (-379.482) -- 0:00:39
326500 -- (-372.005) (-373.926) [-373.477] (-373.765) * (-371.375) (-378.533) (-372.238) [-371.424] -- 0:00:39
327000 -- (-376.044) (-376.485) [-372.868] (-374.124) * [-371.949] (-373.500) (-372.345) (-373.093) -- 0:00:39
327500 -- [-372.557] (-374.743) (-373.839) (-375.680) * [-373.832] (-373.867) (-374.690) (-374.691) -- 0:00:39
328000 -- (-373.891) [-371.872] (-372.930) (-372.662) * (-373.958) [-374.717] (-374.880) (-376.680) -- 0:00:38
328500 -- (-376.901) (-373.206) (-372.611) [-374.384] * (-374.150) [-372.029] (-375.825) (-372.274) -- 0:00:38
329000 -- [-372.800] (-378.507) (-372.096) (-372.182) * (-374.345) [-375.240] (-374.134) (-371.534) -- 0:00:38
329500 -- (-372.576) [-376.630] (-373.599) (-372.943) * [-375.951] (-374.072) (-374.574) (-371.973) -- 0:00:40
330000 -- (-374.334) (-372.837) [-372.684] (-372.530) * (-373.133) (-372.472) [-374.805] (-371.667) -- 0:00:40
Average standard deviation of split frequencies: 0.013781
330500 -- (-374.582) (-373.455) (-374.177) [-374.921] * [-380.835] (-374.775) (-373.937) (-375.624) -- 0:00:40
331000 -- (-374.450) (-374.306) (-374.687) [-374.299] * (-373.045) [-372.142] (-373.855) (-375.546) -- 0:00:40
331500 -- (-372.793) [-376.744] (-375.253) (-374.962) * [-372.868] (-372.577) (-372.703) (-377.893) -- 0:00:40
332000 -- (-372.464) (-380.580) [-373.497] (-372.926) * (-372.515) (-374.764) [-371.493] (-373.395) -- 0:00:40
332500 -- (-371.872) [-376.329] (-374.830) (-372.339) * (-373.135) (-375.521) (-374.892) [-371.699] -- 0:00:40
333000 -- (-372.283) (-373.640) [-371.922] (-373.892) * (-372.064) (-372.622) [-377.403] (-372.342) -- 0:00:40
333500 -- [-373.064] (-373.591) (-376.007) (-375.550) * (-373.317) (-372.843) (-373.614) [-371.815] -- 0:00:39
334000 -- (-372.873) (-373.831) [-375.335] (-372.333) * (-374.488) (-374.266) [-372.881] (-373.269) -- 0:00:39
334500 -- (-380.577) (-372.342) (-376.457) [-372.114] * (-372.216) (-371.584) (-373.540) [-373.106] -- 0:00:39
335000 -- (-373.744) (-372.694) (-373.170) [-373.250] * (-374.431) (-375.939) [-373.000] (-373.962) -- 0:00:39
Average standard deviation of split frequencies: 0.013796
335500 -- (-372.728) (-374.523) (-375.413) [-372.019] * (-372.211) (-376.417) [-372.933] (-373.345) -- 0:00:39
336000 -- (-372.998) (-371.580) (-373.839) [-373.486] * (-372.351) (-372.545) [-372.337] (-375.866) -- 0:00:39
336500 -- (-373.425) (-375.857) [-372.443] (-372.401) * (-377.377) (-373.286) [-372.363] (-371.621) -- 0:00:39
337000 -- (-371.652) (-372.533) [-373.944] (-372.410) * (-373.554) [-374.298] (-372.169) (-374.011) -- 0:00:39
337500 -- (-375.030) (-372.648) (-374.288) [-373.266] * [-371.790] (-373.054) (-371.878) (-377.133) -- 0:00:39
338000 -- (-373.116) (-374.151) (-374.080) [-373.836] * [-372.592] (-374.216) (-373.212) (-378.630) -- 0:00:39
338500 -- (-372.711) [-373.166] (-375.781) (-373.693) * (-372.610) (-371.275) (-375.413) [-380.684] -- 0:00:39
339000 -- (-371.967) (-372.207) [-372.550] (-376.044) * [-371.889] (-376.060) (-372.503) (-376.375) -- 0:00:38
339500 -- (-373.420) (-372.895) [-375.188] (-372.701) * (-373.322) (-378.493) (-374.030) [-372.694] -- 0:00:38
340000 -- (-374.910) (-377.225) [-374.791] (-371.821) * (-374.172) (-373.594) [-374.824] (-372.884) -- 0:00:38
Average standard deviation of split frequencies: 0.013607
340500 -- (-373.016) (-376.596) [-375.515] (-373.881) * (-374.619) (-374.883) (-374.099) [-374.107] -- 0:00:38
341000 -- (-374.891) (-378.384) [-373.588] (-371.481) * (-377.753) (-374.222) [-373.066] (-377.879) -- 0:00:38
341500 -- [-372.923] (-374.639) (-374.181) (-373.767) * (-371.931) (-372.402) (-376.562) [-374.921] -- 0:00:38
342000 -- (-372.501) (-373.720) [-372.282] (-373.423) * (-372.966) (-372.772) [-372.420] (-374.141) -- 0:00:38
342500 -- (-371.740) (-371.774) [-374.688] (-372.858) * (-371.555) (-376.331) (-372.570) [-375.665] -- 0:00:38
343000 -- (-373.058) (-373.313) [-373.696] (-373.433) * [-375.432] (-374.138) (-374.235) (-378.226) -- 0:00:38
343500 -- (-373.835) [-373.025] (-373.011) (-373.743) * (-373.144) [-372.679] (-374.947) (-374.780) -- 0:00:38
344000 -- (-376.000) (-373.083) [-373.332] (-372.482) * [-373.720] (-371.770) (-373.928) (-373.221) -- 0:00:38
344500 -- (-376.004) (-372.078) (-372.705) [-374.706] * (-373.141) [-374.527] (-373.571) (-373.170) -- 0:00:38
345000 -- [-374.989] (-371.890) (-371.918) (-374.861) * (-373.837) (-373.291) [-372.969] (-374.367) -- 0:00:37
Average standard deviation of split frequencies: 0.012867
345500 -- (-373.780) [-377.252] (-373.652) (-372.216) * (-376.781) (-371.805) [-372.489] (-373.951) -- 0:00:37
346000 -- (-376.225) (-372.604) [-372.925] (-373.773) * [-373.044] (-372.862) (-373.263) (-372.961) -- 0:00:37
346500 -- [-373.341] (-372.205) (-372.048) (-373.576) * (-372.927) [-376.256] (-372.184) (-373.759) -- 0:00:39
347000 -- (-377.379) [-374.048] (-373.077) (-377.091) * [-372.387] (-372.756) (-372.666) (-374.339) -- 0:00:39
347500 -- (-372.653) [-373.512] (-374.917) (-374.712) * (-372.600) (-372.696) [-372.795] (-373.768) -- 0:00:39
348000 -- (-373.898) (-373.742) [-374.199] (-376.210) * (-373.404) (-371.488) [-371.487] (-375.105) -- 0:00:39
348500 -- (-372.544) (-374.134) (-372.584) [-372.668] * (-372.230) (-372.437) [-371.574] (-374.341) -- 0:00:39
349000 -- [-371.962] (-378.020) (-374.138) (-373.552) * (-373.073) (-376.081) (-374.224) [-373.778] -- 0:00:39
349500 -- [-374.771] (-376.236) (-377.764) (-372.492) * (-373.089) (-374.599) (-379.008) [-372.532] -- 0:00:39
350000 -- (-372.222) [-371.763] (-371.779) (-373.970) * (-375.574) (-373.181) [-376.342] (-371.773) -- 0:00:39
Average standard deviation of split frequencies: 0.014009
350500 -- [-371.527] (-373.691) (-372.227) (-372.985) * (-373.344) (-373.158) (-372.058) [-371.491] -- 0:00:38
351000 -- (-372.127) (-374.628) (-372.445) [-372.769] * (-371.835) (-374.633) [-372.836] (-377.171) -- 0:00:38
351500 -- [-371.851] (-372.165) (-374.710) (-372.834) * (-371.393) (-374.109) (-377.693) [-372.390] -- 0:00:38
352000 -- (-371.514) (-372.320) (-373.319) [-372.836] * [-372.043] (-373.598) (-373.089) (-374.676) -- 0:00:38
352500 -- [-372.944] (-373.116) (-371.954) (-373.287) * [-371.939] (-373.929) (-372.704) (-377.922) -- 0:00:38
353000 -- (-374.842) (-373.241) (-374.501) [-373.262] * [-372.874] (-380.037) (-374.998) (-373.796) -- 0:00:38
353500 -- (-372.590) [-373.704] (-378.986) (-374.842) * (-374.417) [-373.493] (-373.294) (-371.861) -- 0:00:38
354000 -- (-373.916) (-376.091) [-372.919] (-374.312) * [-372.736] (-376.478) (-373.317) (-372.699) -- 0:00:38
354500 -- [-374.483] (-374.605) (-372.031) (-373.443) * [-372.921] (-374.120) (-374.481) (-372.705) -- 0:00:38
355000 -- [-374.400] (-374.612) (-373.309) (-372.763) * (-373.090) (-377.151) [-372.683] (-373.748) -- 0:00:38
Average standard deviation of split frequencies: 0.014426
355500 -- (-373.049) (-379.985) (-372.734) [-374.965] * (-379.770) (-374.996) [-373.798] (-375.514) -- 0:00:38
356000 -- [-375.937] (-375.082) (-371.956) (-374.569) * (-375.641) (-376.676) (-373.841) [-374.880] -- 0:00:37
356500 -- (-376.541) (-379.245) [-373.904] (-376.945) * (-372.214) (-374.153) [-372.880] (-375.282) -- 0:00:37
357000 -- (-374.534) (-375.728) (-373.971) [-375.159] * (-373.504) [-372.255] (-373.164) (-374.520) -- 0:00:37
357500 -- [-372.785] (-374.571) (-372.840) (-377.826) * (-373.654) (-372.093) [-373.150] (-372.927) -- 0:00:37
358000 -- (-373.120) (-371.988) (-373.834) [-371.411] * (-372.726) [-374.835] (-373.659) (-371.756) -- 0:00:37
358500 -- (-371.956) (-378.128) [-376.878] (-373.494) * (-375.381) (-373.374) (-372.084) [-372.048] -- 0:00:37
359000 -- (-373.597) [-371.390] (-374.672) (-375.261) * [-374.939] (-377.849) (-375.760) (-372.083) -- 0:00:37
359500 -- [-371.504] (-375.643) (-375.293) (-373.386) * (-376.819) (-373.565) [-374.180] (-372.086) -- 0:00:37
360000 -- (-373.498) [-373.489] (-374.181) (-372.572) * (-374.560) (-372.663) [-372.132] (-375.308) -- 0:00:37
Average standard deviation of split frequencies: 0.014305
360500 -- (-373.475) (-375.100) [-374.541] (-372.085) * (-375.042) (-374.277) (-375.189) [-372.583] -- 0:00:37
361000 -- (-377.623) (-375.411) [-375.752] (-374.721) * (-373.980) (-373.501) [-371.487] (-375.250) -- 0:00:37
361500 -- (-377.303) (-373.939) (-373.432) [-373.523] * [-372.823] (-372.581) (-372.253) (-374.987) -- 0:00:37
362000 -- (-375.641) (-372.834) (-373.913) [-375.313] * [-372.033] (-374.574) (-373.322) (-372.264) -- 0:00:37
362500 -- (-374.970) (-373.709) (-371.663) [-374.657] * (-373.057) [-375.437] (-374.926) (-371.591) -- 0:00:36
363000 -- (-374.106) (-372.166) (-380.733) [-373.909] * [-373.753] (-374.704) (-372.065) (-372.975) -- 0:00:36
363500 -- (-373.027) (-371.581) (-377.866) [-372.042] * (-376.005) [-374.368] (-374.279) (-372.740) -- 0:00:36
364000 -- (-373.614) (-371.576) (-371.868) [-372.666] * (-373.020) (-375.061) (-372.839) [-371.897] -- 0:00:38
364500 -- (-372.814) (-373.078) [-371.647] (-372.485) * [-372.182] (-375.511) (-375.277) (-373.115) -- 0:00:38
365000 -- (-374.816) [-373.007] (-372.695) (-372.782) * [-373.483] (-375.436) (-377.342) (-376.512) -- 0:00:38
Average standard deviation of split frequencies: 0.013739
365500 -- (-374.454) (-373.161) [-373.005] (-373.414) * (-373.912) (-373.924) (-371.878) [-375.285] -- 0:00:38
366000 -- [-373.002] (-374.851) (-373.170) (-372.715) * (-371.862) (-374.292) (-375.082) [-374.457] -- 0:00:38
366500 -- (-379.087) (-380.330) [-373.939] (-372.621) * (-373.835) (-373.941) [-373.277] (-373.025) -- 0:00:38
367000 -- (-375.514) (-376.356) [-378.880] (-375.309) * (-374.392) (-373.025) (-374.279) [-372.981] -- 0:00:37
367500 -- (-372.853) (-372.739) (-374.032) [-374.126] * [-372.046] (-374.595) (-373.805) (-375.129) -- 0:00:37
368000 -- [-373.852] (-372.061) (-374.519) (-373.688) * (-372.084) (-372.210) [-373.564] (-373.341) -- 0:00:37
368500 -- (-372.950) [-376.299] (-373.403) (-375.108) * (-372.290) (-372.632) (-371.981) [-374.502] -- 0:00:37
369000 -- [-376.356] (-374.987) (-375.637) (-373.673) * (-372.539) (-372.417) [-371.500] (-372.462) -- 0:00:37
369500 -- (-372.445) [-374.634] (-372.669) (-375.597) * (-373.713) (-372.913) [-371.265] (-372.535) -- 0:00:37
370000 -- [-376.110] (-372.922) (-372.480) (-374.588) * (-371.961) (-372.925) [-372.622] (-372.493) -- 0:00:37
Average standard deviation of split frequencies: 0.013454
370500 -- [-372.348] (-372.688) (-373.333) (-372.111) * (-373.647) (-372.079) [-372.104] (-375.260) -- 0:00:37
371000 -- [-372.837] (-372.339) (-372.409) (-373.169) * [-375.161] (-373.661) (-372.507) (-374.514) -- 0:00:37
371500 -- (-372.116) [-371.559] (-375.450) (-373.913) * (-373.943) (-376.197) [-371.800] (-371.883) -- 0:00:37
372000 -- [-373.954] (-372.739) (-372.990) (-373.709) * (-374.964) (-375.365) (-372.584) [-377.567] -- 0:00:37
372500 -- (-377.468) [-373.335] (-374.006) (-373.646) * (-371.890) [-371.375] (-372.845) (-379.373) -- 0:00:37
373000 -- (-371.896) (-377.707) (-374.685) [-373.642] * (-372.968) (-372.072) [-371.635] (-377.343) -- 0:00:36
373500 -- [-373.409] (-372.511) (-373.772) (-372.525) * (-374.530) (-374.194) (-373.249) [-373.205] -- 0:00:36
374000 -- (-372.236) (-374.698) [-371.505] (-373.161) * (-373.773) (-373.533) (-372.400) [-371.842] -- 0:00:36
374500 -- (-371.538) (-375.874) [-373.332] (-375.629) * [-373.692] (-373.058) (-373.080) (-372.694) -- 0:00:36
375000 -- (-373.161) (-377.299) (-374.782) [-373.395] * [-372.397] (-372.806) (-372.230) (-374.930) -- 0:00:36
Average standard deviation of split frequencies: 0.013659
375500 -- (-372.194) (-376.890) (-375.126) [-375.901] * (-373.124) (-374.374) (-374.457) [-375.069] -- 0:00:36
376000 -- (-375.570) (-375.537) [-375.764] (-373.737) * [-373.457] (-375.886) (-372.774) (-375.063) -- 0:00:36
376500 -- (-374.519) (-373.297) (-373.722) [-371.940] * [-373.340] (-374.544) (-375.774) (-376.515) -- 0:00:36
377000 -- (-372.121) (-375.225) (-374.648) [-372.360] * (-374.608) [-374.051] (-374.292) (-372.097) -- 0:00:36
377500 -- (-375.234) (-373.884) (-371.520) [-374.034] * (-374.566) [-376.726] (-376.288) (-372.451) -- 0:00:36
378000 -- (-372.892) [-374.342] (-372.076) (-372.515) * (-373.936) (-372.605) (-375.663) [-372.806] -- 0:00:36
378500 -- [-372.031] (-376.254) (-371.706) (-374.090) * (-373.599) (-374.159) (-377.376) [-373.120] -- 0:00:36
379000 -- (-375.144) [-371.601] (-371.566) (-377.143) * (-373.898) (-373.670) [-372.425] (-374.280) -- 0:00:36
379500 -- [-373.386] (-372.258) (-371.924) (-375.740) * (-374.023) [-372.639] (-377.639) (-377.538) -- 0:00:35
380000 -- (-373.720) (-373.424) [-371.856] (-378.507) * (-378.035) (-374.552) [-372.366] (-371.860) -- 0:00:35
Average standard deviation of split frequencies: 0.013948
380500 -- (-373.245) (-374.671) (-372.000) [-374.755] * [-371.588] (-375.236) (-377.595) (-372.339) -- 0:00:35
381000 -- (-374.080) [-373.956] (-373.635) (-374.619) * [-371.921] (-375.169) (-376.254) (-374.778) -- 0:00:37
381500 -- [-374.471] (-376.512) (-379.604) (-371.649) * [-372.608] (-378.061) (-379.521) (-385.401) -- 0:00:37
382000 -- (-375.019) (-373.350) (-373.702) [-372.738] * (-374.531) (-375.986) (-373.685) [-373.756] -- 0:00:37
382500 -- (-378.190) (-373.111) [-375.041] (-373.364) * (-375.380) (-373.018) [-371.306] (-373.003) -- 0:00:37
383000 -- (-373.095) (-379.808) [-372.938] (-373.080) * (-373.125) (-373.584) (-372.554) [-374.906] -- 0:00:37
383500 -- [-375.483] (-374.320) (-372.026) (-375.147) * [-371.857] (-372.337) (-373.824) (-371.328) -- 0:00:36
384000 -- (-374.640) (-375.920) [-372.079] (-372.545) * (-373.504) [-372.683] (-376.127) (-375.771) -- 0:00:36
384500 -- [-372.138] (-375.087) (-372.802) (-376.817) * (-376.827) (-374.877) [-374.410] (-373.150) -- 0:00:36
385000 -- (-372.249) [-372.916] (-374.325) (-374.629) * (-377.769) (-376.947) (-374.049) [-373.817] -- 0:00:36
Average standard deviation of split frequencies: 0.014334
385500 -- (-374.553) [-373.438] (-373.179) (-372.336) * (-374.990) [-375.938] (-374.969) (-373.852) -- 0:00:36
386000 -- [-372.831] (-373.538) (-371.735) (-376.684) * (-378.572) [-371.803] (-374.661) (-372.183) -- 0:00:36
386500 -- (-371.909) (-375.985) [-373.894] (-376.222) * (-374.590) [-373.302] (-372.415) (-372.818) -- 0:00:36
387000 -- (-372.602) (-375.541) [-373.263] (-372.322) * (-374.787) (-375.394) (-371.439) [-375.017] -- 0:00:36
387500 -- (-375.179) (-371.741) (-373.644) [-373.309] * (-375.135) (-375.568) [-371.515] (-372.187) -- 0:00:36
388000 -- [-377.037] (-373.626) (-375.112) (-373.581) * (-375.069) [-375.368] (-372.511) (-374.328) -- 0:00:36
388500 -- (-372.823) [-372.378] (-372.023) (-372.071) * (-379.035) (-373.457) [-372.751] (-374.985) -- 0:00:36
389000 -- (-373.694) (-376.833) (-372.589) [-373.168] * (-377.485) (-374.849) (-372.901) [-371.796] -- 0:00:36
389500 -- (-379.724) (-373.273) [-373.144] (-371.666) * (-375.177) (-374.080) [-374.710] (-372.449) -- 0:00:36
390000 -- (-372.156) [-373.816] (-372.067) (-377.555) * [-375.508] (-376.599) (-373.023) (-375.202) -- 0:00:35
Average standard deviation of split frequencies: 0.013609
390500 -- [-371.983] (-373.246) (-376.008) (-382.410) * (-376.866) (-374.012) [-372.274] (-373.656) -- 0:00:35
391000 -- [-372.593] (-373.135) (-376.811) (-373.692) * (-372.411) (-373.671) (-371.707) [-372.101] -- 0:00:35
391500 -- [-373.213] (-376.736) (-373.026) (-372.193) * (-375.036) (-381.251) (-373.780) [-373.791] -- 0:00:35
392000 -- (-374.238) [-372.334] (-372.615) (-376.784) * (-373.676) (-376.628) [-374.453] (-372.756) -- 0:00:35
392500 -- (-375.378) (-374.026) (-372.239) [-375.357] * [-373.533] (-375.057) (-373.461) (-372.652) -- 0:00:35
393000 -- (-375.613) (-376.967) [-372.780] (-373.285) * (-375.387) (-375.954) [-375.051] (-375.317) -- 0:00:35
393500 -- (-372.480) (-374.818) [-373.741] (-372.181) * (-373.590) [-375.620] (-374.510) (-375.960) -- 0:00:35
394000 -- [-374.932] (-375.801) (-372.051) (-372.917) * [-375.127] (-373.444) (-372.090) (-374.615) -- 0:00:35
394500 -- (-372.105) (-375.766) (-372.800) [-372.824] * (-372.172) [-373.840] (-373.612) (-374.881) -- 0:00:35
395000 -- [-374.014] (-373.295) (-374.550) (-375.910) * (-371.956) (-372.042) [-375.415] (-375.905) -- 0:00:35
Average standard deviation of split frequencies: 0.013293
395500 -- (-377.267) (-376.271) (-375.637) [-375.045] * (-372.843) (-371.525) [-374.716] (-374.886) -- 0:00:35
396000 -- (-373.960) (-379.144) [-375.289] (-373.740) * (-372.123) [-371.882] (-375.580) (-373.762) -- 0:00:35
396500 -- [-374.129] (-374.650) (-373.248) (-372.833) * (-373.475) (-373.108) [-372.526] (-376.035) -- 0:00:35
397000 -- [-372.833] (-371.862) (-373.196) (-373.405) * (-373.113) [-372.495] (-374.847) (-378.636) -- 0:00:34
397500 -- [-371.963] (-374.743) (-372.807) (-374.174) * (-376.894) [-373.215] (-373.897) (-372.431) -- 0:00:36
398000 -- (-372.492) [-372.448] (-373.668) (-374.974) * (-377.451) [-372.239] (-375.026) (-373.566) -- 0:00:36
398500 -- [-371.694] (-377.967) (-371.729) (-372.375) * (-375.319) [-378.111] (-374.187) (-375.143) -- 0:00:36
399000 -- (-373.035) (-377.002) [-374.149] (-372.518) * (-372.632) (-376.420) [-374.434] (-371.584) -- 0:00:36
399500 -- [-372.441] (-372.843) (-372.371) (-372.987) * (-374.838) (-372.555) (-373.843) [-371.859] -- 0:00:36
400000 -- (-376.630) [-371.695] (-374.459) (-374.115) * (-376.092) (-372.042) [-374.164] (-376.637) -- 0:00:36
Average standard deviation of split frequencies: 0.012804
400500 -- [-373.665] (-374.152) (-376.691) (-371.357) * (-375.539) (-372.335) [-375.827] (-376.133) -- 0:00:35
401000 -- (-371.647) [-373.399] (-373.903) (-377.244) * (-377.460) [-372.573] (-372.902) (-372.815) -- 0:00:35
401500 -- (-372.805) [-372.558] (-375.034) (-374.376) * (-372.499) (-373.598) [-371.880] (-373.760) -- 0:00:35
402000 -- (-374.101) (-371.227) (-375.517) [-372.822] * [-373.308] (-376.575) (-374.028) (-372.971) -- 0:00:35
402500 -- [-375.744] (-373.551) (-371.378) (-374.416) * (-374.059) (-374.931) [-371.535] (-372.596) -- 0:00:35
403000 -- (-375.456) (-373.202) (-376.353) [-375.162] * [-372.853] (-373.694) (-375.409) (-374.244) -- 0:00:35
403500 -- [-371.649] (-375.727) (-372.616) (-373.048) * (-377.443) [-373.826] (-373.193) (-371.898) -- 0:00:35
404000 -- [-372.830] (-372.548) (-374.904) (-373.377) * (-371.655) [-372.024] (-371.982) (-373.547) -- 0:00:35
404500 -- [-372.566] (-377.191) (-372.077) (-375.010) * (-373.232) (-371.626) [-372.692] (-373.065) -- 0:00:35
405000 -- (-372.430) [-372.503] (-372.019) (-376.865) * (-371.975) (-371.605) (-374.477) [-374.981] -- 0:00:35
Average standard deviation of split frequencies: 0.013288
405500 -- (-374.578) (-374.806) [-374.737] (-371.783) * (-372.205) (-374.286) (-373.551) [-372.688] -- 0:00:35
406000 -- (-372.868) (-373.250) [-372.446] (-372.300) * (-372.180) [-375.149] (-374.591) (-373.654) -- 0:00:35
406500 -- (-373.816) (-376.004) (-373.792) [-375.924] * (-373.995) [-375.798] (-372.636) (-373.023) -- 0:00:35
407000 -- (-372.752) [-376.388] (-377.129) (-372.598) * (-372.135) [-373.322] (-375.916) (-376.595) -- 0:00:34
407500 -- (-373.707) (-377.236) (-376.722) [-371.846] * [-374.279] (-373.215) (-376.608) (-374.178) -- 0:00:34
408000 -- (-374.029) (-371.566) (-373.133) [-371.894] * [-372.665] (-373.201) (-372.808) (-372.555) -- 0:00:34
408500 -- (-374.411) (-372.667) [-374.407] (-373.463) * (-371.935) (-372.933) (-374.767) [-374.293] -- 0:00:34
409000 -- (-375.603) (-373.398) [-373.113] (-372.643) * (-375.742) (-372.565) (-376.868) [-373.610] -- 0:00:34
409500 -- (-375.250) (-372.431) (-372.966) [-374.599] * (-372.297) (-373.085) (-372.769) [-375.872] -- 0:00:34
410000 -- (-373.461) (-374.472) [-373.003] (-373.652) * (-372.502) (-371.532) [-376.304] (-374.193) -- 0:00:34
Average standard deviation of split frequencies: 0.012882
410500 -- (-373.216) [-372.160] (-374.412) (-377.551) * (-375.108) [-373.797] (-374.955) (-372.168) -- 0:00:34
411000 -- (-372.192) [-375.437] (-377.964) (-376.142) * (-371.895) [-373.145] (-373.631) (-371.877) -- 0:00:34
411500 -- (-375.609) [-372.521] (-371.824) (-376.056) * [-371.682] (-377.741) (-374.605) (-375.253) -- 0:00:34
412000 -- [-376.783] (-373.508) (-377.573) (-373.062) * [-371.489] (-376.398) (-375.245) (-372.567) -- 0:00:34
412500 -- (-375.838) (-373.409) (-376.229) [-372.263] * (-373.734) (-374.128) (-372.880) [-372.072] -- 0:00:34
413000 -- (-371.868) (-372.654) (-373.577) [-372.057] * (-372.235) [-373.097] (-373.225) (-372.273) -- 0:00:34
413500 -- [-374.498] (-372.747) (-376.534) (-372.371) * (-373.163) (-372.213) [-373.836] (-377.040) -- 0:00:34
414000 -- (-373.937) (-373.240) (-371.763) [-373.621] * [-372.430] (-372.108) (-371.677) (-372.275) -- 0:00:33
414500 -- [-374.261] (-376.555) (-374.382) (-374.770) * (-375.007) (-377.376) [-372.686] (-371.974) -- 0:00:35
415000 -- (-373.370) (-375.023) (-376.007) [-371.984] * (-372.924) [-371.951] (-374.211) (-374.734) -- 0:00:35
Average standard deviation of split frequencies: 0.012906
415500 -- (-373.514) (-374.282) [-374.909] (-373.419) * (-373.317) (-380.311) [-372.395] (-374.961) -- 0:00:35
416000 -- (-374.400) [-373.478] (-375.072) (-375.580) * (-372.493) [-375.761] (-377.392) (-373.816) -- 0:00:35
416500 -- (-372.087) [-372.477] (-376.082) (-371.906) * [-374.337] (-375.289) (-371.728) (-371.863) -- 0:00:35
417000 -- (-371.564) [-374.314] (-373.981) (-372.060) * (-376.463) (-373.457) [-376.959] (-373.872) -- 0:00:34
417500 -- (-372.817) (-373.378) [-372.477] (-375.001) * (-375.398) [-374.899] (-378.438) (-375.145) -- 0:00:34
418000 -- (-372.287) (-371.734) (-374.509) [-371.493] * (-373.188) [-373.377] (-378.298) (-373.479) -- 0:00:34
418500 -- (-373.230) (-371.525) [-372.795] (-373.247) * (-372.332) [-374.301] (-377.540) (-376.630) -- 0:00:34
419000 -- (-372.929) [-373.978] (-372.551) (-371.170) * (-373.250) [-375.068] (-375.745) (-375.056) -- 0:00:34
419500 -- (-374.301) [-372.758] (-373.201) (-373.295) * (-374.681) (-374.626) [-371.743] (-372.502) -- 0:00:34
420000 -- (-373.066) (-374.773) (-373.199) [-373.383] * (-372.911) (-372.924) (-373.505) [-373.613] -- 0:00:34
Average standard deviation of split frequencies: 0.015029
420500 -- (-374.011) [-376.344] (-373.691) (-374.223) * (-371.703) (-373.713) [-371.576] (-373.635) -- 0:00:34
421000 -- (-372.787) [-373.927] (-373.154) (-374.481) * [-372.013] (-371.568) (-374.951) (-373.703) -- 0:00:34
421500 -- (-372.896) (-373.048) [-374.075] (-372.780) * (-371.808) [-374.487] (-374.605) (-373.928) -- 0:00:34
422000 -- [-371.692] (-373.429) (-373.167) (-373.211) * (-372.406) (-377.023) [-372.778] (-379.036) -- 0:00:34
422500 -- (-372.988) [-375.469] (-373.019) (-375.557) * (-375.798) [-372.411] (-373.620) (-373.493) -- 0:00:34
423000 -- (-373.171) (-377.848) (-375.103) [-373.907] * (-372.217) (-372.623) (-373.927) [-373.419] -- 0:00:34
423500 -- (-372.134) (-374.513) [-372.198] (-375.239) * (-372.554) (-376.263) (-374.854) [-371.483] -- 0:00:34
424000 -- [-372.268] (-380.064) (-374.319) (-374.629) * (-372.232) (-371.952) [-371.725] (-373.104) -- 0:00:33
424500 -- (-376.654) [-373.764] (-374.614) (-374.837) * (-373.603) (-379.190) [-376.182] (-373.236) -- 0:00:33
425000 -- (-373.006) (-373.809) (-373.377) [-373.561] * (-371.641) (-381.491) (-376.298) [-373.045] -- 0:00:33
Average standard deviation of split frequencies: 0.014631
425500 -- (-372.798) (-375.275) [-375.417] (-373.259) * [-371.539] (-374.873) (-379.046) (-374.245) -- 0:00:33
426000 -- (-373.886) (-377.430) (-373.307) [-374.135] * (-375.047) (-372.078) [-377.261] (-374.309) -- 0:00:33
426500 -- (-371.334) [-372.517] (-374.665) (-373.228) * (-371.439) [-373.285] (-374.944) (-371.913) -- 0:00:33
427000 -- (-371.298) [-371.639] (-372.877) (-374.204) * (-371.548) [-372.378] (-375.317) (-372.102) -- 0:00:33
427500 -- (-371.826) (-374.527) [-374.108] (-376.043) * [-374.713] (-372.829) (-375.942) (-373.343) -- 0:00:33
428000 -- (-373.277) (-372.984) [-372.752] (-375.967) * (-375.468) [-373.692] (-373.440) (-374.991) -- 0:00:33
428500 -- [-372.768] (-376.245) (-374.293) (-372.621) * (-371.977) (-377.456) [-374.682] (-374.282) -- 0:00:33
429000 -- (-374.034) (-372.690) (-374.305) [-373.404] * (-372.204) [-371.898] (-376.899) (-375.459) -- 0:00:33
429500 -- (-372.556) (-374.022) (-373.270) [-372.500] * [-372.089] (-373.583) (-373.735) (-372.415) -- 0:00:33
430000 -- [-372.405] (-373.707) (-377.874) (-374.128) * [-374.805] (-372.732) (-375.222) (-372.261) -- 0:00:33
Average standard deviation of split frequencies: 0.014294
430500 -- (-373.248) (-379.909) (-373.659) [-376.035] * [-372.914] (-372.964) (-374.960) (-372.243) -- 0:00:33
431000 -- (-372.815) (-373.840) (-373.197) [-372.060] * (-373.031) (-373.495) [-378.794] (-372.250) -- 0:00:34
431500 -- [-374.263] (-374.777) (-372.437) (-379.676) * (-372.286) (-372.494) (-374.214) [-372.852] -- 0:00:34
432000 -- (-389.774) [-375.395] (-374.522) (-373.952) * [-375.075] (-372.793) (-372.429) (-374.022) -- 0:00:34
432500 -- (-373.321) (-373.738) [-374.700] (-373.825) * (-375.848) (-372.344) [-373.121] (-372.674) -- 0:00:34
433000 -- (-377.571) [-372.133] (-373.350) (-373.897) * (-372.067) (-373.547) (-373.858) [-372.827] -- 0:00:34
433500 -- (-371.485) (-374.575) [-371.211] (-373.271) * (-371.503) (-375.334) [-372.825] (-373.211) -- 0:00:33
434000 -- [-374.227] (-377.226) (-373.049) (-371.942) * [-371.787] (-377.713) (-371.404) (-372.914) -- 0:00:33
434500 -- (-373.507) (-373.180) (-373.246) [-374.286] * (-371.553) (-375.901) (-373.599) [-373.519] -- 0:00:33
435000 -- (-375.032) [-374.510] (-373.257) (-375.990) * (-371.553) (-379.701) (-374.306) [-374.597] -- 0:00:33
Average standard deviation of split frequencies: 0.013996
435500 -- [-371.549] (-374.953) (-373.891) (-375.415) * (-371.679) (-374.602) (-373.191) [-374.412] -- 0:00:33
436000 -- (-371.949) (-374.269) [-373.509] (-373.346) * [-372.018] (-373.129) (-371.918) (-374.129) -- 0:00:33
436500 -- (-375.845) (-375.519) (-374.101) [-373.765] * [-372.331] (-373.620) (-372.909) (-376.878) -- 0:00:33
437000 -- (-375.526) (-376.895) (-372.275) [-375.030] * [-372.632] (-373.603) (-373.193) (-375.525) -- 0:00:33
437500 -- (-372.866) [-374.243] (-376.340) (-372.623) * [-376.644] (-373.541) (-378.978) (-374.019) -- 0:00:33
438000 -- (-372.937) (-372.521) [-372.225] (-374.448) * (-371.422) [-376.991] (-373.656) (-373.019) -- 0:00:33
438500 -- (-375.310) [-375.671] (-371.391) (-374.045) * [-374.651] (-376.577) (-373.365) (-371.780) -- 0:00:33
439000 -- (-372.949) (-374.078) (-371.506) [-374.804] * (-373.658) [-374.381] (-372.764) (-371.593) -- 0:00:33
439500 -- [-371.811] (-371.992) (-373.761) (-371.688) * (-372.927) (-374.108) [-374.549] (-372.193) -- 0:00:33
440000 -- [-371.876] (-373.247) (-372.684) (-373.975) * [-374.111] (-375.278) (-372.892) (-371.610) -- 0:00:33
Average standard deviation of split frequencies: 0.013844
440500 -- (-374.241) (-376.268) [-372.792] (-375.003) * (-373.353) (-373.449) (-373.866) [-373.025] -- 0:00:33
441000 -- (-373.270) [-376.120] (-372.727) (-377.077) * (-376.594) (-372.834) (-374.970) [-372.845] -- 0:00:32
441500 -- (-372.354) (-375.376) [-373.513] (-374.203) * (-372.673) (-372.626) [-376.547] (-372.533) -- 0:00:32
442000 -- (-372.685) (-375.579) (-372.600) [-375.319] * [-376.334] (-374.112) (-378.068) (-372.123) -- 0:00:32
442500 -- (-373.232) (-374.110) (-373.419) [-373.439] * (-375.806) (-375.928) [-380.388] (-373.714) -- 0:00:32
443000 -- (-373.058) (-374.779) [-372.634] (-375.831) * (-372.860) [-373.841] (-375.013) (-372.625) -- 0:00:32
443500 -- (-376.810) [-372.797] (-373.784) (-374.499) * (-374.403) (-371.329) (-371.475) [-373.307] -- 0:00:32
444000 -- (-375.266) (-372.122) [-375.325] (-374.066) * (-374.156) [-374.150] (-372.365) (-375.740) -- 0:00:32
444500 -- (-373.623) (-375.374) [-372.896] (-374.628) * (-376.949) [-373.333] (-373.775) (-378.494) -- 0:00:32
445000 -- (-376.522) (-372.709) (-375.433) [-374.915] * (-373.255) (-376.503) [-373.874] (-373.195) -- 0:00:32
Average standard deviation of split frequencies: 0.013927
445500 -- [-371.595] (-375.936) (-373.466) (-373.118) * (-373.921) [-376.183] (-371.969) (-373.300) -- 0:00:32
446000 -- (-376.593) (-373.680) (-373.114) [-373.928] * (-372.517) (-372.348) [-374.337] (-376.120) -- 0:00:32
446500 -- [-373.236] (-373.294) (-375.075) (-375.216) * (-371.540) (-373.822) (-374.431) [-372.706] -- 0:00:32
447000 -- (-373.510) (-373.156) [-373.383] (-374.618) * (-373.534) (-374.196) [-373.092] (-375.020) -- 0:00:32
447500 -- (-376.066) (-373.348) [-372.715] (-375.428) * [-374.952] (-374.966) (-373.993) (-371.417) -- 0:00:32
448000 -- (-373.368) (-377.979) [-372.804] (-372.808) * (-377.151) (-373.738) (-382.558) [-372.254] -- 0:00:33
448500 -- (-377.521) [-373.989] (-375.602) (-373.550) * (-373.261) (-376.437) (-376.476) [-371.764] -- 0:00:33
449000 -- (-374.397) [-372.596] (-373.939) (-373.053) * (-371.913) (-373.424) [-374.201] (-382.022) -- 0:00:33
449500 -- (-373.344) (-373.311) [-374.371] (-378.301) * (-372.685) (-374.113) (-373.152) [-374.635] -- 0:00:33
450000 -- (-372.437) (-379.287) [-374.894] (-375.512) * [-372.485] (-375.730) (-372.247) (-373.400) -- 0:00:33
Average standard deviation of split frequencies: 0.014237
450500 -- (-373.048) (-377.924) (-373.304) [-376.761] * (-374.664) (-377.264) [-373.494] (-372.161) -- 0:00:32
451000 -- (-376.074) [-371.849] (-373.915) (-373.614) * [-372.623] (-373.492) (-372.199) (-374.954) -- 0:00:32
451500 -- [-372.845] (-373.264) (-374.862) (-373.478) * (-372.400) [-375.019] (-373.531) (-373.190) -- 0:00:32
452000 -- (-372.727) (-377.303) (-375.293) [-372.919] * (-375.256) [-372.993] (-374.772) (-374.681) -- 0:00:32
452500 -- (-373.814) [-372.189] (-372.981) (-374.080) * (-375.109) [-371.905] (-372.391) (-375.038) -- 0:00:32
453000 -- [-373.414] (-374.166) (-372.629) (-376.772) * (-373.709) (-372.396) (-375.221) [-372.513] -- 0:00:32
453500 -- (-372.664) (-376.934) (-371.694) [-371.583] * (-372.766) (-374.188) [-371.952] (-373.979) -- 0:00:32
454000 -- [-373.726] (-375.429) (-376.533) (-373.799) * (-374.958) (-373.986) (-372.117) [-373.427] -- 0:00:32
454500 -- (-374.974) (-375.074) [-373.891] (-378.913) * (-372.846) (-376.257) [-375.394] (-372.700) -- 0:00:32
455000 -- [-372.170] (-374.647) (-373.765) (-375.676) * (-373.003) (-372.912) [-373.752] (-372.573) -- 0:00:32
Average standard deviation of split frequencies: 0.013899
455500 -- [-372.815] (-375.223) (-373.223) (-373.498) * (-374.002) (-373.380) (-372.680) [-374.105] -- 0:00:32
456000 -- [-371.785] (-373.015) (-375.642) (-373.666) * [-373.248] (-374.203) (-371.703) (-375.907) -- 0:00:32
456500 -- [-374.191] (-374.589) (-379.817) (-376.332) * (-371.509) (-373.677) (-372.736) [-373.312] -- 0:00:32
457000 -- (-375.389) [-374.865] (-372.914) (-375.299) * (-374.880) [-372.826] (-375.559) (-373.196) -- 0:00:32
457500 -- [-372.546] (-373.829) (-374.075) (-373.733) * (-373.797) (-374.061) [-373.144] (-372.866) -- 0:00:32
458000 -- (-373.358) (-373.771) [-374.400] (-372.832) * (-374.590) (-374.958) [-373.728] (-374.534) -- 0:00:31
458500 -- (-373.784) (-376.331) [-373.173] (-374.170) * (-372.347) (-374.987) [-373.235] (-372.179) -- 0:00:31
459000 -- (-372.424) (-375.303) (-375.305) [-373.242] * [-374.691] (-372.391) (-376.168) (-375.386) -- 0:00:31
459500 -- [-373.328] (-373.491) (-372.498) (-372.051) * (-379.452) (-373.375) [-373.754] (-371.864) -- 0:00:31
460000 -- (-373.636) (-374.181) (-380.174) [-373.889] * (-373.475) [-371.582] (-372.174) (-372.546) -- 0:00:31
Average standard deviation of split frequencies: 0.013644
460500 -- (-374.638) (-375.485) [-378.073] (-374.440) * [-372.452] (-374.439) (-373.553) (-371.434) -- 0:00:31
461000 -- (-374.891) (-375.369) (-373.955) [-371.659] * (-374.442) [-374.454] (-375.250) (-373.164) -- 0:00:31
461500 -- (-372.718) [-374.210] (-371.764) (-376.558) * (-372.597) (-371.467) [-372.591] (-371.569) -- 0:00:31
462000 -- (-372.418) [-373.371] (-371.346) (-375.808) * (-371.346) (-374.329) (-374.258) [-372.300] -- 0:00:31
462500 -- (-371.983) (-375.761) [-371.974] (-377.486) * (-375.224) (-381.512) [-374.153] (-373.501) -- 0:00:31
463000 -- (-372.141) (-375.496) [-371.786] (-372.814) * (-373.914) (-375.678) [-374.035] (-373.732) -- 0:00:31
463500 -- [-372.270] (-374.095) (-373.701) (-374.856) * (-374.045) (-375.441) (-372.997) [-374.241] -- 0:00:31
464000 -- (-376.253) [-372.745] (-373.945) (-373.007) * [-373.259] (-372.488) (-374.295) (-374.987) -- 0:00:31
464500 -- (-375.103) [-372.082] (-375.159) (-375.821) * (-371.757) [-372.490] (-372.283) (-376.333) -- 0:00:31
465000 -- (-374.722) (-372.189) (-373.309) [-377.570] * (-373.119) [-372.185] (-374.094) (-373.162) -- 0:00:32
Average standard deviation of split frequencies: 0.013544
465500 -- (-375.215) [-376.569] (-372.485) (-377.455) * [-373.575] (-372.356) (-372.573) (-372.187) -- 0:00:32
466000 -- (-372.701) (-374.443) (-373.328) [-372.595] * (-375.317) (-371.748) (-374.508) [-373.287] -- 0:00:32
466500 -- (-374.675) (-374.345) (-371.803) [-371.856] * [-373.803] (-376.441) (-373.983) (-375.477) -- 0:00:32
467000 -- (-377.162) (-375.549) [-371.340] (-377.817) * [-374.682] (-374.320) (-373.219) (-374.594) -- 0:00:31
467500 -- [-374.072] (-373.998) (-374.630) (-377.037) * [-371.981] (-375.639) (-374.606) (-375.967) -- 0:00:31
468000 -- (-374.533) [-373.235] (-373.045) (-373.577) * (-374.574) (-379.246) [-376.819] (-375.391) -- 0:00:31
468500 -- [-374.536] (-373.812) (-379.326) (-372.548) * (-373.964) (-373.461) [-375.044] (-376.214) -- 0:00:31
469000 -- (-376.907) [-372.451] (-373.750) (-372.904) * (-374.169) (-372.480) [-375.449] (-374.356) -- 0:00:31
469500 -- (-374.578) (-372.955) (-373.767) [-373.992] * (-373.829) (-371.827) (-376.926) [-372.669] -- 0:00:31
470000 -- (-374.777) (-379.412) (-373.136) [-373.642] * (-373.054) (-372.029) [-371.790] (-372.231) -- 0:00:31
Average standard deviation of split frequencies: 0.013243
470500 -- [-375.820] (-372.429) (-372.292) (-373.334) * (-373.424) [-372.402] (-373.446) (-372.261) -- 0:00:31
471000 -- (-372.408) [-372.399] (-374.502) (-372.996) * (-374.455) [-373.661] (-373.163) (-372.538) -- 0:00:31
471500 -- [-372.436] (-375.203) (-376.408) (-372.704) * (-375.384) (-378.416) [-374.098] (-373.885) -- 0:00:31
472000 -- [-375.224] (-373.615) (-376.520) (-371.841) * [-372.449] (-375.156) (-371.516) (-377.819) -- 0:00:31
472500 -- (-374.561) (-377.581) (-376.004) [-371.666] * (-372.987) (-373.453) (-373.850) [-376.990] -- 0:00:31
473000 -- (-372.443) (-373.481) (-371.425) [-372.697] * (-373.753) (-372.265) [-378.364] (-372.319) -- 0:00:31
473500 -- [-373.490] (-375.847) (-372.826) (-374.274) * (-371.771) (-372.154) (-374.037) [-373.295] -- 0:00:31
474000 -- (-374.603) (-374.542) [-374.273] (-374.488) * [-371.655] (-375.318) (-372.626) (-371.674) -- 0:00:31
474500 -- (-372.872) [-374.036] (-372.087) (-373.266) * (-373.435) (-378.110) (-378.498) [-374.009] -- 0:00:31
475000 -- (-374.512) (-377.038) [-372.987] (-372.892) * (-372.518) (-377.203) (-373.060) [-374.945] -- 0:00:30
Average standard deviation of split frequencies: 0.013049
475500 -- [-374.839] (-373.654) (-374.542) (-376.293) * (-373.785) (-375.126) (-371.560) [-372.933] -- 0:00:30
476000 -- (-373.494) (-372.970) (-372.832) [-373.432] * (-372.691) (-372.017) (-373.049) [-372.354] -- 0:00:30
476500 -- (-374.341) [-375.319] (-371.968) (-372.325) * (-374.874) (-375.439) [-372.078] (-371.896) -- 0:00:30
477000 -- [-373.447] (-373.683) (-376.290) (-372.839) * (-373.297) [-372.286] (-374.063) (-375.916) -- 0:00:30
477500 -- (-374.935) [-371.831] (-374.563) (-371.771) * (-377.025) (-373.527) [-377.512] (-372.116) -- 0:00:30
478000 -- (-372.538) [-373.149] (-373.220) (-372.213) * (-374.169) (-374.094) (-372.615) [-373.482] -- 0:00:30
478500 -- (-373.291) (-372.545) [-373.740] (-373.095) * (-373.321) (-374.610) [-373.580] (-373.918) -- 0:00:30
479000 -- (-373.474) (-374.316) (-375.078) [-376.427] * (-371.974) (-372.684) (-374.197) [-372.567] -- 0:00:31
479500 -- (-372.250) (-371.706) [-372.961] (-373.190) * (-373.652) [-375.429] (-372.879) (-373.833) -- 0:00:31
480000 -- (-372.732) (-373.091) (-374.933) [-372.787] * (-372.134) [-373.272] (-371.742) (-371.899) -- 0:00:31
Average standard deviation of split frequencies: 0.013557
480500 -- (-376.264) (-373.903) (-377.920) [-372.543] * (-374.652) (-373.037) [-373.936] (-373.606) -- 0:00:31
481000 -- [-371.824] (-372.232) (-376.579) (-373.470) * (-375.758) (-372.216) (-374.375) [-373.297] -- 0:00:31
481500 -- (-372.068) (-375.583) (-377.777) [-379.748] * (-375.021) [-372.013] (-374.217) (-373.805) -- 0:00:31
482000 -- (-373.216) [-377.715] (-376.232) (-375.836) * (-374.495) (-373.297) [-375.887] (-373.604) -- 0:00:31
482500 -- [-372.844] (-373.283) (-372.225) (-374.152) * (-372.664) (-372.657) [-375.503] (-377.727) -- 0:00:31
483000 -- (-375.781) (-374.435) [-372.353] (-372.257) * (-374.292) [-372.468] (-375.304) (-373.654) -- 0:00:31
483500 -- (-374.127) [-373.848] (-374.320) (-372.626) * (-374.595) (-372.644) (-373.241) [-371.871] -- 0:00:30
484000 -- (-373.666) [-375.220] (-375.180) (-374.141) * [-372.423] (-374.709) (-374.573) (-374.137) -- 0:00:30
484500 -- (-374.695) (-377.559) [-377.140] (-374.318) * [-372.061] (-372.711) (-374.033) (-376.993) -- 0:00:30
485000 -- (-375.810) (-375.830) [-371.901] (-374.846) * (-376.193) (-372.092) [-375.648] (-374.023) -- 0:00:30
Average standard deviation of split frequencies: 0.013202
485500 -- (-372.384) (-375.475) [-373.139] (-374.731) * [-372.583] (-373.663) (-371.783) (-375.863) -- 0:00:30
486000 -- [-374.389] (-372.305) (-373.219) (-373.405) * (-372.513) [-373.720] (-378.312) (-375.598) -- 0:00:30
486500 -- [-371.533] (-374.594) (-372.888) (-373.066) * (-374.659) (-373.435) [-377.234] (-372.464) -- 0:00:30
487000 -- (-376.788) (-375.196) [-372.569] (-374.702) * (-372.411) (-372.823) (-375.327) [-372.311] -- 0:00:30
487500 -- (-374.663) (-374.132) [-372.571] (-373.880) * (-380.827) (-372.177) (-376.952) [-372.307] -- 0:00:30
488000 -- (-373.372) [-374.739] (-372.556) (-374.017) * (-375.175) (-372.847) (-374.161) [-372.857] -- 0:00:30
488500 -- (-372.907) [-375.414] (-373.057) (-375.388) * [-373.805] (-372.908) (-375.442) (-373.104) -- 0:00:30
489000 -- [-373.610] (-374.297) (-371.321) (-376.906) * (-373.956) (-371.708) (-374.002) [-372.968] -- 0:00:30
489500 -- (-376.152) (-372.683) (-374.691) [-375.434] * [-371.769] (-371.433) (-375.313) (-375.028) -- 0:00:30
490000 -- (-372.174) [-372.895] (-373.182) (-374.379) * (-373.648) [-375.093] (-378.185) (-374.698) -- 0:00:30
Average standard deviation of split frequencies: 0.012772
490500 -- (-372.026) (-373.104) (-372.360) [-372.553] * (-374.306) (-375.535) [-372.402] (-377.085) -- 0:00:30
491000 -- (-373.401) (-377.173) (-371.859) [-371.975] * (-378.870) [-374.044] (-375.225) (-376.006) -- 0:00:30
491500 -- (-372.560) (-374.011) (-374.095) [-372.162] * (-377.329) [-375.280] (-372.364) (-372.555) -- 0:00:30
492000 -- (-373.306) (-381.162) (-372.947) [-375.181] * (-376.212) (-376.219) (-372.697) [-371.720] -- 0:00:29
492500 -- [-373.157] (-380.280) (-371.766) (-379.009) * (-373.724) (-378.163) (-375.759) [-376.591] -- 0:00:29
493000 -- [-373.624] (-378.716) (-373.950) (-373.180) * (-372.356) (-371.963) (-374.266) [-373.090] -- 0:00:29
493500 -- (-372.793) (-371.831) (-375.364) [-373.453] * (-372.689) [-371.252] (-374.467) (-373.157) -- 0:00:29
494000 -- (-373.613) [-372.253] (-374.667) (-372.324) * [-373.577] (-375.034) (-373.325) (-375.453) -- 0:00:29
494500 -- (-375.953) [-373.217] (-372.465) (-373.585) * (-373.721) (-376.182) [-372.133] (-376.009) -- 0:00:30
495000 -- (-377.294) (-375.513) (-375.511) [-373.418] * (-375.948) [-373.122] (-373.109) (-377.261) -- 0:00:30
Average standard deviation of split frequencies: 0.012132
495500 -- [-371.504] (-375.237) (-371.723) (-374.368) * (-374.643) [-373.112] (-374.175) (-372.561) -- 0:00:30
496000 -- (-373.059) [-374.085] (-372.295) (-371.707) * (-375.903) (-371.991) [-372.534] (-372.291) -- 0:00:30
496500 -- [-374.700] (-375.501) (-373.846) (-374.526) * (-374.403) (-372.389) (-372.697) [-373.146] -- 0:00:30
497000 -- [-372.993] (-373.167) (-377.012) (-373.271) * (-372.846) [-374.140] (-372.356) (-372.763) -- 0:00:30
497500 -- (-372.469) [-375.295] (-375.950) (-374.156) * (-376.038) (-372.168) (-374.997) [-371.587] -- 0:00:30
498000 -- (-374.195) (-376.965) [-373.860] (-380.115) * (-372.995) [-371.815] (-372.772) (-371.431) -- 0:00:30
498500 -- (-373.261) [-373.166] (-375.932) (-376.468) * (-374.047) (-373.835) (-374.935) [-373.366] -- 0:00:30
499000 -- (-372.278) (-373.262) (-372.874) [-373.749] * [-371.826] (-378.936) (-372.188) (-379.799) -- 0:00:30
499500 -- (-374.583) [-371.852] (-375.207) (-375.751) * (-372.348) [-373.064] (-371.948) (-376.345) -- 0:00:30
500000 -- (-373.093) (-373.275) [-372.055] (-374.178) * (-371.490) (-372.055) [-372.932] (-379.322) -- 0:00:30
Average standard deviation of split frequencies: 0.012064
500500 -- (-372.314) (-375.096) [-371.598] (-373.083) * (-372.827) (-372.676) (-373.396) [-374.031] -- 0:00:29
501000 -- (-375.801) (-380.351) [-373.446] (-372.112) * (-375.992) (-376.166) (-374.403) [-377.949] -- 0:00:29
501500 -- (-372.307) (-376.223) [-371.549] (-377.667) * (-374.163) [-373.580] (-373.312) (-375.360) -- 0:00:29
502000 -- (-372.101) (-372.922) (-373.322) [-376.047] * [-376.674] (-372.147) (-373.427) (-377.324) -- 0:00:29
502500 -- (-373.352) (-371.849) (-376.271) [-371.891] * [-373.450] (-373.921) (-374.402) (-375.326) -- 0:00:29
503000 -- (-374.444) (-377.758) (-375.903) [-372.938] * (-372.787) (-374.216) (-372.477) [-377.111] -- 0:00:29
503500 -- (-372.142) [-372.390] (-373.864) (-374.313) * (-373.649) (-375.202) (-374.003) [-374.419] -- 0:00:29
504000 -- [-374.192] (-373.186) (-376.732) (-371.860) * (-372.531) (-374.421) (-374.414) [-374.141] -- 0:00:29
504500 -- (-375.687) [-371.588] (-373.103) (-372.481) * (-372.950) (-374.046) [-371.661] (-377.847) -- 0:00:29
505000 -- (-381.203) (-374.709) [-373.160] (-372.615) * (-373.078) [-375.923] (-375.913) (-375.769) -- 0:00:29
Average standard deviation of split frequencies: 0.012495
505500 -- (-372.503) (-374.371) (-375.978) [-376.491] * (-376.540) (-373.530) [-374.185] (-375.705) -- 0:00:29
506000 -- [-372.144] (-373.537) (-374.681) (-376.331) * (-371.799) [-373.930] (-377.833) (-373.746) -- 0:00:29
506500 -- (-373.598) (-372.755) (-373.339) [-373.596] * (-373.637) [-373.329] (-375.811) (-374.762) -- 0:00:29
507000 -- (-374.313) (-372.047) (-372.009) [-376.035] * (-375.470) (-374.246) (-375.651) [-372.011] -- 0:00:29
507500 -- [-374.066] (-371.692) (-373.134) (-374.134) * (-375.070) [-371.715] (-372.601) (-372.740) -- 0:00:29
508000 -- (-373.317) (-371.683) [-375.896] (-372.808) * (-375.528) (-375.381) [-374.232] (-374.204) -- 0:00:29
508500 -- (-371.879) (-376.217) (-372.242) [-375.432] * (-375.825) (-382.081) [-372.341] (-372.722) -- 0:00:28
509000 -- [-372.319] (-375.653) (-380.795) (-373.992) * [-371.783] (-381.593) (-373.051) (-374.104) -- 0:00:28
509500 -- (-374.637) (-378.423) (-374.007) [-376.437] * [-372.572] (-377.029) (-371.478) (-373.203) -- 0:00:28
510000 -- (-371.911) (-372.467) (-372.842) [-375.073] * (-372.394) (-372.735) (-372.645) [-372.448] -- 0:00:28
Average standard deviation of split frequencies: 0.012381
510500 -- [-374.231] (-372.370) (-374.684) (-373.806) * (-374.907) (-384.414) (-375.010) [-371.693] -- 0:00:28
511000 -- (-375.890) (-371.373) [-374.650] (-372.652) * (-376.615) (-374.300) [-374.094] (-372.142) -- 0:00:28
511500 -- (-374.033) (-375.222) (-373.119) [-375.098] * (-372.330) [-372.380] (-372.944) (-378.041) -- 0:00:29
512000 -- [-375.431] (-372.346) (-372.577) (-372.851) * (-372.766) (-372.475) (-374.684) [-379.996] -- 0:00:29
512500 -- (-374.097) [-374.201] (-372.586) (-373.274) * (-375.366) (-372.760) [-374.174] (-376.537) -- 0:00:29
513000 -- [-372.879] (-375.877) (-373.326) (-372.456) * [-374.138] (-371.608) (-376.889) (-374.093) -- 0:00:29
513500 -- (-371.327) [-374.475] (-374.833) (-375.439) * [-371.923] (-376.810) (-373.314) (-374.438) -- 0:00:29
514000 -- [-371.263] (-373.026) (-375.181) (-375.085) * (-371.578) (-375.054) [-378.786] (-373.559) -- 0:00:29
514500 -- [-373.422] (-372.237) (-372.055) (-383.039) * (-372.159) [-374.302] (-377.244) (-372.111) -- 0:00:29
515000 -- [-372.025] (-375.514) (-374.321) (-378.585) * (-372.281) (-377.353) [-373.741] (-375.424) -- 0:00:29
Average standard deviation of split frequencies: 0.012790
515500 -- (-375.092) (-372.688) [-373.142] (-373.971) * (-372.807) (-375.452) [-372.449] (-374.341) -- 0:00:29
516000 -- (-375.928) (-373.646) [-372.297] (-374.597) * [-377.206] (-373.910) (-374.792) (-376.526) -- 0:00:29
516500 -- (-372.638) (-373.655) (-374.553) [-371.551] * (-373.391) (-373.457) [-373.337] (-374.747) -- 0:00:29
517000 -- [-373.689] (-376.712) (-373.029) (-372.867) * (-374.766) (-372.434) [-373.280] (-373.977) -- 0:00:28
517500 -- (-372.140) (-374.607) [-374.270] (-371.713) * (-372.935) (-372.864) (-373.204) [-374.626] -- 0:00:28
518000 -- (-373.146) [-373.851] (-373.459) (-371.961) * (-374.286) (-372.606) (-374.082) [-372.540] -- 0:00:28
518500 -- (-375.579) (-375.245) (-374.192) [-372.288] * [-374.675] (-374.944) (-376.668) (-375.958) -- 0:00:28
519000 -- (-373.167) (-375.575) (-377.739) [-373.063] * (-371.767) (-372.845) [-371.605] (-371.516) -- 0:00:28
519500 -- (-373.203) (-373.713) (-374.894) [-371.903] * (-372.307) [-372.692] (-371.937) (-372.745) -- 0:00:28
520000 -- [-377.698] (-372.158) (-374.779) (-374.556) * (-373.792) (-375.034) [-371.967] (-376.665) -- 0:00:28
Average standard deviation of split frequencies: 0.012729
520500 -- (-375.184) (-373.600) [-375.283] (-372.789) * (-372.428) [-372.054] (-373.099) (-374.806) -- 0:00:28
521000 -- (-375.537) [-371.990] (-379.025) (-374.338) * (-371.801) [-374.083] (-375.111) (-375.027) -- 0:00:28
521500 -- (-375.972) [-372.884] (-374.330) (-372.902) * [-372.099] (-376.696) (-377.446) (-377.402) -- 0:00:28
522000 -- [-373.636] (-371.448) (-377.523) (-372.500) * (-373.400) [-372.044] (-372.055) (-386.963) -- 0:00:28
522500 -- (-374.690) (-371.445) (-372.393) [-375.823] * (-375.980) (-372.294) (-374.020) [-380.985] -- 0:00:28
523000 -- (-373.949) (-372.767) (-371.938) [-372.937] * (-373.137) [-372.716] (-374.793) (-376.437) -- 0:00:28
523500 -- (-373.875) (-374.366) (-375.530) [-372.021] * (-373.060) (-372.958) [-374.412] (-377.211) -- 0:00:28
524000 -- (-375.295) (-374.465) (-378.425) [-371.985] * [-377.995] (-373.523) (-375.778) (-376.491) -- 0:00:28
524500 -- [-373.721] (-373.396) (-373.841) (-372.463) * (-376.716) (-371.856) (-371.981) [-373.182] -- 0:00:28
525000 -- (-372.681) (-374.185) [-373.621] (-371.780) * (-372.417) [-374.221] (-372.142) (-373.304) -- 0:00:28
Average standard deviation of split frequencies: 0.012336
525500 -- (-374.343) [-372.758] (-372.230) (-380.281) * (-375.167) (-372.990) (-372.409) [-373.679] -- 0:00:27
526000 -- (-373.491) (-373.117) [-372.341] (-380.773) * (-372.324) (-374.200) (-373.309) [-373.376] -- 0:00:27
526500 -- (-373.468) (-372.190) (-372.250) [-376.553] * (-374.358) (-374.949) [-372.280] (-376.743) -- 0:00:27
527000 -- [-372.332] (-373.821) (-375.249) (-373.487) * [-371.955] (-376.208) (-375.646) (-372.292) -- 0:00:27
527500 -- (-374.064) (-372.985) (-376.392) [-372.544] * (-373.143) (-373.573) [-372.882] (-374.197) -- 0:00:27
528000 -- (-372.018) [-378.901] (-373.721) (-375.487) * (-377.723) (-377.900) [-371.851] (-373.057) -- 0:00:27
528500 -- (-375.499) (-372.769) [-372.593] (-374.288) * (-372.286) [-375.247] (-372.435) (-371.535) -- 0:00:28
529000 -- (-380.576) (-373.551) [-371.634] (-372.901) * (-372.623) [-372.562] (-372.937) (-373.967) -- 0:00:28
529500 -- (-378.172) (-375.230) (-371.345) [-372.615] * (-373.815) (-374.858) [-373.454] (-374.642) -- 0:00:28
530000 -- (-373.670) (-374.206) [-374.235] (-374.389) * [-373.736] (-375.782) (-372.926) (-373.874) -- 0:00:28
Average standard deviation of split frequencies: 0.012437
530500 -- (-373.563) (-375.076) [-372.230] (-372.384) * (-378.065) [-371.938] (-375.294) (-372.413) -- 0:00:28
531000 -- (-372.769) (-374.024) [-372.848] (-373.367) * (-375.512) [-373.124] (-373.216) (-372.637) -- 0:00:28
531500 -- (-374.297) [-372.386] (-372.412) (-373.610) * (-374.713) (-372.488) [-373.968] (-380.119) -- 0:00:28
532000 -- (-373.474) (-375.597) [-376.062] (-373.298) * [-373.700] (-373.277) (-373.821) (-374.845) -- 0:00:28
532500 -- (-372.805) (-375.659) [-373.812] (-373.971) * (-377.059) (-372.614) (-374.061) [-373.868] -- 0:00:28
533000 -- [-371.599] (-375.149) (-372.606) (-375.455) * (-374.472) [-374.664] (-375.125) (-374.221) -- 0:00:28
533500 -- [-373.273] (-373.345) (-375.191) (-375.415) * (-376.064) (-374.825) [-375.208] (-371.819) -- 0:00:27
534000 -- [-372.777] (-374.576) (-378.316) (-374.271) * (-373.498) (-373.496) [-375.649] (-372.277) -- 0:00:27
534500 -- (-373.872) [-372.428] (-373.100) (-374.951) * [-372.959] (-371.965) (-376.103) (-376.553) -- 0:00:27
535000 -- (-371.511) [-371.548] (-374.465) (-374.499) * (-372.684) (-372.041) (-374.540) [-373.623] -- 0:00:27
Average standard deviation of split frequencies: 0.012571
535500 -- [-371.468] (-372.090) (-374.410) (-374.086) * (-376.024) [-373.008] (-372.020) (-373.600) -- 0:00:27
536000 -- (-373.047) (-374.274) [-375.788] (-371.589) * [-374.363] (-377.552) (-376.175) (-372.511) -- 0:00:27
536500 -- (-372.014) [-375.837] (-371.960) (-371.518) * (-375.928) (-374.483) (-372.106) [-373.094] -- 0:00:27
537000 -- (-373.324) (-373.887) (-374.130) [-371.624] * (-377.415) (-374.771) (-374.004) [-373.742] -- 0:00:27
537500 -- (-372.572) (-371.508) [-373.342] (-372.294) * (-374.307) (-373.241) (-377.122) [-375.231] -- 0:00:27
538000 -- [-373.856] (-371.222) (-376.410) (-372.792) * (-375.776) (-375.636) [-371.961] (-373.138) -- 0:00:27
538500 -- (-372.388) (-373.126) [-379.686] (-373.442) * [-376.810] (-375.313) (-374.500) (-373.160) -- 0:00:27
539000 -- (-375.058) [-371.870] (-373.838) (-374.476) * (-372.230) [-374.184] (-374.423) (-373.371) -- 0:00:27
539500 -- (-375.386) (-372.858) (-372.044) [-373.974] * (-373.014) [-375.124] (-375.235) (-371.998) -- 0:00:27
540000 -- (-375.027) (-378.290) [-372.507] (-372.388) * [-372.116] (-375.033) (-373.753) (-372.682) -- 0:00:27
Average standard deviation of split frequencies: 0.012479
540500 -- [-374.032] (-377.048) (-372.418) (-374.374) * (-378.350) (-375.037) (-373.580) [-373.291] -- 0:00:27
541000 -- (-372.029) (-375.665) (-372.417) [-372.189] * (-380.146) [-373.859] (-372.860) (-375.097) -- 0:00:27
541500 -- (-375.558) (-374.664) [-372.829] (-375.778) * [-373.962] (-373.747) (-372.196) (-372.420) -- 0:00:27
542000 -- (-375.314) (-376.262) [-372.046] (-373.306) * (-373.788) (-373.071) (-374.666) [-375.735] -- 0:00:27
542500 -- [-371.362] (-374.784) (-374.658) (-376.331) * (-374.222) (-372.306) [-374.907] (-374.046) -- 0:00:26
543000 -- [-373.822] (-375.235) (-372.501) (-372.690) * (-372.571) (-372.652) [-373.507] (-374.901) -- 0:00:26
543500 -- (-376.137) (-373.597) (-376.909) [-373.258] * (-372.526) [-375.002] (-372.430) (-374.431) -- 0:00:26
544000 -- (-375.111) (-373.584) [-375.639] (-374.740) * (-371.573) (-372.599) (-372.550) [-372.541] -- 0:00:26
544500 -- [-373.275] (-372.846) (-374.571) (-375.684) * (-377.182) (-372.108) (-374.749) [-373.778] -- 0:00:26
545000 -- (-373.538) (-374.876) [-372.668] (-375.083) * [-374.564] (-373.049) (-375.320) (-375.437) -- 0:00:26
Average standard deviation of split frequencies: 0.011884
545500 -- (-373.407) (-372.075) [-372.372] (-371.854) * (-372.197) [-374.648] (-376.046) (-371.408) -- 0:00:27
546000 -- (-373.661) (-372.993) (-374.421) [-372.255] * (-373.006) [-374.751] (-372.870) (-373.502) -- 0:00:27
546500 -- [-377.294] (-373.028) (-373.754) (-372.071) * (-376.605) (-376.048) [-373.938] (-372.248) -- 0:00:27
547000 -- [-373.861] (-374.478) (-372.942) (-373.192) * (-372.919) [-376.599] (-376.521) (-374.068) -- 0:00:27
547500 -- (-372.072) (-376.971) (-372.979) [-373.766] * (-374.246) (-371.984) (-372.631) [-375.684] -- 0:00:27
548000 -- [-372.292] (-379.016) (-374.075) (-372.155) * (-374.386) [-373.963] (-377.413) (-371.918) -- 0:00:27
548500 -- (-375.368) [-372.454] (-371.971) (-374.678) * (-374.259) (-372.639) (-376.281) [-371.834] -- 0:00:27
549000 -- [-376.479] (-373.597) (-372.851) (-371.838) * (-375.364) (-372.957) (-373.851) [-373.817] -- 0:00:27
549500 -- (-375.179) (-373.713) [-372.342] (-372.730) * (-374.534) (-373.493) (-373.287) [-373.712] -- 0:00:27
550000 -- [-377.315] (-375.165) (-375.598) (-374.108) * (-374.260) [-373.412] (-375.304) (-373.815) -- 0:00:27
Average standard deviation of split frequencies: 0.011632
550500 -- [-377.709] (-372.632) (-374.072) (-376.707) * (-373.653) [-373.362] (-374.513) (-373.446) -- 0:00:26
551000 -- (-375.409) (-372.989) [-372.471] (-376.044) * (-376.251) (-372.190) [-373.644] (-373.525) -- 0:00:26
551500 -- [-377.519] (-372.416) (-375.401) (-378.316) * (-374.471) (-372.146) (-373.968) [-372.266] -- 0:00:26
552000 -- (-376.358) [-373.245] (-373.600) (-374.962) * (-374.689) [-371.931] (-373.735) (-377.519) -- 0:00:26
552500 -- (-372.527) (-373.968) [-374.428] (-372.857) * (-373.388) (-372.867) (-373.193) [-372.057] -- 0:00:26
553000 -- (-374.324) (-374.472) (-374.676) [-372.313] * (-372.670) (-371.728) (-372.813) [-373.259] -- 0:00:26
553500 -- (-371.947) (-374.553) (-383.932) [-372.195] * (-373.200) [-375.836] (-375.847) (-373.838) -- 0:00:26
554000 -- (-373.750) [-372.441] (-380.957) (-372.356) * (-371.909) (-375.686) [-374.742] (-372.918) -- 0:00:26
554500 -- (-372.003) (-372.917) (-372.447) [-371.790] * (-371.646) [-374.669] (-372.115) (-376.874) -- 0:00:26
555000 -- (-372.132) (-372.622) [-374.512] (-375.258) * (-373.280) (-375.502) (-372.662) [-376.727] -- 0:00:26
Average standard deviation of split frequencies: 0.011870
555500 -- (-373.364) [-371.915] (-373.839) (-381.005) * (-373.953) (-374.708) (-374.550) [-374.409] -- 0:00:26
556000 -- (-373.992) [-374.258] (-375.222) (-376.383) * (-372.927) [-374.807] (-376.091) (-376.756) -- 0:00:26
556500 -- (-372.729) (-371.934) [-374.733] (-374.418) * (-376.112) (-372.840) (-373.326) [-373.951] -- 0:00:26
557000 -- (-372.816) [-371.313] (-372.589) (-372.455) * (-371.753) [-373.295] (-371.689) (-371.441) -- 0:00:26
557500 -- (-380.538) [-373.397] (-372.555) (-371.825) * (-372.469) (-375.992) [-372.367] (-374.554) -- 0:00:26
558000 -- (-373.863) (-377.787) (-374.893) [-374.529] * (-372.535) [-373.209] (-371.706) (-376.545) -- 0:00:26
558500 -- (-374.429) (-376.291) (-373.893) [-378.909] * (-374.796) (-373.926) [-373.046] (-372.985) -- 0:00:26
559000 -- (-374.540) (-373.536) [-376.414] (-377.034) * (-371.431) (-375.726) [-373.910] (-373.696) -- 0:00:26
559500 -- (-374.690) (-373.367) [-372.695] (-372.377) * (-371.378) (-375.933) [-373.135] (-376.317) -- 0:00:25
560000 -- (-375.507) (-372.852) [-375.411] (-372.096) * (-371.809) (-377.188) [-372.343] (-376.262) -- 0:00:25
Average standard deviation of split frequencies: 0.011128
560500 -- (-377.220) [-372.872] (-373.209) (-374.443) * [-373.358] (-372.867) (-374.373) (-374.106) -- 0:00:25
561000 -- [-375.721] (-373.364) (-376.286) (-374.399) * (-371.936) (-373.734) [-371.775] (-375.451) -- 0:00:26
561500 -- (-373.454) (-373.739) (-372.411) [-372.906] * (-378.225) (-374.452) [-372.314] (-371.605) -- 0:00:26
562000 -- (-376.609) (-372.220) (-381.331) [-372.892] * (-372.242) (-376.103) [-373.072] (-371.755) -- 0:00:26
562500 -- [-374.178] (-372.508) (-378.983) (-376.739) * (-372.741) (-376.107) [-371.825] (-372.058) -- 0:00:26
563000 -- (-373.376) [-371.934] (-375.135) (-379.376) * (-371.550) (-372.175) (-372.257) [-379.363] -- 0:00:26
563500 -- (-376.210) (-373.250) [-372.299] (-378.732) * (-377.143) (-375.147) [-379.361] (-376.756) -- 0:00:26
564000 -- [-372.752] (-373.008) (-373.742) (-380.772) * (-374.842) [-372.099] (-378.434) (-377.522) -- 0:00:26
564500 -- (-372.528) (-373.490) [-371.663] (-379.316) * (-375.909) (-373.032) (-381.434) [-373.300] -- 0:00:26
565000 -- (-374.735) (-372.131) [-373.601] (-373.520) * (-374.243) (-373.389) [-375.134] (-378.473) -- 0:00:26
Average standard deviation of split frequencies: 0.011317
565500 -- (-376.229) (-371.651) [-375.798] (-374.879) * [-373.971] (-374.891) (-375.201) (-375.040) -- 0:00:26
566000 -- (-375.510) (-375.550) (-374.089) [-374.105] * [-376.743] (-372.743) (-374.153) (-375.188) -- 0:00:26
566500 -- (-372.769) [-373.924] (-373.807) (-372.267) * (-373.257) (-372.095) [-376.270] (-371.973) -- 0:00:26
567000 -- [-371.702] (-374.952) (-372.253) (-371.805) * (-374.485) [-373.879] (-373.662) (-374.481) -- 0:00:25
567500 -- [-373.303] (-375.031) (-374.767) (-378.924) * (-371.657) (-377.936) [-373.697] (-373.265) -- 0:00:25
568000 -- (-371.842) [-373.757] (-374.270) (-382.217) * (-372.708) (-372.578) [-373.799] (-372.634) -- 0:00:25
568500 -- (-378.133) [-372.382] (-376.554) (-375.039) * (-376.266) (-374.468) (-372.735) [-371.548] -- 0:00:25
569000 -- (-373.211) [-373.348] (-372.618) (-376.029) * [-378.459] (-377.415) (-375.929) (-373.464) -- 0:00:25
569500 -- (-373.581) [-372.243] (-371.960) (-373.118) * [-371.781] (-375.413) (-376.356) (-373.729) -- 0:00:25
570000 -- (-374.438) [-374.279] (-374.728) (-373.328) * (-374.485) [-372.508] (-373.250) (-372.199) -- 0:00:25
Average standard deviation of split frequencies: 0.011419
570500 -- (-373.369) [-376.269] (-375.058) (-374.441) * (-378.341) [-375.114] (-375.081) (-373.588) -- 0:00:25
571000 -- (-373.014) [-371.760] (-373.928) (-376.251) * (-373.633) (-375.672) (-372.596) [-372.940] -- 0:00:25
571500 -- (-373.001) (-373.836) (-373.117) [-374.614] * (-374.808) [-373.213] (-374.237) (-373.894) -- 0:00:25
572000 -- (-371.858) (-376.043) [-373.242] (-371.914) * [-378.069] (-371.744) (-374.394) (-371.811) -- 0:00:25
572500 -- (-374.480) (-373.514) [-372.402] (-373.325) * (-373.346) [-372.737] (-374.687) (-373.765) -- 0:00:25
573000 -- (-375.205) (-375.186) (-372.871) [-372.807] * (-373.499) (-372.139) [-373.847] (-374.584) -- 0:00:25
573500 -- [-372.785] (-376.688) (-372.480) (-372.336) * [-373.233] (-374.714) (-374.008) (-378.514) -- 0:00:25
574000 -- (-372.355) (-374.267) [-373.036] (-374.439) * (-373.179) [-371.780] (-372.696) (-378.489) -- 0:00:25
574500 -- (-374.777) [-373.444] (-373.829) (-372.344) * [-371.837] (-372.258) (-373.222) (-372.663) -- 0:00:25
575000 -- (-376.311) (-372.030) [-372.066] (-372.752) * [-374.118] (-373.387) (-375.871) (-372.446) -- 0:00:25
Average standard deviation of split frequencies: 0.011169
575500 -- (-372.647) (-372.318) (-373.928) [-373.128] * (-373.920) (-373.374) (-374.745) [-372.275] -- 0:00:25
576000 -- (-375.047) (-377.242) [-371.612] (-373.424) * [-373.451] (-373.201) (-372.721) (-373.903) -- 0:00:25
576500 -- (-376.078) [-372.701] (-372.962) (-374.810) * [-373.901] (-373.721) (-373.906) (-373.468) -- 0:00:24
577000 -- (-373.299) (-377.634) [-375.309] (-374.758) * (-373.532) (-373.128) (-376.152) [-371.909] -- 0:00:24
577500 -- (-374.301) [-373.183] (-376.636) (-373.447) * (-371.440) (-373.610) (-373.455) [-373.056] -- 0:00:24
578000 -- (-372.009) (-377.630) [-371.662] (-374.724) * (-371.970) (-372.728) (-375.301) [-373.873] -- 0:00:25
578500 -- [-373.189] (-379.044) (-372.689) (-373.880) * (-371.279) (-373.903) (-374.784) [-372.633] -- 0:00:25
579000 -- (-373.261) [-372.872] (-372.736) (-372.813) * (-371.656) (-375.257) (-372.412) [-374.766] -- 0:00:25
579500 -- [-373.447] (-373.173) (-372.876) (-374.269) * [-371.773] (-376.883) (-374.451) (-374.125) -- 0:00:25
580000 -- [-374.253] (-375.435) (-374.041) (-373.877) * (-374.766) [-374.076] (-371.820) (-373.925) -- 0:00:25
Average standard deviation of split frequencies: 0.010148
580500 -- (-372.237) (-371.984) (-373.753) [-371.842] * (-373.990) [-373.354] (-375.924) (-372.134) -- 0:00:25
581000 -- [-371.981] (-375.665) (-374.124) (-375.749) * (-375.107) (-371.343) (-374.906) [-373.133] -- 0:00:25
581500 -- (-374.153) (-373.335) (-373.663) [-373.030] * [-372.137] (-377.127) (-371.844) (-375.116) -- 0:00:25
582000 -- (-374.676) (-373.956) (-372.685) [-372.570] * [-373.475] (-378.659) (-371.936) (-376.634) -- 0:00:25
582500 -- (-374.648) (-375.993) (-373.402) [-374.997] * (-371.739) (-373.995) (-373.623) [-373.662] -- 0:00:25
583000 -- (-373.502) (-375.808) [-373.049] (-375.663) * (-374.368) (-372.896) [-377.238] (-373.447) -- 0:00:25
583500 -- [-371.424] (-371.560) (-374.154) (-376.180) * (-375.116) (-373.178) (-374.413) [-375.735] -- 0:00:24
584000 -- [-373.273] (-371.747) (-376.319) (-375.287) * (-374.844) (-373.619) [-372.308] (-373.155) -- 0:00:24
584500 -- [-371.864] (-375.459) (-373.733) (-375.274) * (-373.827) [-374.311] (-373.788) (-372.085) -- 0:00:24
585000 -- (-373.114) (-374.785) [-374.218] (-377.703) * (-376.636) (-372.571) (-376.318) [-371.377] -- 0:00:24
Average standard deviation of split frequencies: 0.010413
585500 -- (-373.220) [-374.767] (-373.624) (-371.887) * (-373.122) (-372.231) (-374.505) [-372.592] -- 0:00:24
586000 -- (-373.932) (-375.551) [-371.994] (-373.947) * [-374.010] (-373.265) (-373.882) (-373.710) -- 0:00:24
586500 -- (-373.467) (-373.657) [-374.342] (-377.241) * (-372.937) (-377.007) [-372.453] (-375.934) -- 0:00:24
587000 -- (-374.149) (-373.446) (-375.127) [-371.986] * [-372.910] (-374.250) (-375.678) (-372.617) -- 0:00:24
587500 -- (-373.887) [-373.961] (-375.135) (-371.970) * (-372.416) (-373.082) [-372.129] (-372.223) -- 0:00:24
588000 -- (-372.896) (-372.152) (-373.782) [-372.477] * (-372.382) [-374.173] (-371.462) (-372.891) -- 0:00:24
588500 -- [-375.714] (-377.135) (-373.106) (-372.558) * (-373.575) [-374.533] (-371.313) (-380.936) -- 0:00:24
589000 -- (-372.170) [-378.018] (-374.606) (-372.869) * [-374.012] (-372.509) (-372.025) (-374.141) -- 0:00:24
589500 -- [-375.390] (-373.685) (-371.802) (-375.430) * [-372.832] (-372.363) (-372.844) (-373.594) -- 0:00:24
590000 -- (-372.871) [-372.969] (-374.531) (-373.781) * [-372.703] (-372.602) (-371.902) (-377.377) -- 0:00:24
Average standard deviation of split frequencies: 0.010419
590500 -- (-373.687) (-373.614) (-374.877) [-373.852] * [-375.233] (-375.547) (-373.188) (-372.022) -- 0:00:24
591000 -- (-374.427) [-375.018] (-377.018) (-379.428) * [-373.013] (-374.045) (-372.431) (-374.876) -- 0:00:24
591500 -- [-373.380] (-372.277) (-375.034) (-375.734) * [-374.833] (-372.335) (-374.371) (-374.594) -- 0:00:24
592000 -- (-374.408) [-375.857] (-385.029) (-375.264) * (-372.805) [-373.189] (-373.419) (-374.485) -- 0:00:24
592500 -- [-372.964] (-373.378) (-375.632) (-374.456) * [-374.006] (-374.503) (-375.418) (-372.741) -- 0:00:24
593000 -- (-377.948) [-372.192] (-375.160) (-375.145) * [-373.832] (-371.392) (-371.922) (-376.167) -- 0:00:24
593500 -- (-373.581) (-374.146) (-375.887) [-372.542] * [-372.620] (-371.295) (-372.457) (-372.958) -- 0:00:23
594000 -- [-373.626] (-374.428) (-374.536) (-374.744) * (-373.413) (-374.151) (-371.757) [-371.674] -- 0:00:23
594500 -- (-374.390) (-373.530) [-376.875] (-373.508) * (-372.402) (-371.747) [-375.974] (-372.633) -- 0:00:23
595000 -- (-373.537) (-371.483) [-373.660] (-373.656) * [-372.659] (-376.639) (-374.327) (-371.959) -- 0:00:24
Average standard deviation of split frequencies: 0.010143
595500 -- (-374.251) (-374.560) (-375.049) [-372.854] * (-374.872) (-377.046) [-372.889] (-373.379) -- 0:00:24
596000 -- (-372.700) (-373.965) [-372.626] (-374.427) * (-374.207) [-373.256] (-373.024) (-373.492) -- 0:00:24
596500 -- (-373.025) (-378.803) [-372.429] (-371.939) * (-372.246) (-373.226) [-372.932] (-375.924) -- 0:00:24
597000 -- (-375.131) (-377.143) [-372.322] (-376.547) * (-378.393) (-371.722) (-373.455) [-372.574] -- 0:00:24
597500 -- (-373.261) (-373.177) (-373.739) [-372.941] * (-377.335) (-372.076) [-373.966] (-378.845) -- 0:00:24
598000 -- (-371.925) (-374.734) [-372.043] (-372.257) * (-372.234) [-372.746] (-374.146) (-375.852) -- 0:00:24
598500 -- [-371.870] (-372.556) (-374.167) (-371.426) * (-377.016) (-372.248) [-371.950] (-372.186) -- 0:00:24
599000 -- (-371.577) [-372.723] (-377.988) (-376.033) * [-372.817] (-372.674) (-375.735) (-373.821) -- 0:00:24
599500 -- [-372.075] (-372.111) (-381.998) (-371.690) * [-373.261] (-377.106) (-374.359) (-372.361) -- 0:00:24
600000 -- (-373.111) [-372.822] (-371.788) (-371.786) * (-372.929) (-380.450) (-374.413) [-375.873] -- 0:00:24
Average standard deviation of split frequencies: 0.010064
600500 -- (-372.458) (-375.072) (-374.840) [-372.368] * [-375.760] (-374.015) (-372.638) (-373.976) -- 0:00:23
601000 -- [-373.305] (-372.783) (-374.011) (-374.354) * (-372.500) (-371.976) (-373.756) [-372.444] -- 0:00:23
601500 -- [-374.930] (-372.775) (-372.402) (-374.358) * (-372.446) (-371.744) [-375.771] (-378.456) -- 0:00:23
602000 -- (-373.071) (-374.204) (-374.911) [-373.158] * (-376.112) [-371.178] (-375.074) (-375.022) -- 0:00:23
602500 -- (-373.732) (-373.575) (-373.174) [-372.904] * (-373.737) (-371.959) [-374.001] (-373.195) -- 0:00:23
603000 -- [-372.206] (-373.507) (-376.628) (-374.210) * (-372.329) (-375.006) [-373.046] (-374.856) -- 0:00:23
603500 -- (-371.956) [-371.754] (-372.253) (-372.642) * (-371.897) [-374.185] (-373.325) (-372.704) -- 0:00:23
604000 -- (-371.699) (-372.495) (-372.980) [-372.519] * (-373.081) (-373.016) [-373.937] (-373.500) -- 0:00:23
604500 -- [-371.971] (-372.177) (-372.870) (-373.492) * (-372.501) [-375.764] (-373.614) (-371.334) -- 0:00:23
605000 -- (-372.428) (-373.921) [-372.541] (-373.562) * (-378.285) (-375.465) (-372.940) [-371.590] -- 0:00:23
Average standard deviation of split frequencies: 0.010250
605500 -- (-371.793) (-374.234) [-372.896] (-372.432) * [-371.395] (-371.931) (-373.623) (-374.523) -- 0:00:23
606000 -- (-372.439) (-374.248) [-373.922] (-377.389) * (-376.347) (-374.418) (-375.376) [-372.228] -- 0:00:23
606500 -- (-371.500) (-374.372) (-375.878) [-372.274] * (-375.583) (-372.807) (-373.585) [-374.064] -- 0:00:23
607000 -- (-371.939) [-372.668] (-375.972) (-373.703) * [-372.243] (-371.921) (-375.505) (-372.864) -- 0:00:23
607500 -- (-376.634) [-371.981] (-375.762) (-373.418) * (-374.388) (-371.502) [-372.292] (-371.900) -- 0:00:23
608000 -- (-378.622) (-373.057) (-375.433) [-374.908] * (-374.394) (-371.710) (-371.772) [-372.488] -- 0:00:23
608500 -- [-372.669] (-372.656) (-373.583) (-375.229) * (-371.646) (-371.380) [-371.899] (-372.367) -- 0:00:23
609000 -- (-375.640) [-374.489] (-372.255) (-375.773) * (-372.675) (-372.106) [-373.631] (-372.335) -- 0:00:23
609500 -- [-372.158] (-374.273) (-372.685) (-374.556) * (-376.660) (-374.455) [-375.360] (-373.023) -- 0:00:23
610000 -- (-373.746) [-372.971] (-374.141) (-373.198) * (-373.484) (-372.848) (-378.779) [-371.996] -- 0:00:23
Average standard deviation of split frequencies: 0.009854
610500 -- (-376.391) (-375.021) (-375.343) [-373.277] * (-373.880) (-371.884) (-371.998) [-372.275] -- 0:00:22
611000 -- (-371.554) (-374.489) (-374.985) [-372.501] * (-377.123) (-371.635) (-374.685) [-373.850] -- 0:00:22
611500 -- (-374.907) [-373.114] (-376.618) (-372.804) * (-379.440) (-375.320) [-372.910] (-374.038) -- 0:00:22
612000 -- [-372.008] (-374.371) (-372.571) (-374.166) * [-374.587] (-374.613) (-371.482) (-373.880) -- 0:00:23
612500 -- (-374.638) (-373.153) [-373.978] (-376.499) * (-372.662) [-372.311] (-375.043) (-373.419) -- 0:00:23
613000 -- (-373.943) (-376.882) (-376.038) [-376.245] * (-375.417) (-374.292) [-372.808] (-375.176) -- 0:00:23
613500 -- (-374.390) (-376.559) [-374.785] (-373.666) * (-376.879) [-374.915] (-373.104) (-374.603) -- 0:00:23
614000 -- (-375.951) [-375.645] (-372.687) (-372.386) * (-379.653) (-374.732) [-373.768] (-372.395) -- 0:00:23
614500 -- (-376.657) (-375.689) [-373.298] (-373.087) * [-374.932] (-375.094) (-375.073) (-372.872) -- 0:00:23
615000 -- (-375.182) [-373.069] (-375.308) (-374.308) * (-373.674) (-373.765) (-373.989) [-372.195] -- 0:00:23
Average standard deviation of split frequencies: 0.009231
615500 -- (-371.429) (-373.994) [-372.007] (-373.030) * (-372.599) [-374.321] (-374.691) (-371.763) -- 0:00:23
616000 -- (-371.583) [-372.889] (-373.042) (-371.681) * (-377.630) [-371.355] (-377.755) (-372.199) -- 0:00:23
616500 -- (-373.078) (-373.336) [-372.888] (-372.291) * [-372.422] (-374.266) (-373.498) (-373.379) -- 0:00:23
617000 -- (-374.128) (-373.602) [-374.684] (-372.231) * (-373.015) (-371.766) [-374.107] (-372.776) -- 0:00:22
617500 -- (-375.908) (-372.148) [-375.343] (-372.079) * [-373.167] (-372.635) (-373.082) (-373.275) -- 0:00:22
618000 -- (-379.133) (-377.059) [-374.138] (-373.667) * (-373.082) (-371.755) (-372.819) [-373.274] -- 0:00:22
618500 -- (-376.582) [-372.869] (-375.958) (-372.678) * [-373.939] (-373.366) (-371.679) (-372.550) -- 0:00:22
619000 -- (-374.117) (-373.713) (-372.087) [-372.789] * (-373.718) (-374.731) (-375.913) [-372.574] -- 0:00:22
619500 -- (-374.678) (-374.466) [-371.687] (-374.205) * (-373.016) (-374.443) (-372.355) [-374.177] -- 0:00:22
620000 -- (-376.083) (-375.224) [-374.133] (-372.620) * (-372.885) (-380.451) [-372.714] (-372.353) -- 0:00:22
Average standard deviation of split frequencies: 0.009779
620500 -- (-378.956) [-372.792] (-373.128) (-374.561) * (-372.999) (-373.427) [-373.955] (-372.777) -- 0:00:22
621000 -- (-375.523) (-373.489) (-373.205) [-373.523] * (-375.405) [-372.243] (-372.340) (-374.683) -- 0:00:22
621500 -- (-373.806) (-376.131) (-374.498) [-375.871] * (-377.355) (-372.027) (-372.187) [-374.629] -- 0:00:22
622000 -- (-374.435) (-372.545) [-372.572] (-376.107) * (-372.390) (-375.782) [-371.996] (-372.977) -- 0:00:22
622500 -- (-372.765) [-373.776] (-376.784) (-374.572) * (-372.700) [-372.253] (-372.243) (-372.303) -- 0:00:22
623000 -- (-372.318) [-371.807] (-378.395) (-379.277) * (-376.070) (-373.377) (-376.055) [-372.879] -- 0:00:22
623500 -- (-373.101) (-372.166) (-373.351) [-375.504] * (-373.918) (-373.640) (-374.170) [-376.757] -- 0:00:22
624000 -- [-372.471] (-374.102) (-371.924) (-372.013) * (-373.240) (-372.244) (-375.153) [-374.395] -- 0:00:22
624500 -- (-375.610) (-373.239) (-372.460) [-377.292] * [-373.533] (-374.543) (-372.583) (-377.283) -- 0:00:22
625000 -- (-375.192) (-372.327) (-371.964) [-374.195] * (-376.716) (-375.303) [-373.097] (-372.892) -- 0:00:22
Average standard deviation of split frequencies: 0.009460
625500 -- (-372.911) (-373.278) [-372.254] (-377.624) * (-376.340) (-374.902) (-373.229) [-373.367] -- 0:00:22
626000 -- (-374.231) (-381.774) [-371.944] (-373.629) * (-377.320) (-373.592) [-373.406] (-374.895) -- 0:00:22
626500 -- (-373.903) (-373.894) (-371.891) [-371.643] * [-374.637] (-374.234) (-372.922) (-373.487) -- 0:00:22
627000 -- (-372.370) [-373.920] (-377.583) (-372.564) * (-373.777) (-373.482) [-372.189] (-373.246) -- 0:00:22
627500 -- [-372.531] (-372.727) (-372.803) (-374.229) * (-381.426) (-371.720) (-373.096) [-372.357] -- 0:00:21
628000 -- (-372.199) [-372.253] (-373.031) (-371.503) * (-377.231) (-372.751) [-373.343] (-373.422) -- 0:00:21
628500 -- (-372.665) [-372.593] (-373.109) (-376.452) * [-374.574] (-374.257) (-378.145) (-372.675) -- 0:00:21
629000 -- (-377.366) [-371.871] (-377.129) (-372.947) * (-371.956) (-373.282) [-372.278] (-372.234) -- 0:00:22
629500 -- (-377.057) (-371.970) [-373.607] (-373.345) * [-371.806] (-376.305) (-373.898) (-377.351) -- 0:00:22
630000 -- [-374.571] (-373.436) (-375.331) (-372.995) * (-374.165) (-373.863) [-373.225] (-371.953) -- 0:00:22
Average standard deviation of split frequencies: 0.009764
630500 -- (-372.493) [-372.595] (-372.639) (-374.021) * (-372.178) (-371.743) (-375.095) [-374.026] -- 0:00:22
631000 -- (-379.675) (-372.277) [-372.387] (-372.929) * [-372.109] (-371.956) (-373.594) (-372.622) -- 0:00:22
631500 -- (-374.402) [-373.450] (-374.144) (-373.178) * (-371.931) (-374.246) [-375.112] (-374.577) -- 0:00:22
632000 -- (-373.618) [-374.688] (-371.664) (-374.354) * (-374.312) [-371.624] (-374.600) (-373.016) -- 0:00:22
632500 -- (-375.103) (-379.565) [-371.860] (-373.991) * (-373.355) [-373.251] (-375.806) (-379.616) -- 0:00:22
633000 -- (-374.328) (-375.232) [-373.313] (-374.485) * (-373.478) [-374.571] (-373.436) (-372.477) -- 0:00:22
633500 -- (-378.166) (-372.252) (-371.804) [-373.691] * [-373.773] (-374.923) (-373.552) (-377.197) -- 0:00:21
634000 -- (-373.500) (-372.726) [-374.130] (-374.574) * (-374.194) [-373.154] (-371.910) (-373.176) -- 0:00:21
634500 -- (-374.370) (-371.906) [-373.540] (-374.062) * (-372.945) [-371.994] (-372.138) (-375.618) -- 0:00:21
635000 -- (-375.756) (-373.765) [-376.837] (-371.283) * (-373.805) (-373.106) [-375.007] (-375.053) -- 0:00:21
Average standard deviation of split frequencies: 0.009775
635500 -- [-376.078] (-372.152) (-373.143) (-375.098) * [-374.808] (-376.636) (-376.656) (-376.104) -- 0:00:21
636000 -- (-375.175) (-377.246) (-372.348) [-374.648] * (-372.132) [-375.860] (-376.978) (-372.875) -- 0:00:21
636500 -- (-372.317) [-374.641] (-374.189) (-373.126) * [-372.999] (-373.390) (-373.825) (-373.563) -- 0:00:21
637000 -- (-371.780) (-372.434) [-378.045] (-372.379) * (-373.120) [-373.854] (-373.157) (-375.582) -- 0:00:21
637500 -- (-373.067) [-374.629] (-372.599) (-372.642) * (-375.923) (-372.393) [-373.805] (-374.726) -- 0:00:21
638000 -- [-375.580] (-377.036) (-375.730) (-375.628) * (-376.816) (-373.244) (-374.544) [-372.478] -- 0:00:21
638500 -- (-372.737) (-374.826) [-373.614] (-375.716) * (-371.980) (-372.984) (-373.188) [-372.459] -- 0:00:21
639000 -- [-371.755] (-374.973) (-373.210) (-375.621) * (-377.607) [-372.543] (-376.607) (-375.470) -- 0:00:21
639500 -- [-371.958] (-372.221) (-373.105) (-375.662) * [-374.943] (-375.052) (-375.522) (-377.672) -- 0:00:21
640000 -- (-372.103) (-372.116) (-371.804) [-372.588] * [-376.023] (-371.713) (-376.777) (-375.388) -- 0:00:21
Average standard deviation of split frequencies: 0.009933
640500 -- [-375.348] (-372.209) (-373.468) (-373.297) * (-372.423) (-376.369) [-374.416] (-374.539) -- 0:00:21
641000 -- (-374.095) [-371.531] (-376.119) (-374.258) * [-373.882] (-372.454) (-375.358) (-373.553) -- 0:00:21
641500 -- (-374.660) (-373.473) (-377.250) [-372.607] * [-371.427] (-376.675) (-378.475) (-375.892) -- 0:00:21
642000 -- [-373.154] (-371.964) (-373.537) (-374.001) * (-375.075) [-372.964] (-373.566) (-374.794) -- 0:00:21
642500 -- [-373.003] (-372.568) (-372.168) (-372.178) * (-374.566) (-374.003) [-375.830] (-372.470) -- 0:00:21
643000 -- [-373.235] (-376.193) (-374.413) (-378.211) * (-377.167) (-375.300) (-377.413) [-372.306] -- 0:00:21
643500 -- (-374.075) (-373.666) (-372.825) [-376.012] * [-375.601] (-372.538) (-372.202) (-373.693) -- 0:00:21
644000 -- (-373.129) [-372.131] (-371.999) (-373.239) * (-376.531) [-374.153] (-374.411) (-375.182) -- 0:00:21
644500 -- [-372.690] (-373.355) (-372.614) (-373.330) * (-373.241) (-374.032) [-374.352] (-372.952) -- 0:00:20
645000 -- (-372.381) [-373.763] (-374.523) (-373.416) * [-371.611] (-374.399) (-376.773) (-372.382) -- 0:00:20
Average standard deviation of split frequencies: 0.010173
645500 -- (-374.866) (-372.453) (-376.173) [-375.806] * (-373.228) (-374.962) (-372.122) [-372.371] -- 0:00:21
646000 -- (-373.777) (-372.588) (-374.485) [-373.020] * (-376.117) (-375.365) [-374.272] (-374.445) -- 0:00:21
646500 -- (-374.456) [-372.787] (-372.683) (-371.948) * [-372.841] (-373.163) (-374.295) (-372.677) -- 0:00:21
647000 -- (-376.996) (-373.583) [-376.256] (-376.989) * (-372.133) (-373.490) [-375.137] (-378.554) -- 0:00:21
647500 -- [-373.424] (-371.881) (-373.725) (-373.453) * (-373.363) (-374.386) [-374.594] (-373.404) -- 0:00:21
648000 -- (-372.514) (-372.939) [-372.532] (-371.680) * (-377.352) (-372.462) [-377.029] (-371.598) -- 0:00:21
648500 -- [-375.033] (-371.461) (-371.743) (-373.904) * [-371.519] (-373.856) (-375.198) (-374.609) -- 0:00:21
649000 -- [-373.187] (-375.782) (-374.142) (-373.317) * (-371.323) (-372.057) (-371.795) [-375.209] -- 0:00:21
649500 -- (-372.327) (-371.911) (-373.534) [-375.023] * (-372.950) [-372.391] (-373.727) (-372.447) -- 0:00:21
650000 -- (-374.408) [-372.125] (-374.398) (-380.659) * [-376.950] (-372.905) (-375.403) (-374.838) -- 0:00:21
Average standard deviation of split frequencies: 0.009101
650500 -- [-372.191] (-372.116) (-377.411) (-375.356) * (-373.596) [-374.610] (-374.641) (-373.434) -- 0:00:20
651000 -- (-373.853) [-372.061] (-375.335) (-374.064) * (-373.196) (-381.003) (-376.833) [-374.021] -- 0:00:20
651500 -- (-371.771) [-374.080] (-374.694) (-373.394) * (-377.305) (-373.706) [-374.294] (-372.240) -- 0:00:20
652000 -- (-373.136) (-372.606) (-374.504) [-372.181] * (-373.636) (-372.373) (-372.622) [-372.231] -- 0:00:20
652500 -- (-375.516) [-372.174] (-371.505) (-375.167) * (-375.354) (-376.325) [-372.221] (-371.289) -- 0:00:20
653000 -- (-382.250) (-372.535) [-372.105] (-374.983) * (-374.517) (-372.765) [-371.554] (-376.377) -- 0:00:20
653500 -- [-373.561] (-372.611) (-372.662) (-372.815) * (-378.187) (-375.412) [-372.694] (-375.741) -- 0:00:20
654000 -- (-374.453) (-372.381) [-373.050] (-372.316) * (-372.613) [-374.863] (-376.528) (-371.811) -- 0:00:20
654500 -- (-376.954) [-373.209] (-374.621) (-375.698) * (-375.257) (-377.398) [-372.924] (-373.654) -- 0:00:20
655000 -- (-373.195) (-372.393) (-373.812) [-375.400] * (-374.938) (-371.162) (-373.735) [-376.216] -- 0:00:20
Average standard deviation of split frequencies: 0.009432
655500 -- (-374.931) (-373.235) [-373.595] (-377.439) * (-373.530) (-373.380) [-372.084] (-375.510) -- 0:00:20
656000 -- (-372.907) [-372.418] (-372.715) (-375.207) * (-374.519) (-373.754) [-374.393] (-372.840) -- 0:00:20
656500 -- [-372.290] (-372.318) (-372.776) (-371.503) * (-373.610) (-372.025) [-372.799] (-372.803) -- 0:00:20
657000 -- (-375.658) (-373.336) [-372.285] (-372.586) * (-371.485) (-372.349) (-379.690) [-373.256] -- 0:00:20
657500 -- [-373.525] (-371.858) (-372.265) (-371.885) * (-372.086) (-377.113) [-373.684] (-372.397) -- 0:00:20
658000 -- (-380.837) (-371.984) [-371.642] (-375.276) * (-372.864) [-373.217] (-372.252) (-374.023) -- 0:00:20
658500 -- (-373.202) (-371.805) [-375.990] (-373.535) * (-375.378) (-371.557) (-372.537) [-377.378] -- 0:00:20
659000 -- (-372.679) [-373.343] (-372.248) (-374.603) * (-371.585) (-372.440) (-372.179) [-372.256] -- 0:00:20
659500 -- (-372.379) (-373.305) [-373.194] (-372.536) * [-372.212] (-375.312) (-373.029) (-374.316) -- 0:00:20
660000 -- (-375.458) (-376.647) [-375.801] (-374.951) * (-376.905) [-376.883] (-372.962) (-378.211) -- 0:00:20
Average standard deviation of split frequencies: 0.009677
660500 -- (-381.178) [-372.955] (-373.401) (-372.912) * [-374.087] (-376.024) (-373.003) (-372.541) -- 0:00:20
661000 -- [-372.689] (-378.309) (-374.709) (-373.746) * (-373.571) [-372.132] (-371.572) (-372.368) -- 0:00:20
661500 -- [-377.211] (-372.492) (-373.873) (-372.582) * (-372.170) (-374.108) [-371.521] (-372.734) -- 0:00:19
662000 -- (-373.572) (-373.642) (-375.136) [-373.803] * (-372.794) (-377.229) [-373.156] (-371.669) -- 0:00:19
662500 -- (-372.962) (-374.934) [-375.100] (-372.306) * (-373.742) [-373.789] (-372.251) (-372.750) -- 0:00:19
663000 -- (-378.304) (-374.278) [-373.873] (-373.314) * (-372.086) (-375.322) [-372.816] (-376.314) -- 0:00:20
663500 -- (-374.641) (-377.217) [-373.665] (-374.713) * [-371.868] (-374.780) (-375.150) (-377.652) -- 0:00:20
664000 -- [-373.865] (-373.496) (-374.225) (-372.159) * (-374.108) [-372.620] (-373.398) (-380.473) -- 0:00:20
664500 -- (-373.438) [-372.382] (-372.823) (-379.958) * (-376.486) (-372.423) (-372.484) [-375.096] -- 0:00:20
665000 -- (-373.665) [-373.129] (-376.575) (-380.979) * (-376.355) (-372.096) (-378.035) [-373.633] -- 0:00:20
Average standard deviation of split frequencies: 0.009423
665500 -- (-373.472) [-375.246] (-377.702) (-376.314) * (-375.706) (-372.342) [-372.390] (-372.808) -- 0:00:20
666000 -- (-373.719) (-372.143) [-373.785] (-377.303) * (-373.867) (-376.716) (-373.870) [-372.477] -- 0:00:20
666500 -- (-374.460) (-374.864) [-374.164] (-373.185) * (-372.359) (-375.940) [-373.209] (-373.534) -- 0:00:20
667000 -- (-375.920) (-373.690) (-377.429) [-371.623] * (-372.486) [-371.284] (-372.392) (-374.096) -- 0:00:19
667500 -- [-373.593] (-374.066) (-379.111) (-371.686) * (-375.265) [-374.279] (-372.877) (-375.427) -- 0:00:19
668000 -- (-373.985) (-373.916) (-380.011) [-375.030] * (-374.378) (-375.221) (-373.849) [-374.011] -- 0:00:19
668500 -- (-375.531) [-372.829] (-371.907) (-371.549) * (-374.139) (-372.700) [-371.594] (-376.903) -- 0:00:19
669000 -- (-376.429) (-374.347) [-374.312] (-372.006) * (-373.696) (-371.310) (-373.198) [-377.468] -- 0:00:19
669500 -- [-374.528] (-374.340) (-376.982) (-373.647) * (-375.227) [-372.715] (-373.535) (-375.007) -- 0:00:19
670000 -- (-372.990) [-372.674] (-373.647) (-375.256) * (-374.330) (-374.512) [-373.162] (-375.172) -- 0:00:19
Average standard deviation of split frequencies: 0.009577
670500 -- (-373.233) (-372.993) (-372.430) [-372.798] * (-373.626) [-374.802] (-372.524) (-372.131) -- 0:00:19
671000 -- (-374.635) (-373.296) [-374.269] (-374.163) * (-373.000) (-377.102) (-375.127) [-371.876] -- 0:00:19
671500 -- [-372.410] (-374.904) (-371.281) (-373.804) * (-373.693) (-375.526) (-372.355) [-373.177] -- 0:00:19
672000 -- [-378.190] (-374.894) (-374.571) (-372.507) * (-373.614) (-372.670) (-374.358) [-373.572] -- 0:00:19
672500 -- (-373.564) (-372.445) (-373.493) [-372.078] * (-373.850) [-378.710] (-375.013) (-372.964) -- 0:00:19
673000 -- (-372.740) (-371.506) (-372.666) [-372.072] * (-373.645) (-375.141) (-372.334) [-373.705] -- 0:00:19
673500 -- (-371.839) (-373.394) (-372.675) [-373.871] * (-372.415) (-372.072) (-372.826) [-372.916] -- 0:00:19
674000 -- (-371.966) [-372.384] (-373.975) (-377.917) * (-375.314) [-374.066] (-373.324) (-376.542) -- 0:00:19
674500 -- (-374.824) (-374.782) [-372.975] (-375.289) * (-373.846) (-373.516) [-374.057] (-372.727) -- 0:00:19
675000 -- (-374.864) (-374.723) (-371.723) [-372.651] * (-374.205) [-375.694] (-383.579) (-372.140) -- 0:00:19
Average standard deviation of split frequencies: 0.010583
675500 -- (-372.802) (-373.354) [-374.261] (-375.487) * (-373.242) (-373.164) (-378.696) [-373.604] -- 0:00:19
676000 -- (-376.153) (-374.521) (-371.939) [-375.087] * (-374.152) [-375.235] (-373.626) (-373.475) -- 0:00:19
676500 -- (-373.421) (-374.344) (-374.074) [-375.875] * (-373.847) [-377.365] (-372.678) (-374.622) -- 0:00:19
677000 -- (-374.084) (-376.108) [-375.072] (-373.017) * [-375.443] (-374.565) (-373.140) (-374.193) -- 0:00:19
677500 -- [-372.642] (-375.722) (-373.966) (-372.778) * (-376.433) (-374.769) (-373.356) [-374.412] -- 0:00:19
678000 -- (-376.751) [-374.510] (-374.003) (-372.453) * (-372.662) (-372.226) (-375.459) [-374.748] -- 0:00:18
678500 -- (-374.073) (-374.352) [-379.842] (-376.158) * (-374.966) (-371.583) (-376.779) [-371.730] -- 0:00:18
679000 -- [-375.979] (-373.577) (-373.004) (-373.770) * [-374.128] (-372.530) (-375.783) (-372.813) -- 0:00:18
679500 -- (-373.430) [-373.058] (-373.891) (-372.041) * (-376.513) [-373.113] (-373.155) (-376.459) -- 0:00:19
680000 -- (-374.377) (-377.216) (-373.813) [-376.253] * [-374.320] (-375.753) (-372.650) (-375.673) -- 0:00:19
Average standard deviation of split frequencies: 0.009826
680500 -- (-374.810) (-378.628) (-372.775) [-374.169] * [-374.333] (-374.851) (-375.915) (-375.323) -- 0:00:19
681000 -- (-373.659) (-375.503) [-372.512] (-374.395) * (-372.918) (-375.454) (-376.389) [-372.711] -- 0:00:19
681500 -- (-374.262) [-373.898] (-376.383) (-373.977) * (-372.835) (-376.718) [-372.543] (-375.147) -- 0:00:19
682000 -- (-373.615) [-373.323] (-373.820) (-373.033) * (-373.990) [-375.745] (-371.866) (-372.855) -- 0:00:19
682500 -- (-375.829) [-375.018] (-374.222) (-373.833) * (-377.813) [-375.176] (-371.834) (-375.682) -- 0:00:19
683000 -- (-374.686) [-375.486] (-376.059) (-376.042) * (-376.170) (-372.925) [-373.420] (-372.230) -- 0:00:19
683500 -- (-375.661) [-378.319] (-375.999) (-372.983) * (-380.582) [-374.464] (-373.720) (-375.285) -- 0:00:18
684000 -- (-374.416) [-372.296] (-373.647) (-378.297) * (-373.568) (-371.627) (-375.182) [-372.227] -- 0:00:18
684500 -- (-372.160) (-375.812) (-374.017) [-372.742] * (-376.196) [-373.718] (-374.197) (-372.386) -- 0:00:18
685000 -- (-373.611) [-374.364] (-375.337) (-373.940) * (-374.551) (-374.345) [-378.858] (-374.057) -- 0:00:18
Average standard deviation of split frequencies: 0.009792
685500 -- [-371.688] (-373.868) (-377.409) (-375.907) * (-372.899) [-377.453] (-372.984) (-375.871) -- 0:00:18
686000 -- [-371.952] (-374.661) (-373.025) (-373.291) * (-373.337) (-373.806) (-373.562) [-373.210] -- 0:00:18
686500 -- (-375.901) [-376.486] (-371.911) (-372.035) * (-375.311) (-374.120) [-373.762] (-375.686) -- 0:00:18
687000 -- (-375.755) (-375.836) [-374.945] (-375.191) * (-372.995) [-373.029] (-376.169) (-384.097) -- 0:00:18
687500 -- (-375.229) [-372.533] (-374.287) (-374.835) * (-377.568) (-375.165) (-378.109) [-373.720] -- 0:00:18
688000 -- [-372.111] (-372.889) (-374.579) (-375.204) * (-371.398) (-376.854) (-372.875) [-372.788] -- 0:00:18
688500 -- (-373.691) (-373.229) [-378.574] (-376.728) * [-375.757] (-374.348) (-372.285) (-372.601) -- 0:00:18
689000 -- (-374.233) (-372.030) [-374.065] (-377.717) * (-374.358) (-373.649) [-373.831] (-374.256) -- 0:00:18
689500 -- (-372.134) [-376.403] (-376.318) (-377.559) * (-375.838) [-374.816] (-373.650) (-372.215) -- 0:00:18
690000 -- (-371.163) (-372.665) (-371.510) [-371.893] * (-372.940) [-373.160] (-375.625) (-373.011) -- 0:00:18
Average standard deviation of split frequencies: 0.009676
690500 -- (-371.161) (-372.823) [-371.760] (-373.517) * (-373.277) (-374.831) (-373.433) [-372.252] -- 0:00:18
691000 -- (-372.715) (-375.504) [-372.218] (-374.814) * (-372.644) (-376.050) [-372.629] (-374.656) -- 0:00:18
691500 -- [-378.781] (-374.298) (-375.282) (-374.507) * [-374.111] (-379.133) (-374.424) (-373.572) -- 0:00:18
692000 -- (-374.954) (-372.443) (-376.420) [-372.980] * (-375.479) (-374.992) [-372.442] (-375.426) -- 0:00:18
692500 -- (-372.403) (-372.956) [-372.023] (-373.352) * (-377.195) [-375.307] (-374.988) (-376.227) -- 0:00:18
693000 -- (-371.939) (-371.928) (-372.329) [-371.604] * (-371.964) (-373.329) [-376.976] (-372.840) -- 0:00:18
693500 -- (-373.765) [-371.406] (-373.229) (-375.049) * [-373.589] (-373.750) (-375.239) (-372.648) -- 0:00:18
694000 -- (-372.558) (-372.026) [-372.199] (-373.877) * (-372.995) [-373.152] (-375.424) (-377.083) -- 0:00:18
694500 -- (-371.421) [-371.609] (-371.912) (-381.003) * [-373.403] (-372.566) (-377.564) (-376.885) -- 0:00:18
695000 -- [-372.518] (-371.815) (-373.620) (-376.718) * (-373.868) (-371.703) (-374.319) [-375.988] -- 0:00:17
Average standard deviation of split frequencies: 0.009694
695500 -- (-377.776) (-373.590) (-373.387) [-373.408] * (-375.714) [-371.884] (-381.823) (-373.229) -- 0:00:17
696000 -- (-373.482) (-373.727) (-371.926) [-374.976] * (-376.137) [-372.848] (-375.656) (-375.224) -- 0:00:18
696500 -- (-373.095) (-372.438) (-377.244) [-373.633] * [-372.193] (-376.454) (-372.667) (-375.249) -- 0:00:18
697000 -- (-374.772) (-373.582) (-378.887) [-373.509] * (-373.325) (-374.393) [-372.080] (-376.259) -- 0:00:18
697500 -- (-373.669) (-373.096) (-373.194) [-374.980] * [-373.322] (-374.778) (-371.778) (-374.825) -- 0:00:18
698000 -- (-373.086) [-375.135] (-372.724) (-372.716) * (-375.207) [-372.057] (-372.843) (-373.573) -- 0:00:18
698500 -- (-373.305) (-372.984) (-374.810) [-372.666] * [-372.150] (-376.847) (-373.039) (-373.940) -- 0:00:18
699000 -- [-372.208] (-374.340) (-372.498) (-374.981) * (-375.618) (-375.224) [-374.238] (-373.982) -- 0:00:18
699500 -- (-379.644) (-373.489) (-372.321) [-372.784] * (-376.672) (-373.486) (-377.905) [-373.098] -- 0:00:18
700000 -- [-374.590] (-372.530) (-371.794) (-373.263) * [-371.894] (-374.086) (-372.756) (-377.992) -- 0:00:18
Average standard deviation of split frequencies: 0.009041
700500 -- [-375.876] (-377.693) (-373.437) (-375.670) * (-371.867) [-373.929] (-373.778) (-374.401) -- 0:00:17
701000 -- (-376.514) [-371.393] (-374.008) (-374.635) * (-373.039) (-373.827) (-373.208) [-373.902] -- 0:00:17
701500 -- [-373.017] (-373.769) (-372.155) (-374.495) * [-374.220] (-373.106) (-372.407) (-377.676) -- 0:00:17
702000 -- (-374.679) [-371.730] (-371.427) (-374.470) * (-373.837) (-373.431) [-372.843] (-374.092) -- 0:00:17
702500 -- (-375.131) [-372.900] (-374.063) (-375.099) * (-373.892) [-374.429] (-375.755) (-374.139) -- 0:00:17
703000 -- (-376.632) (-372.776) (-371.308) [-372.163] * (-373.579) [-377.236] (-379.039) (-373.570) -- 0:00:17
703500 -- (-373.457) [-372.361] (-372.027) (-372.767) * (-373.472) (-373.244) (-377.830) [-372.951] -- 0:00:17
704000 -- (-375.962) (-374.274) [-372.546] (-372.427) * (-372.815) (-371.393) (-374.448) [-374.680] -- 0:00:17
704500 -- (-375.262) [-373.592] (-376.333) (-379.169) * (-371.811) (-371.949) [-372.042] (-375.002) -- 0:00:17
705000 -- (-375.279) (-372.918) [-375.682] (-373.685) * (-372.529) (-372.197) (-372.973) [-374.897] -- 0:00:17
Average standard deviation of split frequencies: 0.009473
705500 -- (-375.370) (-372.782) [-374.100] (-373.492) * (-373.740) (-373.022) (-374.763) [-372.628] -- 0:00:17
706000 -- (-375.196) (-373.998) (-376.820) [-372.234] * (-372.629) [-373.401] (-372.546) (-376.422) -- 0:00:17
706500 -- [-376.294] (-373.628) (-374.022) (-372.945) * [-372.264] (-373.600) (-377.838) (-374.845) -- 0:00:17
707000 -- [-374.510] (-375.553) (-380.160) (-373.840) * (-373.135) (-376.586) [-373.570] (-371.950) -- 0:00:17
707500 -- (-381.094) (-374.210) (-373.762) [-374.257] * [-377.161] (-373.971) (-372.636) (-372.915) -- 0:00:17
708000 -- (-381.847) (-373.453) (-373.913) [-372.741] * (-372.918) (-372.782) [-374.217] (-374.654) -- 0:00:17
708500 -- (-374.889) (-375.237) (-371.548) [-375.446] * (-373.707) (-371.588) [-377.474] (-376.512) -- 0:00:17
709000 -- (-377.904) (-373.033) (-372.499) [-371.795] * (-374.636) (-372.300) [-373.349] (-372.475) -- 0:00:17
709500 -- (-374.369) [-374.426] (-373.183) (-374.883) * (-372.419) (-372.007) [-371.569] (-373.881) -- 0:00:17
710000 -- (-375.691) [-376.532] (-375.582) (-372.652) * (-371.859) [-372.371] (-372.785) (-373.929) -- 0:00:17
Average standard deviation of split frequencies: 0.009369
710500 -- (-373.080) [-373.121] (-375.446) (-372.499) * (-371.779) (-374.070) (-372.424) [-376.300] -- 0:00:17
711000 -- (-374.032) (-376.274) (-371.520) [-374.170] * (-373.253) [-372.369] (-373.123) (-375.075) -- 0:00:17
711500 -- (-372.957) (-372.144) [-373.361] (-372.786) * (-372.796) (-374.593) (-373.089) [-371.997] -- 0:00:17
712000 -- (-372.132) (-373.454) (-377.129) [-373.948] * (-374.332) [-373.084] (-371.267) (-374.589) -- 0:00:16
712500 -- [-372.847] (-375.302) (-375.078) (-375.789) * (-373.708) (-372.206) (-372.373) [-376.369] -- 0:00:17
713000 -- [-372.966] (-373.491) (-373.362) (-373.202) * [-374.299] (-374.442) (-375.302) (-374.831) -- 0:00:17
713500 -- (-374.202) [-373.080] (-374.507) (-375.109) * (-376.869) [-372.532] (-373.220) (-375.593) -- 0:00:17
714000 -- (-372.623) (-372.437) (-377.069) [-383.959] * (-374.218) [-373.337] (-376.948) (-375.211) -- 0:00:17
714500 -- (-372.833) (-374.162) (-376.364) [-372.040] * (-377.150) (-376.915) (-382.063) [-375.691] -- 0:00:17
715000 -- [-371.822] (-376.382) (-371.878) (-377.859) * (-378.945) [-371.931] (-381.480) (-371.693) -- 0:00:17
Average standard deviation of split frequencies: 0.009300
715500 -- (-372.764) (-374.974) (-376.754) [-377.565] * (-373.104) [-371.814] (-372.645) (-372.295) -- 0:00:17
716000 -- (-374.960) [-371.983] (-375.501) (-379.424) * (-372.293) (-376.027) [-375.559] (-371.785) -- 0:00:17
716500 -- (-374.057) [-373.785] (-375.975) (-380.857) * [-372.689] (-374.744) (-373.275) (-371.559) -- 0:00:17
717000 -- (-381.758) (-380.810) [-377.606] (-374.358) * (-372.188) (-371.798) (-374.535) [-372.105] -- 0:00:16
717500 -- (-373.142) (-374.643) (-374.312) [-373.472] * (-372.227) [-373.745] (-373.734) (-374.419) -- 0:00:16
718000 -- (-374.556) (-371.931) (-376.418) [-376.265] * [-374.553] (-372.630) (-373.428) (-373.246) -- 0:00:16
718500 -- (-372.006) (-372.750) (-376.886) [-371.757] * (-371.971) (-374.320) (-375.185) [-378.980] -- 0:00:16
719000 -- (-371.737) (-375.939) (-372.390) [-373.365] * [-372.039] (-373.988) (-372.174) (-377.558) -- 0:00:16
719500 -- (-371.688) [-375.432] (-372.051) (-375.443) * (-373.325) (-372.310) (-373.804) [-371.453] -- 0:00:16
720000 -- (-372.540) [-373.057] (-372.379) (-375.542) * (-371.667) [-372.882] (-376.097) (-375.268) -- 0:00:16
Average standard deviation of split frequencies: 0.008953
720500 -- [-373.191] (-373.190) (-372.531) (-373.234) * (-373.797) (-372.319) [-374.189] (-373.701) -- 0:00:16
721000 -- [-374.256] (-371.773) (-373.421) (-376.068) * (-373.892) [-372.015] (-372.912) (-375.300) -- 0:00:16
721500 -- (-375.819) (-376.323) (-373.109) [-376.698] * (-373.383) (-372.023) [-373.099] (-373.436) -- 0:00:16
722000 -- (-374.018) (-376.328) (-380.571) [-371.980] * (-372.590) [-371.872] (-375.585) (-373.152) -- 0:00:16
722500 -- (-374.349) (-376.152) [-373.760] (-373.263) * (-372.422) (-374.288) [-372.046] (-371.983) -- 0:00:16
723000 -- (-374.654) (-375.570) [-374.416] (-375.467) * [-371.517] (-374.969) (-376.025) (-372.266) -- 0:00:16
723500 -- (-373.648) [-378.306] (-372.959) (-373.261) * (-371.730) (-373.679) (-374.296) [-373.589] -- 0:00:16
724000 -- (-372.877) (-377.254) [-372.488] (-372.044) * [-374.140] (-378.312) (-378.726) (-374.379) -- 0:00:16
724500 -- (-373.176) (-377.903) [-371.924] (-371.678) * (-376.562) (-375.928) (-375.997) [-373.347] -- 0:00:16
725000 -- [-374.744] (-374.959) (-372.553) (-373.014) * (-373.714) (-374.229) (-373.293) [-375.732] -- 0:00:16
Average standard deviation of split frequencies: 0.009090
725500 -- (-373.980) (-377.239) [-372.818] (-373.462) * (-375.008) [-372.929] (-376.510) (-374.568) -- 0:00:16
726000 -- (-371.616) (-372.959) (-375.665) [-373.113] * (-375.803) (-373.153) [-371.830] (-378.649) -- 0:00:16
726500 -- (-372.717) (-371.401) [-374.750] (-373.152) * (-372.975) (-375.743) (-373.909) [-372.198] -- 0:00:16
727000 -- (-374.724) (-373.102) [-377.498] (-373.104) * [-372.641] (-375.867) (-371.522) (-373.463) -- 0:00:16
727500 -- [-372.581] (-374.969) (-376.525) (-375.896) * [-372.984] (-372.359) (-373.973) (-378.624) -- 0:00:16
728000 -- (-373.208) [-372.359] (-379.802) (-373.331) * [-372.395] (-375.737) (-372.549) (-380.815) -- 0:00:16
728500 -- (-375.455) [-372.605] (-375.392) (-372.931) * (-373.846) (-375.055) (-373.972) [-375.395] -- 0:00:16
729000 -- (-376.558) (-374.847) (-371.713) [-372.216] * (-373.732) [-373.502] (-372.643) (-375.409) -- 0:00:15
729500 -- (-376.624) (-376.111) [-372.483] (-372.547) * (-375.781) (-373.737) (-373.647) [-373.158] -- 0:00:16
730000 -- (-372.711) [-372.731] (-374.083) (-374.447) * (-371.738) (-375.057) (-374.018) [-372.882] -- 0:00:16
Average standard deviation of split frequencies: 0.008956
730500 -- (-374.283) (-375.608) [-374.518] (-372.749) * [-373.849] (-373.009) (-373.728) (-372.621) -- 0:00:16
731000 -- [-373.954] (-372.851) (-373.301) (-372.249) * (-377.212) (-372.005) [-372.989] (-372.721) -- 0:00:16
731500 -- (-374.786) (-376.247) (-372.968) [-375.328] * (-371.689) (-374.551) [-372.381] (-374.196) -- 0:00:16
732000 -- (-372.236) (-373.095) [-372.461] (-373.001) * (-376.136) [-371.877] (-372.400) (-373.656) -- 0:00:16
732500 -- (-373.250) (-374.308) [-371.633] (-372.849) * (-381.831) [-372.333] (-377.262) (-372.220) -- 0:00:16
733000 -- (-372.546) [-374.840] (-371.958) (-372.766) * (-375.615) [-372.718] (-378.606) (-372.075) -- 0:00:16
733500 -- [-374.661] (-375.400) (-375.517) (-373.452) * [-374.283] (-371.687) (-374.189) (-373.493) -- 0:00:15
734000 -- (-372.901) (-376.370) (-378.570) [-372.278] * (-373.741) (-373.592) (-372.236) [-373.095] -- 0:00:15
734500 -- [-374.433] (-374.697) (-372.059) (-373.372) * (-375.732) (-377.107) (-373.765) [-375.649] -- 0:00:15
735000 -- (-374.502) (-373.006) (-375.289) [-372.353] * (-373.393) [-372.035] (-372.309) (-376.556) -- 0:00:15
Average standard deviation of split frequencies: 0.009367
735500 -- (-375.741) [-373.115] (-373.486) (-374.009) * (-372.687) (-372.599) [-372.488] (-372.142) -- 0:00:15
736000 -- [-375.962] (-371.729) (-374.508) (-377.714) * (-378.185) (-374.288) (-371.813) [-372.261] -- 0:00:15
736500 -- (-376.200) (-372.204) [-371.466] (-379.089) * [-373.660] (-376.259) (-372.026) (-372.154) -- 0:00:15
737000 -- [-375.183] (-374.377) (-373.245) (-374.812) * (-374.302) (-372.314) [-371.874] (-373.270) -- 0:00:15
737500 -- [-373.095] (-371.867) (-372.595) (-371.916) * (-374.428) [-372.236] (-372.781) (-372.030) -- 0:00:15
738000 -- (-372.511) (-371.806) [-371.771] (-375.476) * (-372.189) (-372.419) [-373.352] (-371.827) -- 0:00:15
738500 -- (-371.881) (-371.508) (-372.014) [-376.986] * (-373.912) [-373.110] (-372.938) (-378.034) -- 0:00:15
739000 -- [-371.330] (-372.075) (-377.573) (-375.386) * (-373.613) (-374.321) [-372.715] (-375.050) -- 0:00:15
739500 -- (-371.377) (-378.588) [-378.439] (-373.423) * (-372.756) (-375.611) (-373.625) [-371.441] -- 0:00:15
740000 -- (-375.251) (-371.801) [-371.819] (-373.278) * (-375.944) (-375.404) [-372.734] (-371.378) -- 0:00:15
Average standard deviation of split frequencies: 0.009467
740500 -- [-374.045] (-371.803) (-371.676) (-373.563) * [-376.755] (-376.855) (-376.791) (-372.824) -- 0:00:15
741000 -- (-372.262) (-372.244) (-375.765) [-372.887] * (-373.734) [-373.536] (-377.873) (-372.078) -- 0:00:15
741500 -- (-377.387) (-374.128) (-373.542) [-372.935] * (-374.391) (-381.333) [-372.379] (-371.810) -- 0:00:15
742000 -- (-377.460) [-375.196] (-381.204) (-374.171) * (-373.849) (-373.956) (-371.323) [-375.838] -- 0:00:15
742500 -- (-374.373) [-372.868] (-376.119) (-375.391) * (-377.983) (-372.856) [-372.418] (-375.658) -- 0:00:15
743000 -- (-373.769) [-373.384] (-375.399) (-375.125) * (-375.378) (-371.879) [-372.339] (-376.346) -- 0:00:15
743500 -- [-373.187] (-375.550) (-373.515) (-375.647) * (-376.326) [-372.386] (-371.585) (-373.988) -- 0:00:15
744000 -- (-376.371) (-372.213) [-373.219] (-377.017) * (-373.721) [-371.964] (-374.097) (-374.648) -- 0:00:15
744500 -- (-375.895) (-372.708) (-372.068) [-374.159] * (-374.311) [-376.195] (-374.384) (-375.310) -- 0:00:15
745000 -- (-375.997) [-372.853] (-373.224) (-372.696) * (-374.154) (-374.099) (-373.199) [-373.156] -- 0:00:15
Average standard deviation of split frequencies: 0.009558
745500 -- (-372.650) [-372.325] (-377.356) (-374.497) * (-372.710) (-372.927) (-373.073) [-372.464] -- 0:00:15
746000 -- (-372.322) (-373.658) (-376.994) [-374.665] * (-375.458) (-373.904) (-371.321) [-372.443] -- 0:00:14
746500 -- (-374.628) [-373.109] (-372.802) (-373.847) * [-373.334] (-373.963) (-372.072) (-373.051) -- 0:00:15
747000 -- [-373.059] (-372.701) (-371.380) (-374.039) * (-374.293) [-375.108] (-374.525) (-374.739) -- 0:00:15
747500 -- (-372.903) [-373.730] (-373.032) (-374.824) * (-373.346) (-376.133) (-373.044) [-374.738] -- 0:00:15
748000 -- (-373.680) (-376.279) [-371.964] (-374.482) * (-372.639) (-373.578) (-373.383) [-373.729] -- 0:00:15
748500 -- (-377.837) [-375.206] (-373.788) (-374.594) * (-373.038) [-372.942] (-372.938) (-373.348) -- 0:00:15
749000 -- (-372.569) (-376.027) [-372.092] (-373.425) * (-371.546) (-374.074) (-372.383) [-374.149] -- 0:00:15
749500 -- (-371.604) (-372.140) [-372.091] (-371.557) * [-371.690] (-372.073) (-372.625) (-373.580) -- 0:00:15
750000 -- (-372.048) [-374.735] (-374.071) (-371.614) * [-374.618] (-373.039) (-372.889) (-373.833) -- 0:00:15
Average standard deviation of split frequencies: 0.009145
750500 -- [-372.250] (-374.736) (-376.836) (-373.966) * [-374.832] (-374.530) (-372.139) (-378.047) -- 0:00:14
751000 -- (-378.969) (-372.779) [-376.314] (-376.536) * (-377.564) [-376.657] (-372.804) (-373.916) -- 0:00:14
751500 -- (-373.016) (-375.342) (-375.242) [-375.721] * [-373.053] (-373.183) (-374.218) (-373.682) -- 0:00:14
752000 -- (-372.878) (-374.304) (-377.160) [-373.320] * (-378.600) [-374.540] (-372.535) (-372.254) -- 0:00:14
752500 -- (-374.270) [-372.011] (-374.027) (-373.342) * (-372.818) (-372.945) [-372.070] (-371.530) -- 0:00:14
753000 -- (-373.486) [-375.018] (-372.306) (-371.753) * (-373.942) (-375.321) (-373.987) [-371.498] -- 0:00:14
753500 -- (-373.160) [-374.584] (-371.551) (-374.411) * (-372.915) [-372.706] (-376.125) (-376.727) -- 0:00:14
754000 -- (-371.859) (-375.373) (-373.376) [-372.704] * (-372.730) (-372.173) [-372.245] (-374.646) -- 0:00:14
754500 -- (-372.952) (-371.978) [-371.997] (-372.751) * (-372.912) (-373.509) [-376.234] (-372.840) -- 0:00:14
755000 -- [-372.263] (-374.099) (-371.995) (-373.683) * (-373.451) (-373.234) [-372.030] (-371.990) -- 0:00:14
Average standard deviation of split frequencies: 0.009119
755500 -- (-371.886) (-375.097) [-374.463] (-378.160) * (-374.022) (-375.759) [-371.187] (-372.427) -- 0:00:14
756000 -- (-373.924) (-371.675) (-373.483) [-372.589] * (-375.570) [-373.619] (-374.029) (-372.857) -- 0:00:14
756500 -- (-373.875) [-371.690] (-373.477) (-373.886) * (-374.325) (-372.498) [-372.969] (-378.079) -- 0:00:14
757000 -- (-373.995) (-374.188) (-373.541) [-371.988] * (-371.769) (-373.315) (-376.593) [-372.743] -- 0:00:14
757500 -- (-372.678) [-373.403] (-374.269) (-375.272) * (-376.007) (-376.945) [-372.115] (-371.929) -- 0:00:14
758000 -- (-376.833) [-374.200] (-377.527) (-375.349) * (-373.121) [-373.032] (-374.292) (-372.145) -- 0:00:14
758500 -- (-373.969) (-373.274) [-375.394] (-378.475) * (-374.062) (-376.436) [-372.431] (-374.603) -- 0:00:14
759000 -- [-376.963] (-376.736) (-375.215) (-375.107) * (-371.888) (-374.938) [-372.124] (-374.548) -- 0:00:14
759500 -- (-371.635) [-374.864] (-376.730) (-375.455) * (-373.127) [-372.288] (-371.390) (-371.761) -- 0:00:14
760000 -- (-372.432) (-380.906) [-373.015] (-373.738) * (-374.965) (-377.079) (-372.313) [-371.596] -- 0:00:14
Average standard deviation of split frequencies: 0.009373
760500 -- (-372.431) (-375.860) [-372.760] (-374.684) * (-373.388) (-376.893) (-373.346) [-375.549] -- 0:00:14
761000 -- (-372.597) (-374.454) (-379.999) [-371.290] * (-372.529) (-377.671) [-374.235] (-376.447) -- 0:00:14
761500 -- (-373.822) (-372.717) [-375.510] (-371.696) * [-374.635] (-376.488) (-376.786) (-372.850) -- 0:00:14
762000 -- (-372.533) [-375.234] (-373.722) (-373.430) * (-374.606) (-374.822) (-375.798) [-372.470] -- 0:00:14
762500 -- (-372.371) [-372.155] (-371.499) (-373.258) * (-372.284) (-374.770) (-373.800) [-376.450] -- 0:00:14
763000 -- [-376.752] (-374.041) (-374.996) (-374.441) * (-373.878) (-374.623) (-372.184) [-372.863] -- 0:00:13
763500 -- (-372.793) [-374.307] (-375.019) (-372.533) * [-374.000] (-374.076) (-375.131) (-377.149) -- 0:00:14
764000 -- (-373.042) [-374.656] (-378.214) (-371.922) * (-374.431) (-374.444) [-376.490] (-373.270) -- 0:00:14
764500 -- (-372.826) (-374.148) (-371.711) [-372.575] * (-371.915) [-377.813] (-373.124) (-377.123) -- 0:00:14
765000 -- (-372.431) (-373.854) (-372.690) [-374.976] * (-371.960) (-371.451) [-374.805] (-380.236) -- 0:00:14
Average standard deviation of split frequencies: 0.009267
765500 -- (-371.592) (-373.350) [-374.099] (-373.312) * (-371.692) [-371.895] (-373.258) (-373.456) -- 0:00:14
766000 -- (-373.020) (-376.576) [-372.297] (-373.654) * [-371.455] (-371.235) (-372.709) (-375.300) -- 0:00:14
766500 -- (-371.952) (-373.833) [-372.548] (-372.959) * [-372.306] (-371.442) (-374.612) (-372.899) -- 0:00:14
767000 -- (-373.036) (-372.905) (-373.182) [-372.786] * [-372.542] (-372.199) (-373.867) (-374.556) -- 0:00:13
767500 -- (-372.290) (-373.396) [-374.840] (-373.526) * (-375.848) [-374.906] (-373.700) (-373.956) -- 0:00:13
768000 -- [-372.646] (-375.900) (-372.468) (-372.666) * (-372.993) (-372.359) 