--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 17:47:57 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0475/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0475/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0475/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0475/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1024.97 -1031.24 2 -1024.98 -1028.27 -------------------------------------- TOTAL -1024.98 -1030.59 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0475/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0475/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0475/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.898672 0.090418 0.372106 1.513727 0.863286 1289.28 1366.90 1.001 r(A<->C){all} 0.168634 0.020546 0.000147 0.466311 0.127237 127.95 167.09 1.000 r(A<->G){all} 0.162088 0.018061 0.000035 0.433995 0.127718 219.74 233.34 1.001 r(A<->T){all} 0.174386 0.020659 0.000162 0.467472 0.137230 98.15 149.74 1.002 r(C<->G){all} 0.168621 0.019923 0.000165 0.449026 0.132453 250.38 264.88 1.000 r(C<->T){all} 0.159288 0.018099 0.000010 0.426010 0.123985 120.83 152.87 1.005 r(G<->T){all} 0.166983 0.021262 0.000123 0.470865 0.122721 129.82 210.74 1.000 pi(A){all} 0.205813 0.000211 0.177600 0.233956 0.205471 1252.07 1328.86 1.000 pi(C){all} 0.272146 0.000261 0.242070 0.303829 0.271533 1099.85 1258.07 1.000 pi(G){all} 0.335560 0.000293 0.303304 0.369787 0.335408 1001.43 1087.41 1.000 pi(T){all} 0.186481 0.000213 0.156978 0.213807 0.186215 1290.39 1308.64 1.000 alpha{1,2} 0.436693 0.241477 0.000126 1.425046 0.268726 1006.95 1142.41 1.000 alpha{3} 0.463834 0.241514 0.000461 1.457558 0.297232 970.80 1052.76 1.000 pinvar{all} 0.997923 0.000006 0.993542 0.999999 0.998675 1113.35 1230.74 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -958.382625 Model 2: PositiveSelection -958.382599 Model 0: one-ratio -958.382787 Model 7: beta -958.382599 Model 8: beta&w>1 -958.382751 Model 0 vs 1 3.2400000009147334E-4 Model 2 vs 1 5.199999986871262E-5 Model 8 vs 7 3.039999999145948E-4
>C1 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C2 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C3 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C4 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C5 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C6 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=251 C1 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C2 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C3 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C4 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C5 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C6 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY ************************************************** C1 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C2 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C3 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C4 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C5 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C6 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ************************************************** C1 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C2 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C3 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C4 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C5 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C6 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE ************************************************** C1 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C2 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C3 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C4 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C5 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C6 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA ************************************************** C1 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C2 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C3 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C4 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C5 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C6 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG ************************************************** C1 E C2 E C3 E C4 E C5 E C6 E * PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7530] Library Relaxation: Multi_proc [96] Relaxation Summary: [7530]--->[7530] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.494 Mb, Max= 30.804 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C2 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C3 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C4 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C5 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY C6 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY ************************************************** C1 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C2 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C3 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C4 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C5 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI C6 DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ************************************************** C1 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C2 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C3 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C4 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C5 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE C6 ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE ************************************************** C1 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C2 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C3 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C4 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C5 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA C6 DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA ************************************************** C1 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C2 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C3 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C4 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C5 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG C6 SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG ************************************************** C1 E C2 E C3 E C4 E C5 E C6 E * FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT C2 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT C3 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT C4 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT C5 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT C6 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT ************************************************** C1 TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG C2 TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG C3 TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG C4 TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG C5 TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG C6 TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG ************************************************** C1 TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC C2 TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC C3 TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC C4 TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC C5 TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC C6 TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC ************************************************** C1 GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA C2 GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA C3 GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA C4 GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA C5 GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA C6 GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA ************************************************** C1 ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC C2 ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC C3 ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC C4 ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC C5 ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC C6 ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC ************************************************** C1 AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC C2 AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC C3 AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC C4 AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC C5 AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC C6 AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC ************************************************** C1 GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC C2 GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC C3 GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC C4 GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC C5 GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC C6 GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC ************************************************** C1 GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC C2 GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC C3 GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC C4 GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC C5 GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC C6 GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC ************************************************** C1 TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA C2 TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA C3 TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA C4 TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA C5 TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA C6 TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA ************************************************** C1 GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA C2 GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA C3 GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA C4 GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA C5 GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA C6 GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA ************************************************** C1 CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG C2 CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG C3 CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG C4 CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG C5 CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG C6 CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG ************************************************** C1 TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT C2 TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT C3 TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT C4 TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT C5 TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT C6 TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT ************************************************** C1 AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA C2 AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA C3 AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA C4 AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA C5 AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA C6 AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA ************************************************** C1 GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG C2 GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG C3 GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG C4 GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG C5 GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG C6 GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG ************************************************** C1 TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC C2 TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC C3 TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC C4 TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC C5 TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC C6 TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC ************************************************** C1 GAG C2 GAG C3 GAG C4 GAG C5 GAG C6 GAG *** >C1 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC GAG >C2 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC GAG >C3 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC GAG >C4 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC GAG >C5 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC GAG >C6 ATGAGCGGCCATTCCAAGTGGGCCACCACCAAGCACAAAAAGGCTGTCAT TGATGCTCGCCGCGGCAAGATGTTCGCCCGGCTGATTAAGAACATTGAGG TTGCGGCTCGCGTCGGTGGTGGTGATCCAGTGGGCAACCCAACGCTCTAC GATGCGATCCAGAAAGCGAAGAAGAGCTCGGTGCCCAACGGGAACATCGA ACGGGCGCGCAAACGCGGCGCTGGCGAGGAGGTCGGTGGTGCCGACTGGC AAGTCATTACCTACGAGGGCTACGCACCCAACGGTGTGGCGGTCCTGATC GAATGTCTGACCGATAACCGCAACCGCGCAGCTGGTGAGGTGCGGGTGGC GATGACTCGCAATGGCGGTGCCATGGCTGATCCAGGGTCGGTGGCCTACC TGTTCTCTCGCAAGGGCGTGGTCACCTTGGAGAAGAACGGTCTCACCGAA GACGATGTGCTCGCTGCGGTGCTAGACGCCGGCGCTGAGGAGGTCAACGA CCTTGGTGACAGCTTCGAGGTGATTGCCGAGCCAGGTGATCTGGTTGCGG TCCGCACCGCGTTGCAGGATGCCGGCATCGACTACGAGTCAGCTGAAGCT AGTTTCCAGCCGTCGGTCAGCATGCCAGTTGACCTCGATGGCGCCCGCAA GGTATTCAAGCTTGTCGACGCGCTAGAGGACAGCGACGACGTGCATAATG TCTGGACTAATGCCGATGTATCCGACGAGGTGTTGGCCGCCCTTGACGGC GAG >C1 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C2 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C3 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C4 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C5 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E >C6 MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLY DAIQKAKKSSVPNGNIERARKRGAGEEVGGADWQVITYEGYAPNGVAVLI ECLTDNRNRAAGEVRVAMTRNGGAMADPGSVAYLFSRKGVVTLEKNGLTE DDVLAAVLDAGAEEVNDLGDSFEVIAEPGDLVAVRTALQDAGIDYESAEA SFQPSVSMPVDLDGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDG E MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0475/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 753 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579801596 Setting output file names to "/data/4res/ML0475/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 746592399 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 1694907107 Seed = 1822172690 Swapseed = 1579801596 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1685.250001 -- -24.965149 Chain 2 -- -1685.250098 -- -24.965149 Chain 3 -- -1685.249841 -- -24.965149 Chain 4 -- -1685.250098 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1685.250098 -- -24.965149 Chain 2 -- -1685.250001 -- -24.965149 Chain 3 -- -1685.250098 -- -24.965149 Chain 4 -- -1685.250098 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1685.250] (-1685.250) (-1685.250) (-1685.250) * [-1685.250] (-1685.250) (-1685.250) (-1685.250) 500 -- (-1032.303) (-1038.384) (-1040.716) [-1029.515] * (-1044.956) [-1048.760] (-1046.164) (-1046.958) -- 0:00:00 1000 -- (-1037.617) [-1034.644] (-1034.624) (-1036.190) * [-1036.397] (-1032.908) (-1041.719) (-1032.525) -- 0:00:00 1500 -- (-1037.523) (-1034.273) [-1032.387] (-1039.455) * [-1040.086] (-1038.424) (-1034.548) (-1035.953) -- 0:00:00 2000 -- (-1035.534) (-1033.981) (-1033.472) [-1027.927] * (-1039.146) [-1031.595] (-1038.539) (-1029.895) -- 0:00:00 2500 -- (-1039.644) (-1044.929) [-1031.859] (-1031.180) * (-1034.788) (-1035.414) [-1038.764] (-1035.256) -- 0:00:00 3000 -- (-1035.469) (-1038.968) [-1029.172] (-1031.327) * [-1034.068] (-1033.609) (-1040.316) (-1034.772) -- 0:00:00 3500 -- [-1033.401] (-1035.948) (-1030.054) (-1037.349) * [-1030.005] (-1037.516) (-1035.297) (-1027.999) -- 0:00:00 4000 -- (-1038.041) (-1046.123) (-1040.026) [-1032.906] * [-1037.832] (-1036.346) (-1047.279) (-1034.991) -- 0:00:00 4500 -- [-1036.915] (-1038.830) (-1036.984) (-1037.226) * (-1041.281) [-1032.578] (-1029.936) (-1042.575) -- 0:00:00 5000 -- (-1044.405) (-1032.270) (-1032.438) [-1035.419] * (-1028.038) (-1035.642) (-1035.636) [-1028.943] -- 0:00:00 Average standard deviation of split frequencies: 0.070711 5500 -- [-1033.520] (-1034.556) (-1040.407) (-1036.939) * (-1035.632) [-1033.735] (-1032.984) (-1036.696) -- 0:00:00 6000 -- [-1035.001] (-1035.301) (-1034.708) (-1043.168) * [-1040.596] (-1033.157) (-1031.933) (-1034.837) -- 0:00:00 6500 -- [-1037.565] (-1031.081) (-1039.441) (-1033.498) * (-1028.980) (-1038.564) [-1044.950] (-1034.424) -- 0:00:00 7000 -- (-1042.294) (-1036.076) [-1036.137] (-1036.131) * (-1037.289) [-1038.089] (-1044.646) (-1039.885) -- 0:02:21 7500 -- (-1038.620) [-1032.010] (-1030.373) (-1037.283) * (-1032.303) (-1033.110) [-1029.772] (-1032.876) -- 0:02:12 8000 -- [-1030.075] (-1035.769) (-1035.555) (-1031.476) * (-1038.644) [-1032.976] (-1046.094) (-1035.703) -- 0:02:04 8500 -- (-1024.381) [-1033.799] (-1027.476) (-1036.047) * [-1032.968] (-1037.401) (-1034.809) (-1040.364) -- 0:01:56 9000 -- (-1024.568) (-1036.118) [-1032.118] (-1036.715) * (-1047.973) [-1032.167] (-1035.677) (-1028.718) -- 0:01:50 9500 -- (-1028.116) (-1030.768) [-1035.987] (-1032.654) * (-1034.035) (-1032.717) (-1031.165) [-1032.801] -- 0:01:44 10000 -- (-1026.000) (-1035.689) [-1029.789] (-1035.475) * (-1033.143) (-1034.245) [-1034.651] (-1039.045) -- 0:01:39 Average standard deviation of split frequencies: 0.072106 10500 -- (-1028.105) (-1032.052) [-1035.425] (-1029.964) * [-1045.388] (-1036.037) (-1032.476) (-1039.190) -- 0:01:34 11000 -- (-1025.873) [-1037.870] (-1040.527) (-1031.085) * (-1039.584) (-1037.187) (-1026.746) [-1026.811] -- 0:01:29 11500 -- (-1028.859) [-1030.742] (-1036.729) (-1032.127) * (-1033.932) [-1034.829] (-1031.465) (-1033.938) -- 0:01:25 12000 -- (-1024.644) (-1042.708) (-1040.511) [-1033.112] * (-1042.471) (-1036.734) (-1036.320) [-1035.366] -- 0:01:22 12500 -- [-1024.829] (-1046.652) (-1032.410) (-1042.335) * (-1033.705) [-1030.927] (-1031.302) (-1037.566) -- 0:01:19 13000 -- (-1024.327) (-1037.575) [-1034.190] (-1030.017) * (-1035.031) (-1036.923) [-1036.442] (-1037.100) -- 0:01:15 13500 -- (-1024.456) (-1028.921) [-1037.361] (-1036.730) * [-1031.594] (-1034.563) (-1039.703) (-1038.084) -- 0:01:13 14000 -- (-1025.583) (-1026.726) (-1036.256) [-1039.073] * [-1028.973] (-1038.411) (-1034.618) (-1036.321) -- 0:01:10 14500 -- (-1025.471) (-1024.847) [-1034.188] (-1033.701) * [-1032.730] (-1039.598) (-1039.242) (-1035.225) -- 0:01:07 15000 -- (-1024.824) (-1025.936) [-1032.441] (-1039.274) * [-1030.603] (-1039.686) (-1041.751) (-1036.646) -- 0:01:05 Average standard deviation of split frequencies: 0.052378 15500 -- (-1026.347) (-1027.622) (-1032.250) [-1043.833] * (-1036.122) (-1035.063) [-1032.336] (-1037.813) -- 0:01:03 16000 -- (-1027.964) (-1024.973) (-1037.252) [-1035.052] * (-1037.583) [-1030.386] (-1032.917) (-1037.016) -- 0:01:01 16500 -- (-1027.138) (-1025.882) (-1029.915) [-1035.736] * (-1036.427) (-1039.436) [-1037.804] (-1033.850) -- 0:00:59 17000 -- (-1025.310) [-1023.584] (-1047.303) (-1043.580) * [-1031.551] (-1031.898) (-1036.440) (-1031.368) -- 0:00:57 17500 -- (-1025.454) (-1025.754) (-1040.787) [-1028.662] * (-1039.399) [-1039.872] (-1036.937) (-1032.800) -- 0:00:56 18000 -- (-1024.393) (-1025.704) (-1025.846) [-1026.530] * (-1036.932) [-1037.930] (-1031.774) (-1034.734) -- 0:00:54 18500 -- [-1024.745] (-1026.596) (-1027.184) (-1027.237) * [-1035.454] (-1033.105) (-1033.818) (-1036.902) -- 0:00:53 19000 -- (-1026.385) [-1024.841] (-1027.527) (-1026.181) * (-1033.483) [-1030.767] (-1036.190) (-1038.619) -- 0:00:51 19500 -- (-1025.566) [-1025.469] (-1024.751) (-1025.637) * [-1030.951] (-1039.949) (-1036.609) (-1037.267) -- 0:00:50 20000 -- (-1027.138) (-1025.528) [-1025.791] (-1024.808) * (-1036.484) (-1040.109) [-1033.839] (-1035.836) -- 0:00:49 Average standard deviation of split frequencies: 0.042769 20500 -- [-1026.394] (-1025.013) (-1027.735) (-1028.040) * (-1036.823) (-1036.233) [-1029.897] (-1042.455) -- 0:00:47 21000 -- (-1027.280) [-1024.720] (-1026.179) (-1025.911) * (-1038.238) (-1036.452) [-1034.845] (-1038.859) -- 0:00:46 21500 -- (-1024.938) [-1024.050] (-1025.226) (-1025.666) * (-1036.291) (-1033.412) [-1035.013] (-1036.556) -- 0:00:45 22000 -- (-1023.463) (-1025.864) [-1025.090] (-1027.484) * (-1044.269) (-1038.078) [-1033.374] (-1034.354) -- 0:01:28 22500 -- (-1024.476) (-1025.300) (-1028.010) [-1028.733] * (-1031.183) (-1031.161) (-1035.445) [-1037.930] -- 0:01:26 23000 -- (-1025.346) [-1028.001] (-1027.080) (-1026.589) * [-1037.632] (-1032.889) (-1030.608) (-1038.755) -- 0:01:24 23500 -- [-1024.474] (-1024.362) (-1024.558) (-1025.541) * [-1031.535] (-1031.230) (-1042.764) (-1037.440) -- 0:01:23 24000 -- [-1024.610] (-1023.708) (-1026.693) (-1026.062) * (-1040.267) [-1029.107] (-1034.888) (-1045.955) -- 0:01:21 24500 -- (-1027.121) (-1027.528) (-1027.994) [-1024.082] * (-1035.746) (-1031.956) (-1034.857) [-1034.131] -- 0:01:19 25000 -- [-1025.097] (-1026.644) (-1025.779) (-1023.920) * (-1042.234) (-1033.643) [-1032.097] (-1033.011) -- 0:01:18 Average standard deviation of split frequencies: 0.029010 25500 -- (-1025.803) (-1027.991) [-1025.526] (-1025.994) * (-1032.044) [-1038.454] (-1034.599) (-1029.716) -- 0:01:16 26000 -- [-1027.565] (-1028.746) (-1028.331) (-1023.971) * (-1034.686) (-1034.746) (-1032.656) [-1032.626] -- 0:01:14 26500 -- (-1029.507) (-1025.247) (-1026.667) [-1024.000] * (-1030.881) (-1049.161) [-1032.420] (-1038.288) -- 0:01:13 27000 -- (-1025.131) (-1029.309) (-1028.394) [-1024.618] * [-1034.485] (-1029.977) (-1043.729) (-1033.610) -- 0:01:12 27500 -- [-1024.684] (-1025.563) (-1025.498) (-1024.213) * [-1028.685] (-1025.261) (-1030.543) (-1037.924) -- 0:01:10 28000 -- (-1024.010) (-1026.003) (-1024.775) [-1025.950] * [-1031.857] (-1025.850) (-1035.403) (-1032.462) -- 0:01:09 28500 -- (-1023.547) (-1025.831) (-1024.695) [-1025.663] * (-1038.268) (-1025.652) [-1036.705] (-1036.974) -- 0:01:08 29000 -- (-1025.295) (-1027.614) [-1026.250] (-1026.701) * (-1037.916) [-1024.849] (-1034.779) (-1031.330) -- 0:01:06 29500 -- (-1025.195) [-1025.347] (-1026.223) (-1027.743) * (-1031.239) (-1025.208) [-1032.034] (-1037.487) -- 0:01:05 30000 -- [-1023.805] (-1028.132) (-1025.837) (-1024.235) * (-1042.578) [-1026.040] (-1038.470) (-1029.526) -- 0:01:04 Average standard deviation of split frequencies: 0.030744 30500 -- (-1024.425) (-1024.586) (-1025.092) [-1026.031] * [-1036.598] (-1026.465) (-1037.465) (-1030.062) -- 0:01:03 31000 -- (-1025.762) (-1026.831) (-1028.147) [-1025.296] * (-1034.261) (-1024.081) [-1042.956] (-1039.613) -- 0:01:02 31500 -- (-1025.780) [-1025.199] (-1025.202) (-1029.067) * [-1048.510] (-1025.224) (-1038.110) (-1033.798) -- 0:01:01 32000 -- (-1026.421) (-1024.954) (-1027.834) [-1028.380] * (-1035.164) (-1023.997) [-1034.943] (-1033.184) -- 0:01:00 32500 -- (-1029.306) [-1025.124] (-1024.667) (-1029.412) * (-1031.707) (-1024.482) [-1032.219] (-1030.567) -- 0:00:59 33000 -- (-1025.695) (-1027.101) (-1024.332) [-1024.435] * (-1032.987) (-1024.307) [-1030.757] (-1030.806) -- 0:00:58 33500 -- [-1026.849] (-1025.099) (-1026.060) (-1023.681) * (-1037.545) (-1024.997) (-1032.742) [-1036.914] -- 0:00:57 34000 -- [-1024.805] (-1024.673) (-1025.539) (-1025.696) * (-1036.566) (-1024.518) (-1030.322) [-1031.427] -- 0:00:56 34500 -- (-1025.627) (-1024.830) [-1023.290] (-1026.260) * [-1030.556] (-1024.610) (-1046.067) (-1034.618) -- 0:00:55 35000 -- [-1024.415] (-1025.540) (-1027.497) (-1025.354) * (-1031.184) (-1023.854) [-1028.856] (-1034.377) -- 0:00:55 Average standard deviation of split frequencies: 0.036010 35500 -- (-1026.180) (-1026.005) (-1024.871) [-1024.377] * (-1029.296) (-1025.139) (-1027.731) [-1034.639] -- 0:00:54 36000 -- (-1024.647) [-1025.722] (-1024.410) (-1025.818) * (-1034.538) (-1025.171) (-1024.033) [-1036.207] -- 0:00:53 36500 -- (-1025.782) (-1027.236) (-1025.331) [-1023.944] * (-1037.103) (-1024.345) [-1029.731] (-1032.825) -- 0:00:52 37000 -- (-1024.384) (-1024.838) (-1024.486) [-1024.136] * (-1038.675) (-1024.971) (-1025.223) [-1031.954] -- 0:00:52 37500 -- (-1025.248) [-1024.789] (-1023.448) (-1028.438) * [-1034.651] (-1025.479) (-1025.992) (-1045.392) -- 0:00:51 38000 -- (-1025.001) (-1026.466) [-1025.011] (-1024.237) * (-1042.854) (-1026.262) [-1025.366] (-1039.300) -- 0:01:15 38500 -- (-1027.729) (-1025.560) [-1025.914] (-1027.123) * (-1031.853) [-1023.880] (-1027.440) (-1037.394) -- 0:01:14 39000 -- (-1029.328) (-1024.678) [-1028.457] (-1026.549) * (-1034.520) (-1025.986) [-1024.813] (-1039.042) -- 0:01:13 39500 -- (-1024.045) [-1024.964] (-1025.849) (-1023.694) * (-1041.946) (-1023.507) [-1023.819] (-1032.487) -- 0:01:12 40000 -- (-1024.668) (-1024.514) (-1025.668) [-1023.435] * (-1048.755) (-1024.858) [-1023.415] (-1036.736) -- 0:01:12 Average standard deviation of split frequencies: 0.033556 40500 -- (-1024.804) (-1024.281) [-1027.143] (-1026.004) * [-1040.579] (-1028.171) (-1025.052) (-1037.213) -- 0:01:11 41000 -- (-1026.131) [-1024.325] (-1026.653) (-1025.319) * (-1036.027) (-1029.973) [-1023.988] (-1038.855) -- 0:01:10 41500 -- (-1030.007) (-1023.859) (-1025.854) [-1024.419] * (-1037.075) (-1029.700) [-1029.590] (-1037.580) -- 0:01:09 42000 -- (-1026.771) (-1023.713) [-1025.827] (-1025.222) * (-1031.925) [-1032.027] (-1031.614) (-1044.233) -- 0:01:08 42500 -- (-1029.256) (-1023.884) [-1025.398] (-1025.913) * (-1034.245) (-1029.913) [-1029.473] (-1033.470) -- 0:01:07 43000 -- (-1029.426) (-1025.874) [-1025.028] (-1024.236) * (-1044.271) [-1026.619] (-1029.069) (-1030.706) -- 0:01:06 43500 -- (-1027.657) [-1026.213] (-1025.313) (-1026.031) * [-1037.554] (-1025.773) (-1023.901) (-1032.458) -- 0:01:05 44000 -- [-1023.686] (-1027.871) (-1027.909) (-1030.052) * (-1037.356) [-1023.503] (-1024.107) (-1040.082) -- 0:01:05 44500 -- (-1024.403) (-1027.425) (-1026.984) [-1030.625] * [-1035.371] (-1023.349) (-1024.864) (-1034.198) -- 0:01:04 45000 -- [-1024.356] (-1027.852) (-1027.021) (-1025.123) * (-1037.756) [-1024.291] (-1026.227) (-1045.401) -- 0:01:03 Average standard deviation of split frequencies: 0.031720 45500 -- [-1024.358] (-1029.393) (-1027.135) (-1024.558) * (-1040.572) (-1028.026) (-1026.638) [-1037.197] -- 0:01:02 46000 -- (-1025.724) (-1029.727) [-1024.191] (-1025.303) * (-1038.026) [-1025.121] (-1025.188) (-1037.514) -- 0:01:02 46500 -- [-1024.615] (-1026.463) (-1026.478) (-1025.988) * [-1031.451] (-1025.197) (-1023.442) (-1044.553) -- 0:01:01 47000 -- [-1024.179] (-1030.396) (-1026.046) (-1023.972) * [-1030.245] (-1024.806) (-1027.150) (-1038.147) -- 0:01:00 47500 -- (-1025.930) (-1029.102) [-1024.259] (-1024.820) * (-1029.297) (-1028.066) [-1025.505] (-1032.988) -- 0:01:00 48000 -- (-1027.352) (-1027.176) [-1024.258] (-1026.298) * (-1034.330) (-1024.328) (-1024.675) [-1030.012] -- 0:00:59 48500 -- (-1023.862) (-1025.804) [-1024.266] (-1026.785) * [-1035.595] (-1024.846) (-1026.407) (-1032.716) -- 0:00:58 49000 -- [-1024.178] (-1025.382) (-1024.583) (-1026.435) * (-1029.939) (-1025.033) (-1025.362) [-1030.975] -- 0:00:58 49500 -- (-1023.978) (-1026.474) [-1025.682] (-1025.897) * (-1031.566) [-1024.968] (-1025.703) (-1040.096) -- 0:00:57 50000 -- [-1024.394] (-1028.553) (-1023.576) (-1026.147) * (-1041.078) (-1025.445) [-1027.439] (-1044.562) -- 0:00:57 Average standard deviation of split frequencies: 0.029604 50500 -- [-1027.104] (-1029.557) (-1023.894) (-1029.382) * (-1045.840) [-1027.594] (-1024.885) (-1032.873) -- 0:00:56 51000 -- [-1025.299] (-1029.539) (-1024.398) (-1027.208) * (-1033.088) (-1027.950) [-1026.255] (-1034.101) -- 0:00:55 51500 -- (-1023.584) (-1026.982) (-1023.356) [-1027.977] * (-1033.592) (-1025.539) [-1023.364] (-1031.217) -- 0:00:55 52000 -- (-1027.370) (-1029.203) [-1026.041] (-1031.616) * (-1033.660) [-1027.045] (-1025.228) (-1038.957) -- 0:00:54 52500 -- (-1026.991) [-1026.208] (-1024.006) (-1028.131) * (-1033.526) (-1027.262) (-1025.380) [-1034.057] -- 0:00:54 53000 -- (-1026.504) (-1026.426) [-1027.162] (-1025.851) * (-1027.892) (-1028.674) [-1025.210] (-1035.139) -- 0:00:53 53500 -- [-1025.606] (-1029.174) (-1024.691) (-1024.492) * (-1026.622) (-1026.366) [-1024.382] (-1023.521) -- 0:00:53 54000 -- (-1024.897) [-1026.375] (-1028.281) (-1024.428) * (-1024.220) (-1026.822) (-1026.525) [-1023.703] -- 0:00:52 54500 -- (-1025.050) (-1028.471) (-1029.580) [-1025.396] * (-1024.374) [-1025.127] (-1024.679) (-1026.545) -- 0:01:09 55000 -- (-1027.214) [-1028.325] (-1024.692) (-1029.318) * [-1024.228] (-1027.466) (-1026.916) (-1029.448) -- 0:01:08 Average standard deviation of split frequencies: 0.027912 55500 -- [-1023.991] (-1025.874) (-1024.692) (-1026.242) * (-1024.553) (-1028.904) (-1025.594) [-1027.887] -- 0:01:08 56000 -- [-1024.109] (-1024.646) (-1026.661) (-1027.275) * (-1024.339) (-1025.530) (-1027.690) [-1026.333] -- 0:01:07 56500 -- (-1024.445) (-1025.911) [-1027.646] (-1025.338) * (-1024.233) (-1024.898) [-1028.190] (-1025.502) -- 0:01:06 57000 -- (-1025.362) (-1027.805) (-1031.704) [-1025.445] * (-1024.267) [-1024.898] (-1026.675) (-1028.841) -- 0:01:06 57500 -- (-1025.320) [-1024.831] (-1026.078) (-1025.894) * (-1024.469) [-1025.994] (-1024.415) (-1025.315) -- 0:01:05 58000 -- (-1030.453) (-1023.783) [-1025.384] (-1025.382) * (-1027.568) [-1023.895] (-1025.246) (-1024.660) -- 0:01:04 58500 -- [-1024.698] (-1023.669) (-1026.094) (-1025.676) * (-1025.163) (-1024.576) (-1024.651) [-1025.349] -- 0:01:04 59000 -- (-1026.725) [-1023.892] (-1025.352) (-1025.026) * (-1024.337) [-1025.144] (-1024.921) (-1025.534) -- 0:01:03 59500 -- [-1025.670] (-1024.730) (-1024.862) (-1024.985) * (-1027.977) (-1024.764) [-1026.106] (-1026.931) -- 0:01:03 60000 -- (-1025.248) (-1025.879) [-1025.478] (-1027.732) * (-1025.558) [-1023.611] (-1028.956) (-1024.647) -- 0:01:02 Average standard deviation of split frequencies: 0.029916 60500 -- (-1025.466) (-1025.624) [-1025.075] (-1026.990) * (-1025.718) (-1024.511) (-1029.746) [-1026.884] -- 0:01:02 61000 -- (-1027.580) (-1025.062) [-1025.102] (-1025.804) * (-1028.854) (-1026.297) (-1027.472) [-1024.420] -- 0:01:01 61500 -- (-1029.002) (-1025.179) (-1026.002) [-1024.715] * [-1028.697] (-1025.638) (-1024.441) (-1023.849) -- 0:01:01 62000 -- (-1025.140) (-1027.486) (-1026.637) [-1024.717] * (-1025.095) (-1023.563) (-1024.527) [-1024.486] -- 0:01:00 62500 -- [-1024.020] (-1023.882) (-1026.607) (-1025.441) * [-1025.127] (-1024.980) (-1026.211) (-1024.830) -- 0:01:00 63000 -- (-1026.775) (-1027.782) [-1024.600] (-1029.116) * (-1024.131) (-1025.095) (-1026.373) [-1026.546] -- 0:00:59 63500 -- [-1024.482] (-1030.944) (-1024.916) (-1024.904) * (-1026.847) (-1026.815) (-1026.863) [-1024.814] -- 0:00:58 64000 -- [-1024.082] (-1025.101) (-1027.062) (-1025.419) * (-1025.656) (-1026.489) [-1027.832] (-1023.595) -- 0:00:58 64500 -- (-1024.539) (-1023.433) [-1024.410] (-1025.521) * (-1023.929) (-1023.613) [-1025.460] (-1024.422) -- 0:00:58 65000 -- (-1026.887) [-1025.271] (-1027.499) (-1027.369) * (-1026.186) (-1027.990) (-1025.233) [-1024.959] -- 0:00:57 Average standard deviation of split frequencies: 0.029219 65500 -- (-1024.347) (-1024.984) (-1026.432) [-1026.926] * (-1024.267) [-1024.222] (-1026.273) (-1026.269) -- 0:00:57 66000 -- (-1023.788) (-1025.200) [-1025.188] (-1025.566) * (-1026.011) (-1025.740) (-1026.683) [-1023.872] -- 0:00:56 66500 -- [-1023.590] (-1025.970) (-1028.029) (-1026.717) * (-1034.389) (-1024.936) (-1027.927) [-1027.772] -- 0:00:56 67000 -- [-1024.825] (-1028.383) (-1026.137) (-1025.345) * (-1027.078) [-1023.693] (-1025.800) (-1025.945) -- 0:00:55 67500 -- [-1026.390] (-1025.459) (-1027.779) (-1025.733) * (-1026.944) (-1023.385) [-1030.739] (-1026.765) -- 0:00:55 68000 -- (-1025.390) (-1025.546) [-1023.244] (-1024.265) * (-1026.648) (-1023.798) (-1031.838) [-1027.375] -- 0:00:54 68500 -- (-1024.915) (-1027.612) (-1024.948) [-1025.728] * [-1025.998] (-1026.820) (-1032.710) (-1023.728) -- 0:00:54 69000 -- (-1025.160) (-1029.445) (-1026.053) [-1025.222] * (-1026.064) (-1026.377) (-1027.503) [-1023.726] -- 0:00:53 69500 -- (-1027.201) (-1027.593) [-1024.954] (-1029.007) * (-1024.968) (-1024.638) [-1025.005] (-1024.894) -- 0:00:53 70000 -- [-1025.032] (-1028.065) (-1024.282) (-1029.190) * (-1028.199) (-1025.313) [-1025.425] (-1024.956) -- 0:00:53 Average standard deviation of split frequencies: 0.029352 70500 -- (-1026.841) (-1028.993) [-1023.777] (-1026.394) * (-1027.045) (-1025.251) [-1026.751] (-1027.342) -- 0:00:52 71000 -- [-1027.043] (-1023.670) (-1024.938) (-1025.902) * [-1027.821] (-1026.484) (-1030.166) (-1027.303) -- 0:00:52 71500 -- (-1025.206) (-1025.661) [-1024.323] (-1028.864) * [-1026.270] (-1025.604) (-1027.599) (-1024.461) -- 0:01:04 72000 -- (-1026.992) [-1023.780] (-1026.856) (-1024.326) * (-1025.803) [-1027.832] (-1031.206) (-1025.649) -- 0:01:04 72500 -- (-1027.039) [-1024.058] (-1027.034) (-1024.823) * (-1030.975) [-1025.223] (-1028.233) (-1029.502) -- 0:01:03 73000 -- (-1026.370) (-1024.718) (-1029.724) [-1029.414] * [-1025.709] (-1025.578) (-1025.083) (-1030.025) -- 0:01:03 73500 -- (-1028.518) (-1027.349) (-1025.107) [-1024.453] * [-1025.143] (-1025.832) (-1026.599) (-1025.891) -- 0:01:03 74000 -- [-1023.615] (-1025.630) (-1025.569) (-1026.500) * [-1024.891] (-1030.280) (-1027.152) (-1028.077) -- 0:01:02 74500 -- (-1025.169) [-1024.912] (-1026.941) (-1025.582) * (-1026.638) [-1025.860] (-1024.636) (-1026.600) -- 0:01:02 75000 -- (-1026.695) (-1024.907) [-1026.812] (-1024.524) * (-1026.250) (-1025.644) [-1023.394] (-1025.717) -- 0:01:01 Average standard deviation of split frequencies: 0.030732 75500 -- (-1024.788) [-1025.792] (-1027.014) (-1023.526) * (-1032.545) (-1026.817) (-1025.999) [-1024.143] -- 0:01:01 76000 -- (-1024.680) (-1024.977) (-1026.209) [-1024.826] * (-1027.218) (-1025.575) [-1023.912] (-1024.534) -- 0:01:00 76500 -- (-1029.290) (-1025.904) (-1025.706) [-1024.127] * (-1029.471) [-1024.108] (-1024.866) (-1025.136) -- 0:01:00 77000 -- (-1030.363) (-1024.862) [-1023.977] (-1024.367) * (-1035.072) (-1030.078) [-1024.002] (-1026.792) -- 0:00:59 77500 -- (-1031.079) [-1024.632] (-1026.874) (-1024.870) * (-1030.359) (-1024.937) [-1026.405] (-1025.833) -- 0:00:59 78000 -- (-1030.757) [-1024.991] (-1026.036) (-1024.150) * [-1027.207] (-1027.407) (-1025.951) (-1024.786) -- 0:00:59 78500 -- [-1024.906] (-1024.014) (-1029.986) (-1027.516) * [-1026.598] (-1029.019) (-1025.795) (-1024.687) -- 0:00:58 79000 -- [-1024.684] (-1024.065) (-1026.442) (-1028.158) * (-1027.277) (-1028.210) [-1024.897] (-1026.325) -- 0:00:58 79500 -- (-1027.970) [-1026.306] (-1024.939) (-1026.502) * (-1026.399) (-1029.106) [-1026.427] (-1025.833) -- 0:00:57 80000 -- [-1023.976] (-1024.924) (-1024.985) (-1027.582) * (-1027.670) (-1027.915) [-1024.351] (-1026.843) -- 0:00:57 Average standard deviation of split frequencies: 0.029804 80500 -- (-1024.208) (-1027.513) [-1025.400] (-1027.181) * [-1028.124] (-1023.876) (-1025.813) (-1026.163) -- 0:00:57 81000 -- [-1024.713] (-1027.821) (-1024.898) (-1025.522) * (-1025.411) (-1024.036) (-1024.483) [-1023.516] -- 0:00:56 81500 -- [-1027.698] (-1030.209) (-1025.154) (-1025.402) * [-1030.461] (-1024.735) (-1028.600) (-1023.866) -- 0:00:56 82000 -- (-1027.195) [-1028.855] (-1024.188) (-1024.846) * (-1026.409) (-1025.007) (-1027.682) [-1024.121] -- 0:00:55 82500 -- [-1026.409] (-1029.173) (-1027.144) (-1024.011) * (-1026.333) [-1026.131] (-1025.636) (-1027.063) -- 0:00:55 83000 -- (-1027.762) [-1026.096] (-1024.584) (-1024.535) * [-1023.964] (-1026.182) (-1025.555) (-1030.586) -- 0:00:55 83500 -- (-1026.957) [-1029.954] (-1024.074) (-1030.886) * [-1025.430] (-1034.101) (-1025.418) (-1029.106) -- 0:00:54 84000 -- (-1028.931) [-1026.841] (-1024.721) (-1031.150) * (-1024.178) (-1025.443) (-1025.132) [-1025.602] -- 0:00:54 84500 -- (-1031.815) (-1026.414) [-1026.020] (-1030.124) * (-1024.840) (-1025.800) (-1030.867) [-1028.015] -- 0:00:54 85000 -- (-1027.067) [-1025.825] (-1024.112) (-1027.817) * (-1024.878) (-1024.298) [-1026.690] (-1025.522) -- 0:00:53 Average standard deviation of split frequencies: 0.026624 85500 -- (-1023.850) (-1025.619) (-1025.199) [-1026.371] * (-1027.826) [-1024.037] (-1030.786) (-1031.139) -- 0:00:53 86000 -- (-1024.219) [-1024.834] (-1025.645) (-1028.155) * (-1024.617) (-1025.343) (-1027.294) [-1028.456] -- 0:00:53 86500 -- [-1026.302] (-1025.621) (-1026.207) (-1025.273) * (-1028.251) [-1027.696] (-1025.274) (-1025.363) -- 0:00:52 87000 -- (-1024.662) (-1025.023) [-1027.534] (-1025.782) * (-1025.080) [-1028.191] (-1027.102) (-1025.254) -- 0:00:52 87500 -- (-1025.286) (-1025.871) (-1026.341) [-1026.872] * (-1024.013) [-1027.647] (-1030.689) (-1026.231) -- 0:01:02 88000 -- [-1027.621] (-1025.431) (-1025.047) (-1024.888) * (-1025.169) [-1030.372] (-1027.553) (-1027.825) -- 0:01:02 88500 -- (-1031.717) (-1026.134) (-1024.517) [-1025.541] * [-1024.308] (-1030.400) (-1025.989) (-1024.983) -- 0:01:01 89000 -- [-1027.959] (-1029.453) (-1025.536) (-1026.041) * (-1026.309) [-1024.457] (-1024.290) (-1027.182) -- 0:01:01 89500 -- (-1028.429) (-1027.564) [-1029.285] (-1026.323) * [-1025.606] (-1025.699) (-1024.003) (-1025.625) -- 0:01:01 90000 -- [-1024.288] (-1024.690) (-1030.701) (-1025.327) * [-1024.324] (-1024.614) (-1024.567) (-1024.492) -- 0:01:00 Average standard deviation of split frequencies: 0.025749 90500 -- [-1025.925] (-1027.656) (-1025.913) (-1024.227) * [-1026.613] (-1024.886) (-1027.898) (-1024.035) -- 0:01:00 91000 -- (-1028.558) [-1024.391] (-1025.427) (-1025.584) * (-1030.408) (-1025.980) (-1026.106) [-1024.435] -- 0:00:59 91500 -- (-1029.090) (-1025.722) [-1024.761] (-1023.542) * (-1027.001) (-1026.523) (-1026.056) [-1025.241] -- 0:00:59 92000 -- (-1025.646) (-1024.514) (-1025.615) [-1026.437] * (-1023.399) (-1026.525) (-1027.599) [-1025.194] -- 0:00:59 92500 -- (-1028.860) (-1027.976) [-1026.447] (-1027.576) * [-1024.112] (-1026.221) (-1025.451) (-1026.887) -- 0:00:58 93000 -- [-1029.956] (-1024.644) (-1025.619) (-1025.483) * (-1023.891) [-1024.986] (-1027.114) (-1025.621) -- 0:00:58 93500 -- [-1027.468] (-1030.047) (-1024.731) (-1025.621) * (-1030.313) (-1025.144) [-1026.991] (-1027.274) -- 0:00:58 94000 -- (-1026.661) (-1026.464) (-1025.557) [-1027.403] * (-1025.193) [-1027.317] (-1024.109) (-1025.350) -- 0:00:57 94500 -- (-1029.238) [-1023.713] (-1024.209) (-1026.490) * (-1025.753) [-1024.190] (-1024.586) (-1023.831) -- 0:00:57 95000 -- (-1026.066) [-1023.410] (-1024.028) (-1026.206) * (-1024.947) (-1026.979) (-1025.379) [-1025.789] -- 0:00:57 Average standard deviation of split frequencies: 0.025488 95500 -- (-1025.930) (-1025.377) (-1024.816) [-1024.508] * (-1028.411) (-1024.425) (-1029.172) [-1025.695] -- 0:00:56 96000 -- (-1025.655) (-1024.297) (-1024.013) [-1027.042] * [-1025.534] (-1026.488) (-1027.931) (-1025.638) -- 0:00:56 96500 -- (-1027.968) [-1024.240] (-1023.943) (-1024.490) * (-1024.421) [-1024.006] (-1024.492) (-1026.274) -- 0:00:56 97000 -- (-1025.793) [-1026.915] (-1023.850) (-1026.956) * (-1025.711) [-1029.681] (-1024.708) (-1033.499) -- 0:00:55 97500 -- (-1026.927) (-1024.893) (-1024.709) [-1025.971] * (-1029.141) [-1026.953] (-1025.748) (-1035.533) -- 0:00:55 98000 -- [-1024.801] (-1027.023) (-1025.896) (-1024.554) * (-1029.805) [-1024.298] (-1023.921) (-1029.034) -- 0:00:55 98500 -- [-1025.833] (-1026.606) (-1026.120) (-1024.373) * [-1025.550] (-1024.341) (-1024.712) (-1030.347) -- 0:00:54 99000 -- [-1024.357] (-1025.333) (-1023.432) (-1026.453) * (-1028.576) [-1023.935] (-1023.339) (-1025.539) -- 0:00:54 99500 -- (-1024.302) [-1026.061] (-1030.526) (-1027.667) * (-1026.756) (-1026.658) (-1025.173) [-1024.914] -- 0:00:54 100000 -- (-1025.326) [-1027.011] (-1024.646) (-1024.680) * [-1026.281] (-1024.687) (-1024.900) (-1031.638) -- 0:00:54 Average standard deviation of split frequencies: 0.026692 100500 -- (-1025.555) (-1024.585) [-1025.657] (-1024.445) * (-1024.677) [-1025.373] (-1023.530) (-1028.197) -- 0:00:53 101000 -- (-1024.687) (-1026.393) (-1024.847) [-1024.785] * [-1024.810] (-1026.246) (-1023.804) (-1028.559) -- 0:00:53 101500 -- (-1026.188) (-1023.472) [-1024.968] (-1023.555) * (-1026.019) (-1028.298) [-1025.430] (-1026.069) -- 0:00:53 102000 -- [-1025.180] (-1027.100) (-1027.641) (-1024.822) * (-1025.509) [-1028.977] (-1025.243) (-1025.929) -- 0:00:52 102500 -- (-1026.724) (-1029.219) [-1025.833] (-1025.335) * (-1024.905) (-1030.120) (-1025.645) [-1026.422] -- 0:00:52 103000 -- (-1024.434) (-1025.147) [-1028.264] (-1026.119) * (-1023.804) (-1024.001) (-1025.557) [-1026.020] -- 0:00:52 103500 -- (-1025.372) [-1027.291] (-1026.071) (-1024.748) * (-1024.536) (-1027.702) [-1025.022] (-1024.657) -- 0:01:00 104000 -- (-1024.013) (-1028.419) (-1029.522) [-1026.387] * [-1024.959] (-1025.098) (-1028.141) (-1023.887) -- 0:01:00 104500 -- [-1023.954] (-1027.251) (-1026.383) (-1027.534) * [-1027.961] (-1024.019) (-1029.153) (-1025.053) -- 0:00:59 105000 -- (-1023.980) (-1026.144) (-1026.217) [-1028.985] * [-1024.178] (-1024.563) (-1027.004) (-1024.981) -- 0:00:59 Average standard deviation of split frequencies: 0.024682 105500 -- [-1024.674] (-1026.259) (-1024.032) (-1028.795) * (-1024.484) [-1024.342] (-1029.441) (-1025.550) -- 0:00:59 106000 -- [-1023.493] (-1027.938) (-1025.084) (-1029.935) * (-1024.934) (-1024.113) [-1029.400] (-1024.738) -- 0:00:59 106500 -- (-1026.901) [-1028.736] (-1024.951) (-1031.994) * (-1027.415) [-1025.142] (-1023.824) (-1024.627) -- 0:00:58 107000 -- (-1027.900) (-1025.215) [-1024.819] (-1027.558) * (-1026.433) (-1026.010) [-1024.843] (-1024.456) -- 0:00:58 107500 -- (-1023.481) (-1025.638) [-1024.992] (-1025.299) * [-1025.756] (-1024.856) (-1025.135) (-1031.132) -- 0:00:58 108000 -- (-1023.502) (-1026.270) [-1025.079] (-1024.077) * [-1028.505] (-1025.053) (-1027.378) (-1030.818) -- 0:00:57 108500 -- [-1024.113] (-1028.276) (-1027.705) (-1024.204) * (-1026.408) (-1025.374) [-1025.616] (-1025.866) -- 0:00:57 109000 -- (-1023.656) (-1028.589) (-1024.514) [-1026.346] * [-1026.251] (-1025.384) (-1024.683) (-1023.956) -- 0:00:57 109500 -- (-1024.245) [-1036.029] (-1025.424) (-1025.027) * (-1030.363) (-1024.778) [-1023.605] (-1025.286) -- 0:00:56 110000 -- (-1024.136) (-1027.492) (-1026.781) [-1024.636] * (-1028.510) [-1024.751] (-1025.061) (-1025.370) -- 0:00:56 Average standard deviation of split frequencies: 0.023428 110500 -- (-1024.954) (-1024.998) [-1026.719] (-1025.235) * (-1027.135) (-1027.650) [-1024.907] (-1024.090) -- 0:00:56 111000 -- (-1024.163) (-1025.175) [-1025.667] (-1027.705) * (-1028.304) (-1027.136) [-1026.898] (-1023.725) -- 0:00:56 111500 -- (-1029.695) [-1025.010] (-1027.899) (-1027.490) * (-1030.394) [-1026.765] (-1027.176) (-1023.720) -- 0:00:55 112000 -- (-1029.671) (-1025.230) [-1025.398] (-1032.259) * [-1025.646] (-1029.746) (-1030.767) (-1024.345) -- 0:00:55 112500 -- (-1025.772) (-1029.193) [-1025.482] (-1027.229) * (-1025.866) (-1025.575) (-1024.861) [-1025.740] -- 0:00:55 113000 -- (-1027.681) (-1025.821) [-1024.721] (-1028.157) * (-1029.425) (-1024.743) [-1025.773] (-1025.479) -- 0:00:54 113500 -- (-1030.135) (-1023.788) [-1029.462] (-1028.371) * (-1026.802) (-1024.969) (-1024.330) [-1025.565] -- 0:00:54 114000 -- (-1024.336) (-1024.734) [-1025.113] (-1028.760) * (-1027.985) (-1024.823) (-1024.952) [-1026.465] -- 0:00:54 114500 -- (-1024.368) [-1028.346] (-1026.025) (-1024.423) * [-1025.383] (-1023.618) (-1027.189) (-1024.463) -- 0:00:54 115000 -- [-1025.063] (-1025.101) (-1026.616) (-1023.900) * (-1026.592) (-1025.351) [-1024.804] (-1023.907) -- 0:00:53 Average standard deviation of split frequencies: 0.020726 115500 -- (-1025.008) [-1024.424] (-1025.052) (-1024.270) * (-1025.531) (-1026.221) (-1026.149) [-1026.517] -- 0:00:53 116000 -- (-1027.022) (-1024.328) (-1024.833) [-1024.216] * (-1027.345) (-1024.203) (-1026.389) [-1025.398] -- 0:00:53 116500 -- [-1027.144] (-1025.422) (-1024.406) (-1023.938) * (-1024.925) [-1024.529] (-1029.153) (-1024.611) -- 0:00:53 117000 -- (-1024.429) (-1028.072) (-1024.644) [-1024.580] * (-1023.523) [-1027.305] (-1028.064) (-1024.783) -- 0:00:52 117500 -- (-1023.724) [-1025.654] (-1026.525) (-1027.777) * (-1024.589) (-1027.191) [-1026.220] (-1024.730) -- 0:00:52 118000 -- (-1024.854) (-1026.231) (-1025.161) [-1026.304] * (-1024.850) [-1026.168] (-1025.671) (-1025.679) -- 0:00:52 118500 -- (-1025.800) (-1027.494) (-1025.314) [-1025.114] * [-1023.770] (-1024.146) (-1025.812) (-1025.901) -- 0:00:52 119000 -- (-1023.491) (-1026.477) (-1025.290) [-1024.723] * [-1024.465] (-1023.371) (-1027.230) (-1025.891) -- 0:00:51 119500 -- (-1024.458) (-1026.917) [-1024.572] (-1026.443) * (-1023.607) [-1024.192] (-1029.250) (-1025.489) -- 0:00:51 120000 -- (-1023.710) (-1024.706) (-1025.295) [-1025.660] * (-1028.711) (-1024.705) [-1026.603] (-1024.866) -- 0:00:58 Average standard deviation of split frequencies: 0.018300 120500 -- (-1024.972) [-1025.550] (-1025.279) (-1026.261) * (-1024.991) (-1024.827) [-1024.795] (-1024.992) -- 0:00:58 121000 -- [-1023.972] (-1025.550) (-1026.126) (-1027.088) * (-1025.191) (-1027.245) [-1026.821] (-1026.311) -- 0:00:58 121500 -- (-1026.385) [-1025.106] (-1024.485) (-1028.683) * (-1024.206) (-1029.604) [-1027.999] (-1024.545) -- 0:00:57 122000 -- [-1023.833] (-1026.230) (-1024.493) (-1027.553) * (-1028.570) (-1028.222) [-1024.482] (-1025.969) -- 0:00:57 122500 -- (-1024.219) (-1024.656) [-1026.612] (-1029.172) * (-1025.075) (-1026.537) (-1025.076) [-1024.902] -- 0:00:57 123000 -- [-1026.347] (-1025.042) (-1026.459) (-1025.811) * (-1025.415) [-1025.926] (-1026.228) (-1027.866) -- 0:00:57 123500 -- (-1032.171) (-1025.052) [-1027.184] (-1024.109) * (-1025.249) (-1024.807) [-1024.572] (-1026.746) -- 0:00:56 124000 -- (-1029.672) (-1027.510) [-1026.100] (-1024.815) * (-1031.035) (-1025.848) [-1026.103] (-1029.320) -- 0:00:56 124500 -- (-1027.711) [-1025.738] (-1027.447) (-1025.158) * [-1025.042] (-1025.592) (-1023.982) (-1030.023) -- 0:00:56 125000 -- (-1025.821) (-1024.605) (-1025.664) [-1026.713] * [-1024.376] (-1026.371) (-1024.850) (-1029.867) -- 0:00:56 Average standard deviation of split frequencies: 0.018116 125500 -- (-1027.433) (-1026.362) [-1025.834] (-1024.662) * (-1025.387) (-1026.338) (-1024.240) [-1025.966] -- 0:00:55 126000 -- [-1025.666] (-1025.306) (-1025.743) (-1025.770) * (-1027.697) (-1027.521) [-1028.438] (-1023.776) -- 0:00:55 126500 -- (-1024.782) (-1025.395) (-1028.485) [-1025.214] * (-1026.011) (-1025.009) (-1032.850) [-1024.792] -- 0:00:55 127000 -- (-1025.061) (-1025.174) [-1029.326] (-1026.303) * (-1026.569) [-1025.214] (-1024.602) (-1025.899) -- 0:00:54 127500 -- (-1028.239) [-1026.488] (-1024.430) (-1033.010) * [-1027.003] (-1024.298) (-1025.683) (-1027.925) -- 0:00:54 128000 -- (-1025.906) [-1026.002] (-1024.630) (-1028.163) * (-1026.272) (-1026.608) (-1024.757) [-1025.646] -- 0:00:54 128500 -- (-1026.749) [-1026.105] (-1024.238) (-1024.120) * (-1026.096) [-1026.375] (-1024.341) (-1025.284) -- 0:00:54 129000 -- (-1028.105) (-1027.205) [-1024.330] (-1026.682) * [-1025.458] (-1025.065) (-1025.047) (-1025.377) -- 0:00:54 129500 -- [-1024.345] (-1026.446) (-1024.635) (-1026.694) * [-1024.899] (-1025.987) (-1024.570) (-1024.390) -- 0:00:53 130000 -- (-1024.277) [-1028.584] (-1024.099) (-1025.418) * (-1026.640) [-1026.685] (-1024.815) (-1025.915) -- 0:00:53 Average standard deviation of split frequencies: 0.018038 130500 -- (-1025.641) (-1025.973) [-1024.234] (-1025.786) * (-1025.561) (-1026.301) [-1024.311] (-1026.172) -- 0:00:53 131000 -- (-1024.203) (-1027.687) [-1023.813] (-1025.369) * (-1025.647) (-1026.288) [-1024.857] (-1026.231) -- 0:00:53 131500 -- [-1028.578] (-1027.137) (-1025.302) (-1031.548) * (-1025.505) (-1026.218) (-1026.706) [-1025.807] -- 0:00:52 132000 -- [-1024.729] (-1026.076) (-1024.870) (-1028.796) * (-1027.294) (-1026.467) (-1027.081) [-1025.034] -- 0:00:52 132500 -- (-1026.468) (-1026.427) [-1024.595] (-1025.570) * (-1024.398) (-1024.942) [-1025.530] (-1025.492) -- 0:00:52 133000 -- (-1024.095) (-1025.321) (-1024.591) [-1024.372] * [-1026.382] (-1025.196) (-1026.596) (-1025.608) -- 0:00:52 133500 -- (-1025.527) (-1029.177) (-1024.028) [-1025.033] * (-1025.968) [-1025.009] (-1027.130) (-1024.058) -- 0:00:51 134000 -- (-1025.693) (-1027.620) (-1025.801) [-1024.196] * (-1024.168) [-1027.622] (-1028.562) (-1025.180) -- 0:00:51 134500 -- [-1028.112] (-1025.268) (-1026.006) (-1024.721) * (-1025.422) (-1028.853) [-1028.810] (-1027.924) -- 0:00:51 135000 -- (-1027.663) (-1026.479) [-1025.673] (-1027.561) * (-1023.553) [-1028.734] (-1024.302) (-1027.531) -- 0:00:51 Average standard deviation of split frequencies: 0.021162 135500 -- (-1028.847) [-1026.245] (-1027.416) (-1023.722) * (-1024.420) (-1027.218) [-1025.438] (-1023.817) -- 0:00:51 136000 -- (-1028.388) (-1026.237) (-1027.388) [-1024.521] * [-1024.303] (-1025.498) (-1024.481) (-1026.672) -- 0:00:57 136500 -- (-1025.806) (-1026.936) [-1024.906] (-1024.936) * [-1023.908] (-1023.534) (-1024.983) (-1024.521) -- 0:00:56 137000 -- (-1028.664) [-1028.206] (-1026.982) (-1028.579) * [-1024.106] (-1023.531) (-1024.478) (-1025.393) -- 0:00:56 137500 -- (-1025.674) [-1025.302] (-1026.071) (-1026.275) * (-1024.187) (-1023.445) [-1025.490] (-1029.369) -- 0:00:56 138000 -- [-1024.737] (-1025.111) (-1026.141) (-1024.476) * (-1029.311) (-1024.226) (-1025.094) [-1025.062] -- 0:00:56 138500 -- (-1024.978) [-1025.518] (-1025.625) (-1023.759) * (-1025.942) (-1026.757) (-1027.053) [-1024.966] -- 0:00:55 139000 -- [-1023.624] (-1027.115) (-1025.608) (-1027.879) * (-1029.781) (-1025.009) (-1028.647) [-1027.386] -- 0:00:55 139500 -- (-1023.580) (-1027.684) (-1025.611) [-1025.789] * (-1026.310) (-1026.082) (-1023.631) [-1026.079] -- 0:00:55 140000 -- (-1025.185) (-1024.913) [-1028.751] (-1025.664) * (-1025.383) (-1024.699) [-1024.968] (-1026.555) -- 0:00:55 Average standard deviation of split frequencies: 0.020480 140500 -- (-1030.635) [-1024.353] (-1025.743) (-1024.878) * (-1026.427) [-1025.896] (-1025.926) (-1027.884) -- 0:00:55 141000 -- [-1025.965] (-1027.821) (-1027.251) (-1027.242) * [-1025.508] (-1027.610) (-1025.926) (-1027.463) -- 0:00:54 141500 -- [-1025.736] (-1025.217) (-1025.144) (-1024.551) * (-1025.464) (-1028.370) [-1027.315] (-1024.870) -- 0:00:54 142000 -- (-1027.149) [-1025.272] (-1023.926) (-1024.813) * (-1025.589) (-1030.170) [-1025.218] (-1025.579) -- 0:00:54 142500 -- (-1023.418) (-1024.881) (-1024.652) [-1025.013] * [-1025.765] (-1028.117) (-1025.012) (-1027.247) -- 0:00:54 143000 -- (-1023.817) (-1024.993) (-1026.032) [-1024.326] * (-1025.066) (-1024.256) (-1024.462) [-1025.242] -- 0:00:53 143500 -- [-1023.712] (-1024.048) (-1026.614) (-1025.646) * [-1023.788] (-1028.856) (-1024.684) (-1026.550) -- 0:00:53 144000 -- (-1024.132) (-1026.454) (-1025.932) [-1026.566] * (-1025.285) [-1025.751] (-1028.043) (-1025.369) -- 0:00:53 144500 -- (-1024.851) (-1025.276) [-1026.580] (-1024.197) * [-1024.775] (-1025.465) (-1027.804) (-1023.929) -- 0:00:53 145000 -- (-1025.327) (-1026.504) (-1025.014) [-1024.566] * (-1027.818) (-1031.193) (-1026.711) [-1024.760] -- 0:00:53 Average standard deviation of split frequencies: 0.019713 145500 -- (-1028.374) (-1025.315) (-1025.550) [-1025.253] * [-1033.370] (-1030.050) (-1026.203) (-1023.815) -- 0:00:52 146000 -- (-1025.943) (-1023.641) (-1025.129) [-1025.443] * (-1037.598) [-1027.293] (-1026.257) (-1023.865) -- 0:00:52 146500 -- (-1025.564) (-1024.866) [-1023.909] (-1024.703) * (-1029.837) (-1026.722) (-1026.365) [-1028.305] -- 0:00:52 147000 -- (-1025.858) (-1025.894) [-1023.909] (-1024.916) * (-1027.622) [-1025.338] (-1027.483) (-1027.496) -- 0:00:52 147500 -- (-1027.955) (-1024.122) [-1024.448] (-1023.373) * (-1025.478) (-1024.801) (-1028.497) [-1026.061] -- 0:00:52 148000 -- [-1026.498] (-1026.271) (-1024.743) (-1028.133) * [-1027.695] (-1024.830) (-1025.767) (-1031.404) -- 0:00:51 148500 -- (-1024.352) [-1025.307] (-1024.647) (-1027.188) * (-1024.864) [-1024.780] (-1025.888) (-1037.089) -- 0:00:51 149000 -- (-1024.763) (-1025.929) [-1025.026] (-1024.764) * (-1023.887) (-1024.927) [-1026.002] (-1030.688) -- 0:00:51 149500 -- (-1027.172) (-1025.721) [-1026.087] (-1025.009) * [-1024.251] (-1023.608) (-1023.494) (-1028.637) -- 0:00:51 150000 -- (-1023.757) (-1026.103) [-1026.889] (-1029.824) * (-1025.745) (-1025.591) [-1023.687] (-1027.818) -- 0:00:51 Average standard deviation of split frequencies: 0.022560 150500 -- [-1025.571] (-1025.261) (-1024.804) (-1026.596) * (-1024.659) (-1026.906) (-1024.993) [-1024.365] -- 0:00:50 151000 -- [-1023.464] (-1023.527) (-1024.659) (-1027.807) * (-1025.218) (-1024.266) (-1023.869) [-1024.545] -- 0:00:50 151500 -- (-1024.736) (-1025.987) [-1024.228] (-1024.036) * [-1024.234] (-1024.739) (-1023.965) (-1029.641) -- 0:00:50 152000 -- [-1025.481] (-1035.970) (-1026.819) (-1026.109) * (-1025.775) [-1027.013] (-1023.611) (-1025.681) -- 0:00:50 152500 -- (-1026.596) (-1031.072) (-1027.632) [-1026.307] * (-1024.357) (-1023.580) [-1024.833] (-1028.534) -- 0:00:55 153000 -- (-1027.741) [-1027.849] (-1025.756) (-1026.273) * (-1026.703) [-1025.998] (-1026.866) (-1028.132) -- 0:00:55 153500 -- (-1026.612) [-1027.741] (-1027.280) (-1025.445) * (-1024.701) (-1024.359) (-1023.510) [-1027.290] -- 0:00:55 154000 -- [-1030.497] (-1030.104) (-1028.317) (-1025.802) * (-1034.625) (-1025.997) (-1024.188) [-1026.444] -- 0:00:54 154500 -- [-1025.585] (-1028.444) (-1027.714) (-1025.317) * (-1029.273) (-1025.627) [-1025.236] (-1026.122) -- 0:00:54 155000 -- (-1027.047) (-1026.469) [-1026.155] (-1024.921) * (-1027.500) (-1029.022) [-1025.055] (-1026.709) -- 0:00:54 Average standard deviation of split frequencies: 0.021471 155500 -- [-1026.733] (-1025.473) (-1026.048) (-1024.168) * (-1025.442) [-1034.241] (-1027.293) (-1025.055) -- 0:00:54 156000 -- (-1028.232) (-1024.769) [-1024.524] (-1024.038) * [-1025.983] (-1027.092) (-1031.431) (-1025.376) -- 0:00:54 156500 -- (-1024.258) [-1025.181] (-1026.328) (-1023.961) * (-1024.359) [-1023.922] (-1025.954) (-1029.098) -- 0:00:53 157000 -- (-1026.548) (-1024.277) [-1025.750] (-1026.146) * (-1024.167) (-1025.002) [-1024.509] (-1026.429) -- 0:00:53 157500 -- (-1025.368) [-1024.036] (-1030.365) (-1023.833) * [-1025.861] (-1023.966) (-1028.441) (-1024.598) -- 0:00:53 158000 -- (-1027.805) (-1027.543) (-1025.520) [-1023.773] * (-1024.840) (-1025.006) [-1025.767] (-1025.608) -- 0:00:53 158500 -- (-1027.945) (-1025.320) (-1026.401) [-1025.333] * (-1024.351) [-1024.122] (-1024.750) (-1024.715) -- 0:00:53 159000 -- (-1026.470) (-1024.674) [-1025.929] (-1028.710) * (-1024.270) [-1025.200] (-1024.957) (-1035.525) -- 0:00:52 159500 -- [-1025.381] (-1028.091) (-1024.137) (-1023.893) * (-1025.940) (-1027.274) (-1027.873) [-1026.465] -- 0:00:52 160000 -- (-1027.352) [-1024.537] (-1024.179) (-1023.767) * (-1025.555) (-1025.196) (-1027.408) [-1024.588] -- 0:00:52 Average standard deviation of split frequencies: 0.021774 160500 -- (-1024.985) (-1025.960) [-1027.473] (-1025.167) * (-1023.540) [-1024.772] (-1026.444) (-1024.488) -- 0:00:52 161000 -- (-1025.430) (-1026.482) [-1026.567] (-1031.780) * [-1024.322] (-1025.162) (-1025.007) (-1025.204) -- 0:00:52 161500 -- [-1023.922] (-1024.748) (-1027.685) (-1024.111) * (-1024.327) [-1024.916] (-1026.921) (-1024.543) -- 0:00:51 162000 -- (-1024.847) [-1025.506] (-1030.747) (-1023.569) * [-1024.167] (-1026.897) (-1024.960) (-1027.459) -- 0:00:51 162500 -- (-1023.767) [-1024.472] (-1026.051) (-1024.857) * (-1024.654) (-1026.617) [-1024.295] (-1027.294) -- 0:00:51 163000 -- (-1026.114) [-1025.967] (-1026.386) (-1023.583) * (-1024.990) (-1026.215) (-1024.410) [-1029.990] -- 0:00:51 163500 -- (-1023.477) [-1024.791] (-1026.785) (-1024.149) * (-1027.201) (-1025.869) [-1024.617] (-1023.757) -- 0:00:51 164000 -- (-1027.394) (-1025.932) [-1024.247] (-1028.247) * (-1025.040) (-1026.842) (-1024.154) [-1024.386] -- 0:00:50 164500 -- (-1024.761) [-1024.911] (-1026.053) (-1030.589) * [-1027.583] (-1027.103) (-1027.894) (-1024.465) -- 0:00:50 165000 -- (-1025.463) (-1025.312) [-1030.804] (-1028.433) * (-1027.807) (-1027.281) [-1029.398] (-1024.959) -- 0:00:50 Average standard deviation of split frequencies: 0.022569 165500 -- (-1024.572) (-1027.118) (-1025.875) [-1028.489] * (-1024.188) (-1031.338) (-1028.282) [-1024.508] -- 0:00:50 166000 -- (-1024.598) (-1025.556) (-1029.154) [-1026.811] * (-1025.648) (-1027.271) [-1027.779] (-1024.144) -- 0:00:50 166500 -- (-1026.728) (-1025.758) [-1026.520] (-1028.781) * (-1026.004) (-1026.913) [-1027.649] (-1025.616) -- 0:00:50 167000 -- (-1025.814) [-1025.746] (-1024.172) (-1027.994) * [-1024.532] (-1027.490) (-1027.123) (-1025.595) -- 0:00:49 167500 -- [-1027.208] (-1025.632) (-1025.432) (-1023.970) * (-1026.294) [-1027.431] (-1030.789) (-1024.338) -- 0:00:49 168000 -- (-1024.874) [-1025.493] (-1025.614) (-1024.007) * [-1024.897] (-1027.659) (-1027.720) (-1024.050) -- 0:00:49 168500 -- (-1024.785) [-1026.903] (-1024.419) (-1023.679) * (-1026.564) (-1029.252) (-1025.482) [-1024.022] -- 0:00:49 169000 -- (-1025.559) [-1024.299] (-1026.580) (-1023.268) * (-1025.635) (-1024.950) [-1024.881] (-1028.853) -- 0:00:54 169500 -- (-1024.973) (-1026.193) (-1024.032) [-1025.719] * [-1023.261] (-1025.181) (-1025.065) (-1025.302) -- 0:00:53 170000 -- (-1026.022) (-1025.788) (-1025.375) [-1024.294] * [-1023.583] (-1023.950) (-1026.104) (-1025.978) -- 0:00:53 Average standard deviation of split frequencies: 0.024552 170500 -- (-1030.361) (-1024.892) (-1025.424) [-1026.767] * (-1024.091) (-1023.692) (-1025.974) [-1025.432] -- 0:00:53 171000 -- (-1031.064) [-1024.820] (-1024.155) (-1029.361) * (-1025.392) (-1024.614) (-1024.726) [-1025.431] -- 0:00:53 171500 -- [-1036.393] (-1024.358) (-1025.884) (-1026.955) * (-1023.606) (-1023.620) [-1025.273] (-1025.168) -- 0:00:53 172000 -- (-1029.675) (-1024.405) (-1028.865) [-1026.574] * (-1025.420) [-1023.620] (-1025.898) (-1024.852) -- 0:00:52 172500 -- (-1028.018) (-1025.176) (-1026.032) [-1025.446] * (-1027.786) (-1023.593) [-1025.865] (-1024.978) -- 0:00:52 173000 -- (-1024.228) (-1025.542) [-1025.895] (-1026.114) * [-1026.171] (-1024.181) (-1027.149) (-1025.313) -- 0:00:52 173500 -- (-1026.010) (-1029.098) [-1025.139] (-1031.128) * (-1027.545) (-1026.320) (-1025.580) [-1026.674] -- 0:00:52 174000 -- (-1028.942) [-1025.640] (-1024.360) (-1028.905) * (-1031.691) (-1026.704) (-1024.791) [-1026.199] -- 0:00:52 174500 -- (-1033.756) [-1026.659] (-1029.538) (-1026.293) * (-1030.466) [-1025.809] (-1025.224) (-1027.431) -- 0:00:52 175000 -- (-1032.435) [-1025.579] (-1028.131) (-1030.469) * [-1025.312] (-1026.108) (-1024.311) (-1026.264) -- 0:00:51 Average standard deviation of split frequencies: 0.023660 175500 -- [-1025.791] (-1026.764) (-1025.953) (-1025.001) * (-1024.277) (-1027.202) (-1026.554) [-1023.831] -- 0:00:51 176000 -- (-1024.980) (-1025.791) (-1031.168) [-1026.003] * (-1026.273) (-1026.593) [-1025.199] (-1023.353) -- 0:00:51 176500 -- [-1025.734] (-1028.180) (-1025.530) (-1025.429) * [-1025.815] (-1026.058) (-1024.808) (-1026.477) -- 0:00:51 177000 -- (-1023.902) (-1028.995) [-1026.328] (-1026.784) * (-1026.814) (-1024.553) [-1024.330] (-1025.800) -- 0:00:51 177500 -- (-1023.900) (-1024.732) (-1028.316) [-1025.174] * (-1024.533) (-1025.328) (-1024.659) [-1023.962] -- 0:00:50 178000 -- (-1025.166) (-1026.059) (-1029.873) [-1024.925] * [-1027.124] (-1029.405) (-1027.487) (-1027.950) -- 0:00:50 178500 -- (-1025.135) (-1026.021) [-1028.841] (-1026.718) * (-1025.199) [-1024.400] (-1026.141) (-1023.983) -- 0:00:50 179000 -- (-1024.182) [-1026.603] (-1024.176) (-1026.350) * (-1023.862) (-1029.249) [-1024.613] (-1025.149) -- 0:00:50 179500 -- [-1024.314] (-1023.834) (-1023.308) (-1029.250) * (-1024.103) (-1028.818) (-1026.533) [-1024.844] -- 0:00:50 180000 -- [-1026.509] (-1026.045) (-1023.465) (-1024.353) * (-1023.424) (-1033.279) [-1024.060] (-1027.466) -- 0:00:50 Average standard deviation of split frequencies: 0.021744 180500 -- (-1023.736) (-1028.070) (-1024.174) [-1024.744] * (-1028.619) (-1025.760) [-1025.491] (-1029.884) -- 0:00:49 181000 -- [-1024.560] (-1027.097) (-1024.336) (-1023.554) * [-1029.209] (-1029.546) (-1027.784) (-1025.953) -- 0:00:49 181500 -- (-1025.832) (-1029.805) (-1027.406) [-1031.420] * (-1025.448) (-1026.927) (-1025.603) [-1024.653] -- 0:00:49 182000 -- (-1024.086) [-1026.106] (-1025.132) (-1027.842) * (-1027.260) (-1025.297) [-1027.507] (-1026.612) -- 0:00:49 182500 -- (-1024.597) (-1027.271) (-1025.365) [-1025.565] * (-1026.107) (-1026.094) (-1027.953) [-1026.669] -- 0:00:49 183000 -- (-1024.920) [-1026.970] (-1026.810) (-1027.172) * (-1026.713) [-1027.247] (-1027.900) (-1024.843) -- 0:00:49 183500 -- [-1024.891] (-1027.992) (-1027.906) (-1026.469) * (-1024.095) [-1027.501] (-1027.892) (-1024.562) -- 0:00:48 184000 -- (-1025.196) (-1024.958) [-1025.239] (-1028.275) * (-1024.718) [-1026.702] (-1028.026) (-1024.562) -- 0:00:48 184500 -- (-1024.903) (-1027.499) (-1027.357) [-1025.585] * (-1024.336) (-1028.675) (-1031.500) [-1026.185] -- 0:00:48 185000 -- (-1026.685) (-1024.594) (-1026.872) [-1027.563] * (-1025.452) (-1024.831) (-1028.125) [-1025.966] -- 0:00:48 Average standard deviation of split frequencies: 0.020542 185500 -- (-1024.407) [-1023.721] (-1026.661) (-1026.310) * (-1024.868) (-1028.387) (-1028.094) [-1027.225] -- 0:00:52 186000 -- [-1023.988] (-1024.880) (-1026.256) (-1027.153) * (-1028.678) (-1027.963) [-1028.260] (-1027.413) -- 0:00:52 186500 -- [-1024.970] (-1024.933) (-1026.825) (-1026.088) * [-1029.828] (-1033.588) (-1028.942) (-1027.403) -- 0:00:52 187000 -- (-1028.943) (-1024.663) [-1025.044] (-1025.415) * (-1024.490) (-1031.514) (-1026.678) [-1025.367] -- 0:00:52 187500 -- (-1030.146) [-1024.737] (-1024.433) (-1025.289) * (-1027.693) (-1024.975) [-1023.833] (-1026.462) -- 0:00:52 188000 -- (-1033.777) [-1029.041] (-1024.748) (-1025.909) * (-1027.988) [-1024.803] (-1024.776) (-1025.267) -- 0:00:51 188500 -- (-1025.286) [-1027.000] (-1026.524) (-1025.890) * [-1031.283] (-1028.145) (-1027.073) (-1027.413) -- 0:00:51 189000 -- (-1024.030) (-1029.599) (-1025.514) [-1025.439] * (-1029.223) [-1024.323] (-1025.648) (-1025.077) -- 0:00:51 189500 -- [-1024.499] (-1033.903) (-1026.690) (-1027.422) * [-1025.378] (-1024.084) (-1025.031) (-1027.679) -- 0:00:51 190000 -- (-1024.931) [-1028.031] (-1024.886) (-1024.373) * (-1023.506) [-1024.790] (-1025.874) (-1026.485) -- 0:00:51 Average standard deviation of split frequencies: 0.019649 190500 -- (-1025.621) (-1024.862) (-1024.493) [-1025.025] * [-1023.874] (-1026.467) (-1026.734) (-1026.707) -- 0:00:50 191000 -- (-1026.663) (-1023.804) (-1028.454) [-1027.514] * (-1026.278) (-1025.936) [-1026.363] (-1028.782) -- 0:00:50 191500 -- (-1025.311) [-1023.953] (-1028.572) (-1027.363) * (-1025.791) [-1029.539] (-1024.731) (-1028.357) -- 0:00:50 192000 -- (-1025.084) (-1025.066) (-1027.138) [-1023.952] * [-1025.701] (-1025.409) (-1026.809) (-1026.793) -- 0:00:50 192500 -- (-1027.788) (-1027.610) [-1026.369] (-1025.654) * [-1024.356] (-1024.828) (-1023.971) (-1026.308) -- 0:00:50 193000 -- (-1024.262) [-1026.688] (-1028.968) (-1027.635) * (-1025.927) [-1024.692] (-1023.910) (-1027.854) -- 0:00:50 193500 -- (-1026.490) [-1025.788] (-1026.803) (-1025.358) * (-1025.966) (-1025.389) [-1027.115] (-1023.665) -- 0:00:50 194000 -- (-1026.610) [-1025.702] (-1025.918) (-1025.543) * (-1030.241) [-1025.397] (-1024.829) (-1023.665) -- 0:00:49 194500 -- [-1026.270] (-1026.860) (-1025.797) (-1026.377) * (-1026.437) (-1023.957) [-1025.627] (-1026.673) -- 0:00:49 195000 -- (-1024.904) [-1024.395] (-1026.808) (-1025.184) * (-1028.117) (-1028.671) [-1024.563] (-1026.587) -- 0:00:49 Average standard deviation of split frequencies: 0.020254 195500 -- (-1024.585) (-1029.577) (-1026.623) [-1024.671] * (-1025.931) [-1027.259] (-1029.945) (-1029.084) -- 0:00:49 196000 -- (-1024.791) [-1032.313] (-1033.816) (-1027.374) * (-1027.351) (-1024.218) (-1026.631) [-1025.452] -- 0:00:49 196500 -- (-1025.684) (-1028.522) (-1026.675) [-1026.200] * (-1028.366) [-1027.987] (-1024.990) (-1025.588) -- 0:00:49 197000 -- (-1024.509) (-1027.896) (-1026.318) [-1026.212] * [-1026.066] (-1024.262) (-1025.569) (-1026.789) -- 0:00:48 197500 -- [-1024.370] (-1027.930) (-1025.073) (-1027.846) * (-1026.249) (-1024.810) (-1027.859) [-1024.397] -- 0:00:48 198000 -- [-1025.864] (-1026.666) (-1024.537) (-1031.819) * (-1024.277) (-1024.968) (-1026.459) [-1025.244] -- 0:00:48 198500 -- (-1026.788) [-1024.016] (-1026.148) (-1030.456) * (-1025.335) (-1026.064) (-1026.157) [-1024.853] -- 0:00:48 199000 -- [-1026.573] (-1024.510) (-1026.053) (-1026.811) * (-1028.338) [-1029.388] (-1025.462) (-1024.824) -- 0:00:48 199500 -- (-1024.384) (-1025.333) (-1026.457) [-1024.671] * (-1027.544) (-1029.093) (-1030.305) [-1025.326] -- 0:00:48 200000 -- (-1026.398) [-1026.467] (-1027.236) (-1024.953) * [-1029.349] (-1027.521) (-1023.786) (-1026.336) -- 0:00:48 Average standard deviation of split frequencies: 0.020895 200500 -- (-1026.547) (-1024.969) [-1027.929] (-1024.599) * [-1023.803] (-1024.592) (-1024.313) (-1024.825) -- 0:00:47 201000 -- (-1026.864) [-1024.528] (-1026.577) (-1025.522) * (-1024.032) (-1025.725) [-1025.399] (-1027.329) -- 0:00:47 201500 -- (-1023.877) (-1028.700) (-1026.916) [-1026.882] * (-1024.650) (-1027.275) [-1024.035] (-1024.852) -- 0:00:51 202000 -- (-1023.329) (-1028.007) (-1024.382) [-1026.365] * (-1024.172) (-1027.795) [-1024.052] (-1024.845) -- 0:00:51 202500 -- (-1023.333) (-1024.790) [-1024.176] (-1027.979) * (-1023.631) (-1027.186) [-1024.184] (-1024.166) -- 0:00:51 203000 -- (-1024.340) (-1025.136) [-1024.517] (-1026.750) * (-1023.805) (-1025.611) [-1024.715] (-1026.797) -- 0:00:51 203500 -- (-1023.549) (-1026.414) (-1026.981) [-1024.579] * [-1025.127] (-1026.002) (-1024.360) (-1023.944) -- 0:00:50 204000 -- (-1024.711) (-1029.376) [-1025.134] (-1024.364) * (-1026.041) (-1025.367) [-1024.274] (-1023.703) -- 0:00:50 204500 -- (-1026.142) [-1024.032] (-1026.996) (-1026.210) * (-1027.544) (-1026.191) [-1025.268] (-1025.053) -- 0:00:50 205000 -- (-1028.079) (-1024.465) [-1026.266] (-1027.165) * (-1026.450) (-1024.688) (-1025.678) [-1027.361] -- 0:00:50 Average standard deviation of split frequencies: 0.019752 205500 -- (-1026.211) (-1024.369) [-1029.230] (-1027.882) * (-1030.350) (-1027.641) (-1025.779) [-1025.274] -- 0:00:50 206000 -- [-1024.549] (-1024.577) (-1024.739) (-1031.587) * (-1028.407) (-1023.640) (-1024.716) [-1025.331] -- 0:00:50 206500 -- (-1024.529) [-1024.805] (-1024.321) (-1027.347) * (-1026.544) [-1024.731] (-1025.446) (-1026.211) -- 0:00:49 207000 -- [-1026.474] (-1026.004) (-1026.164) (-1025.651) * [-1030.458] (-1028.381) (-1028.356) (-1025.836) -- 0:00:49 207500 -- (-1023.991) (-1025.656) [-1025.461] (-1026.018) * (-1024.399) (-1025.558) (-1031.145) [-1025.481] -- 0:00:49 208000 -- (-1024.333) (-1024.607) [-1027.178] (-1026.325) * [-1024.256] (-1025.900) (-1026.388) (-1024.769) -- 0:00:49 208500 -- [-1024.294] (-1026.734) (-1027.422) (-1025.869) * (-1024.759) (-1026.805) [-1025.282] (-1024.101) -- 0:00:49 209000 -- (-1025.172) [-1028.147] (-1024.991) (-1024.871) * (-1025.104) (-1027.010) (-1024.873) [-1025.126] -- 0:00:49 209500 -- (-1025.849) (-1025.332) [-1023.647] (-1028.450) * (-1025.311) [-1025.441] (-1026.437) (-1025.078) -- 0:00:49 210000 -- (-1025.339) (-1024.442) [-1025.672] (-1025.587) * (-1026.005) [-1025.059] (-1025.919) (-1029.974) -- 0:00:48 Average standard deviation of split frequencies: 0.018490 210500 -- (-1025.749) (-1024.762) [-1026.729] (-1024.501) * [-1025.982] (-1025.253) (-1027.862) (-1025.360) -- 0:00:48 211000 -- (-1025.461) [-1025.069] (-1027.273) (-1026.728) * (-1024.410) (-1027.508) (-1027.083) [-1025.765] -- 0:00:48 211500 -- (-1025.461) (-1024.221) (-1029.085) [-1023.957] * [-1027.417] (-1024.727) (-1023.996) (-1027.900) -- 0:00:48 212000 -- [-1024.310] (-1024.454) (-1026.321) (-1024.381) * (-1025.790) (-1027.996) (-1023.939) [-1025.020] -- 0:00:48 212500 -- (-1025.069) (-1024.450) (-1028.106) [-1024.279] * (-1024.839) (-1026.186) (-1024.240) [-1027.770] -- 0:00:48 213000 -- [-1026.911] (-1024.806) (-1027.735) (-1025.907) * [-1026.587] (-1023.874) (-1026.838) (-1026.246) -- 0:00:48 213500 -- [-1034.244] (-1024.969) (-1030.949) (-1027.051) * (-1025.104) (-1026.487) [-1023.612] (-1027.002) -- 0:00:47 214000 -- (-1028.690) [-1026.587] (-1026.025) (-1029.192) * (-1025.911) [-1024.436] (-1025.184) (-1027.254) -- 0:00:47 214500 -- (-1025.447) (-1026.060) [-1023.961] (-1026.849) * (-1025.553) (-1027.026) [-1024.864] (-1026.510) -- 0:00:47 215000 -- (-1027.552) [-1027.750] (-1025.095) (-1024.323) * (-1028.410) [-1027.370] (-1023.801) (-1026.686) -- 0:00:47 Average standard deviation of split frequencies: 0.017574 215500 -- (-1031.071) (-1024.396) (-1024.735) [-1027.130] * (-1026.335) (-1029.244) [-1027.062] (-1025.543) -- 0:00:47 216000 -- (-1029.181) [-1024.973] (-1023.995) (-1025.838) * [-1026.124] (-1031.015) (-1027.723) (-1024.847) -- 0:00:47 216500 -- (-1024.867) (-1024.352) [-1025.249] (-1025.480) * (-1029.607) (-1026.343) [-1024.566] (-1023.744) -- 0:00:47 217000 -- [-1026.308] (-1027.034) (-1026.811) (-1030.910) * (-1027.577) [-1026.637] (-1025.068) (-1023.737) -- 0:00:46 217500 -- (-1027.511) [-1025.908] (-1027.262) (-1032.608) * (-1026.613) [-1030.076] (-1025.453) (-1023.815) -- 0:00:46 218000 -- (-1026.407) (-1027.388) (-1026.264) [-1025.805] * (-1024.462) (-1025.718) [-1025.874] (-1026.124) -- 0:00:50 218500 -- [-1025.388] (-1027.574) (-1026.697) (-1023.977) * [-1024.500] (-1027.661) (-1024.586) (-1025.167) -- 0:00:50 219000 -- [-1025.401] (-1029.653) (-1025.869) (-1027.432) * [-1023.632] (-1023.994) (-1026.022) (-1024.719) -- 0:00:49 219500 -- (-1028.306) (-1028.551) (-1024.202) [-1026.851] * [-1023.507] (-1025.672) (-1025.708) (-1025.428) -- 0:00:49 220000 -- (-1027.874) (-1028.727) [-1028.038] (-1026.864) * (-1023.811) (-1025.947) [-1024.598] (-1025.151) -- 0:00:49 Average standard deviation of split frequencies: 0.018327 220500 -- [-1024.515] (-1028.113) (-1026.933) (-1027.738) * (-1027.772) [-1025.393] (-1024.537) (-1028.543) -- 0:00:49 221000 -- [-1026.270] (-1027.461) (-1025.433) (-1030.287) * (-1024.150) (-1025.062) [-1023.690] (-1028.066) -- 0:00:49 221500 -- (-1028.239) (-1031.264) (-1024.237) [-1024.696] * (-1027.078) (-1027.459) (-1025.373) [-1024.573] -- 0:00:49 222000 -- (-1025.205) (-1027.507) [-1024.421] (-1023.678) * (-1026.357) (-1027.232) [-1026.406] (-1024.709) -- 0:00:49 222500 -- [-1024.280] (-1025.914) (-1024.223) (-1024.238) * [-1025.189] (-1024.429) (-1024.844) (-1025.510) -- 0:00:48 223000 -- (-1024.882) [-1025.322] (-1026.339) (-1024.981) * (-1025.488) (-1023.820) (-1025.029) [-1024.242] -- 0:00:48 223500 -- (-1028.317) [-1025.553] (-1027.609) (-1030.634) * (-1025.634) (-1026.666) [-1025.260] (-1023.941) -- 0:00:48 224000 -- [-1026.251] (-1024.583) (-1023.585) (-1025.948) * (-1024.792) (-1026.340) (-1026.068) [-1025.936] -- 0:00:48 224500 -- (-1030.641) (-1026.434) [-1024.464] (-1024.943) * [-1025.820] (-1024.614) (-1028.585) (-1028.081) -- 0:00:48 225000 -- (-1023.562) (-1025.419) (-1024.400) [-1030.560] * (-1027.026) (-1023.948) [-1024.811] (-1025.863) -- 0:00:48 Average standard deviation of split frequencies: 0.017346 225500 -- (-1024.786) (-1024.886) (-1027.206) [-1025.008] * (-1027.900) (-1027.305) (-1024.176) [-1026.036] -- 0:00:48 226000 -- (-1024.716) (-1026.045) (-1024.709) [-1024.326] * [-1026.080] (-1029.712) (-1023.833) (-1025.783) -- 0:00:47 226500 -- (-1027.376) (-1025.163) (-1025.367) [-1026.017] * (-1025.360) [-1026.390] (-1025.936) (-1025.506) -- 0:00:47 227000 -- (-1029.107) (-1024.971) (-1025.785) [-1025.083] * (-1024.122) (-1026.996) [-1026.290] (-1025.307) -- 0:00:47 227500 -- (-1025.368) (-1026.502) (-1026.555) [-1024.406] * (-1025.023) (-1025.661) (-1028.292) [-1027.465] -- 0:00:47 228000 -- (-1024.773) (-1026.106) [-1026.403] (-1024.008) * (-1030.223) (-1023.751) (-1025.937) [-1025.464] -- 0:00:47 228500 -- (-1023.859) (-1024.891) [-1026.164] (-1024.786) * [-1026.422] (-1024.317) (-1025.673) (-1025.048) -- 0:00:47 229000 -- (-1025.559) (-1026.838) (-1026.509) [-1025.021] * (-1025.509) (-1024.234) [-1026.251] (-1024.363) -- 0:00:47 229500 -- [-1026.289] (-1025.835) (-1025.064) (-1028.113) * [-1025.257] (-1024.957) (-1030.404) (-1025.106) -- 0:00:47 230000 -- (-1026.076) (-1025.273) (-1025.979) [-1025.442] * (-1028.614) (-1025.093) [-1028.935] (-1024.805) -- 0:00:46 Average standard deviation of split frequencies: 0.017102 230500 -- (-1026.556) (-1025.225) [-1027.331] (-1026.717) * [-1026.189] (-1023.478) (-1028.328) (-1024.019) -- 0:00:46 231000 -- (-1023.951) (-1025.707) [-1024.081] (-1028.239) * (-1024.218) [-1023.478] (-1026.004) (-1026.039) -- 0:00:46 231500 -- [-1023.689] (-1026.972) (-1024.349) (-1025.824) * (-1026.587) [-1024.626] (-1025.322) (-1025.454) -- 0:00:46 232000 -- (-1024.699) (-1026.722) [-1024.724] (-1027.382) * (-1024.735) (-1024.955) (-1029.761) [-1031.026] -- 0:00:46 232500 -- (-1026.809) (-1025.735) [-1024.766] (-1028.255) * (-1024.238) (-1024.626) (-1029.828) [-1025.314] -- 0:00:46 233000 -- (-1025.813) (-1026.867) [-1025.194] (-1026.201) * [-1025.891] (-1024.566) (-1028.426) (-1026.845) -- 0:00:46 233500 -- (-1027.339) (-1026.332) (-1026.551) [-1029.233] * (-1029.806) (-1025.665) (-1026.976) [-1024.064] -- 0:00:45 234000 -- (-1027.219) [-1025.422] (-1025.047) (-1027.987) * (-1024.850) (-1027.198) (-1024.912) [-1024.057] -- 0:00:49 234500 -- (-1025.544) (-1024.313) (-1026.358) [-1026.643] * (-1026.106) (-1025.733) (-1027.981) [-1024.225] -- 0:00:48 235000 -- (-1025.910) (-1024.029) [-1027.632] (-1025.676) * (-1029.504) (-1027.010) (-1029.549) [-1026.967] -- 0:00:48 Average standard deviation of split frequencies: 0.018532 235500 -- [-1024.058] (-1023.509) (-1026.091) (-1025.308) * [-1025.679] (-1025.988) (-1026.765) (-1026.766) -- 0:00:48 236000 -- (-1027.134) (-1023.637) [-1026.310] (-1026.642) * [-1026.469] (-1024.876) (-1030.694) (-1024.567) -- 0:00:48 236500 -- [-1026.015] (-1024.052) (-1031.097) (-1029.335) * (-1026.495) (-1024.351) (-1024.580) [-1025.827] -- 0:00:48 237000 -- (-1024.681) [-1027.403] (-1029.483) (-1026.226) * (-1026.294) (-1024.526) (-1025.308) [-1023.914] -- 0:00:48 237500 -- (-1024.446) (-1027.538) (-1030.721) [-1024.268] * [-1023.657] (-1024.589) (-1027.204) (-1023.917) -- 0:00:48 238000 -- (-1025.422) (-1024.545) [-1024.862] (-1024.637) * [-1023.976] (-1024.596) (-1025.312) (-1024.558) -- 0:00:48 238500 -- (-1027.181) [-1024.892] (-1030.455) (-1027.671) * (-1024.291) (-1023.386) (-1026.827) [-1025.010] -- 0:00:47 239000 -- (-1025.120) (-1024.706) (-1027.549) [-1025.365] * [-1024.663] (-1024.328) (-1025.494) (-1024.503) -- 0:00:47 239500 -- [-1024.206] (-1024.573) (-1027.978) (-1024.784) * [-1028.732] (-1026.205) (-1026.851) (-1026.277) -- 0:00:47 240000 -- [-1025.213] (-1026.220) (-1027.589) (-1027.903) * [-1028.486] (-1029.419) (-1023.701) (-1026.804) -- 0:00:47 Average standard deviation of split frequencies: 0.019043 240500 -- (-1024.777) (-1028.115) (-1026.287) [-1025.100] * (-1028.530) (-1027.696) (-1032.030) [-1023.908] -- 0:00:47 241000 -- (-1024.216) (-1028.876) (-1024.421) [-1024.210] * (-1024.989) (-1024.116) (-1025.032) [-1024.074] -- 0:00:47 241500 -- (-1025.064) [-1027.556] (-1029.178) (-1026.684) * [-1025.402] (-1024.350) (-1023.729) (-1025.868) -- 0:00:47 242000 -- (-1026.488) [-1024.318] (-1028.458) (-1025.729) * (-1025.331) (-1025.693) (-1028.246) [-1026.530] -- 0:00:46 242500 -- (-1025.294) (-1026.803) [-1024.184] (-1025.151) * [-1024.762] (-1024.939) (-1026.760) (-1025.591) -- 0:00:46 243000 -- (-1028.151) (-1026.709) (-1024.035) [-1025.693] * (-1025.831) [-1024.714] (-1025.848) (-1028.016) -- 0:00:46 243500 -- (-1031.083) (-1024.539) [-1026.993] (-1026.306) * (-1025.115) (-1025.604) (-1027.030) [-1027.161] -- 0:00:46 244000 -- [-1029.003] (-1025.045) (-1028.329) (-1027.629) * (-1025.602) (-1026.597) (-1029.170) [-1027.488] -- 0:00:46 244500 -- [-1028.521] (-1025.522) (-1026.624) (-1025.103) * (-1023.986) (-1025.259) [-1024.269] (-1026.086) -- 0:00:46 245000 -- (-1025.117) [-1029.169] (-1025.067) (-1026.546) * (-1029.383) [-1024.976] (-1024.036) (-1030.913) -- 0:00:46 Average standard deviation of split frequencies: 0.018098 245500 -- (-1024.551) (-1028.016) (-1027.942) [-1027.575] * (-1026.572) [-1024.559] (-1025.597) (-1026.873) -- 0:00:46 246000 -- (-1024.863) (-1026.245) (-1027.539) [-1027.870] * (-1024.602) (-1033.140) (-1024.547) [-1025.241] -- 0:00:45 246500 -- (-1024.129) [-1025.722] (-1027.761) (-1029.488) * (-1024.579) (-1027.836) (-1025.051) [-1026.819] -- 0:00:45 247000 -- (-1024.008) [-1026.701] (-1035.822) (-1023.449) * (-1023.889) (-1025.005) (-1027.717) [-1030.556] -- 0:00:45 247500 -- [-1025.103] (-1028.190) (-1029.708) (-1026.003) * [-1027.181] (-1024.308) (-1025.449) (-1027.735) -- 0:00:45 248000 -- [-1023.774] (-1030.504) (-1025.854) (-1027.677) * (-1027.084) (-1032.005) (-1025.527) [-1024.511] -- 0:00:45 248500 -- (-1025.868) (-1026.052) (-1026.684) [-1024.771] * (-1026.662) [-1026.277] (-1025.227) (-1024.425) -- 0:00:45 249000 -- [-1023.917] (-1025.920) (-1025.945) (-1029.459) * (-1024.531) (-1025.507) [-1025.009] (-1024.617) -- 0:00:45 249500 -- [-1023.871] (-1026.519) (-1029.812) (-1030.361) * (-1025.066) (-1028.557) (-1027.110) [-1025.994] -- 0:00:45 250000 -- [-1023.874] (-1025.790) (-1026.728) (-1025.706) * (-1024.497) (-1028.750) [-1028.285] (-1027.310) -- 0:00:45 Average standard deviation of split frequencies: 0.017030 250500 -- (-1024.264) (-1024.052) [-1027.733] (-1029.910) * (-1023.803) (-1026.401) (-1028.326) [-1025.334] -- 0:00:47 251000 -- (-1025.067) [-1024.315] (-1027.991) (-1025.825) * (-1023.981) (-1024.434) (-1026.521) [-1024.547] -- 0:00:47 251500 -- (-1024.083) [-1024.701] (-1029.888) (-1024.848) * (-1026.003) (-1024.260) [-1025.094] (-1023.774) -- 0:00:47 252000 -- (-1026.211) [-1024.839] (-1027.508) (-1027.358) * (-1028.257) [-1027.550] (-1029.421) (-1023.504) -- 0:00:47 252500 -- (-1027.611) (-1028.918) [-1028.776] (-1024.221) * (-1025.198) (-1024.598) (-1024.053) [-1024.917] -- 0:00:47 253000 -- (-1025.045) (-1030.048) [-1025.492] (-1025.374) * (-1025.162) (-1024.715) (-1023.715) [-1025.300] -- 0:00:47 253500 -- (-1024.297) (-1025.903) [-1025.885] (-1025.514) * [-1023.983] (-1024.452) (-1026.996) (-1025.224) -- 0:00:47 254000 -- (-1026.278) [-1025.059] (-1030.534) (-1028.387) * (-1028.015) [-1023.746] (-1027.382) (-1025.991) -- 0:00:46 254500 -- [-1027.040] (-1027.317) (-1031.744) (-1026.183) * (-1030.905) [-1025.021] (-1024.595) (-1028.572) -- 0:00:46 255000 -- [-1027.177] (-1027.195) (-1031.020) (-1028.550) * (-1030.616) (-1024.927) [-1024.436] (-1036.261) -- 0:00:46 Average standard deviation of split frequencies: 0.017289 255500 -- (-1025.207) [-1024.707] (-1029.446) (-1025.919) * [-1023.885] (-1025.206) (-1025.576) (-1027.793) -- 0:00:46 256000 -- (-1025.226) (-1025.922) (-1027.143) [-1025.954] * [-1024.370] (-1028.814) (-1024.959) (-1025.620) -- 0:00:46 256500 -- (-1023.983) (-1025.651) (-1025.112) [-1025.847] * [-1026.992] (-1025.470) (-1032.441) (-1024.930) -- 0:00:46 257000 -- (-1024.676) [-1024.463] (-1027.154) (-1024.502) * (-1025.327) (-1025.326) [-1024.085] (-1028.637) -- 0:00:46 257500 -- (-1026.915) (-1024.619) [-1027.970] (-1024.867) * (-1024.131) (-1027.316) (-1025.045) [-1026.698] -- 0:00:46 258000 -- [-1024.084] (-1026.547) (-1032.148) (-1026.384) * (-1025.459) (-1027.240) (-1034.731) [-1025.489] -- 0:00:46 258500 -- (-1024.103) [-1024.895] (-1026.200) (-1025.432) * [-1028.739] (-1023.869) (-1025.171) (-1025.818) -- 0:00:45 259000 -- (-1024.321) [-1027.055] (-1030.662) (-1025.356) * [-1024.178] (-1024.173) (-1024.578) (-1024.063) -- 0:00:45 259500 -- [-1026.483] (-1026.841) (-1027.155) (-1026.897) * (-1023.559) (-1023.901) [-1026.705] (-1024.579) -- 0:00:45 260000 -- (-1029.173) (-1026.415) (-1025.577) [-1026.522] * (-1024.214) (-1024.792) (-1027.768) [-1023.886] -- 0:00:45 Average standard deviation of split frequencies: 0.016979 260500 -- (-1028.767) [-1025.051] (-1024.650) (-1025.809) * (-1026.192) (-1024.877) [-1025.430] (-1025.721) -- 0:00:45 261000 -- (-1028.999) (-1026.905) (-1025.179) [-1025.795] * (-1030.253) (-1025.150) [-1024.689] (-1025.574) -- 0:00:45 261500 -- (-1026.430) [-1027.897] (-1027.239) (-1025.038) * (-1026.149) (-1025.434) (-1024.570) [-1028.974] -- 0:00:45 262000 -- (-1026.374) (-1026.270) (-1026.727) [-1026.769] * [-1028.086] (-1029.165) (-1024.595) (-1024.424) -- 0:00:45 262500 -- (-1025.258) (-1026.515) (-1027.582) [-1023.655] * [-1028.475] (-1024.098) (-1024.892) (-1025.576) -- 0:00:44 263000 -- (-1024.932) (-1025.722) [-1024.902] (-1024.743) * (-1029.148) (-1025.871) (-1025.322) [-1025.772] -- 0:00:44 263500 -- [-1024.154] (-1028.356) (-1026.540) (-1024.594) * (-1026.295) [-1025.577] (-1026.174) (-1025.375) -- 0:00:44 264000 -- (-1024.383) (-1023.995) (-1025.481) [-1025.979] * (-1026.961) (-1029.891) [-1029.248] (-1023.859) -- 0:00:44 264500 -- [-1025.054] (-1024.242) (-1025.023) (-1025.878) * [-1026.917] (-1027.994) (-1025.964) (-1024.623) -- 0:00:44 265000 -- (-1026.914) [-1028.093] (-1024.920) (-1028.549) * (-1027.853) [-1023.856] (-1024.716) (-1028.860) -- 0:00:44 Average standard deviation of split frequencies: 0.017069 265500 -- (-1026.613) (-1025.345) (-1025.307) [-1026.237] * (-1025.846) [-1024.820] (-1024.730) (-1025.540) -- 0:00:44 266000 -- (-1027.710) (-1025.121) (-1027.877) [-1025.439] * [-1025.580] (-1024.754) (-1026.792) (-1025.056) -- 0:00:44 266500 -- (-1025.035) [-1024.584] (-1026.490) (-1024.653) * (-1026.168) (-1026.022) [-1028.510] (-1025.234) -- 0:00:44 267000 -- [-1025.929] (-1023.530) (-1023.816) (-1028.998) * [-1025.001] (-1024.964) (-1028.692) (-1032.325) -- 0:00:46 267500 -- (-1030.741) [-1025.490] (-1024.859) (-1024.187) * (-1027.430) (-1024.756) [-1024.699] (-1027.797) -- 0:00:46 268000 -- (-1031.279) (-1024.607) [-1023.354] (-1027.095) * [-1027.125] (-1024.316) (-1026.628) (-1028.486) -- 0:00:46 268500 -- (-1034.217) (-1023.697) [-1025.123] (-1028.681) * [-1024.879] (-1027.670) (-1024.303) (-1027.475) -- 0:00:46 269000 -- (-1023.949) (-1023.910) [-1024.472] (-1026.680) * (-1024.765) (-1025.463) (-1025.719) [-1025.429] -- 0:00:46 269500 -- [-1026.445] (-1023.581) (-1023.618) (-1026.530) * [-1024.811] (-1025.691) (-1025.774) (-1027.073) -- 0:00:46 270000 -- (-1032.049) (-1023.641) [-1024.410] (-1025.824) * [-1025.562] (-1026.491) (-1024.404) (-1027.979) -- 0:00:45 Average standard deviation of split frequencies: 0.017233 270500 -- (-1028.738) (-1024.900) (-1025.070) [-1024.997] * (-1027.708) (-1025.203) (-1026.385) [-1025.630] -- 0:00:45 271000 -- (-1028.180) (-1026.465) [-1024.302] (-1028.294) * [-1024.238] (-1024.458) (-1026.152) (-1023.651) -- 0:00:45 271500 -- (-1027.826) (-1024.751) (-1029.258) [-1026.618] * (-1025.298) (-1025.252) (-1028.348) [-1024.684] -- 0:00:45 272000 -- (-1026.053) (-1025.704) [-1025.503] (-1025.702) * (-1023.877) (-1024.222) (-1027.069) [-1025.442] -- 0:00:45 272500 -- [-1028.798] (-1026.606) (-1025.831) (-1024.507) * [-1024.980] (-1024.690) (-1025.665) (-1029.039) -- 0:00:45 273000 -- [-1024.584] (-1024.999) (-1025.273) (-1025.719) * [-1027.500] (-1024.231) (-1025.710) (-1026.439) -- 0:00:45 273500 -- (-1029.330) (-1025.734) (-1025.981) [-1024.096] * [-1024.815] (-1025.112) (-1024.175) (-1025.580) -- 0:00:45 274000 -- (-1024.900) (-1024.286) [-1026.077] (-1023.949) * (-1027.084) [-1025.385] (-1026.139) (-1024.755) -- 0:00:45 274500 -- (-1025.564) [-1024.644] (-1026.847) (-1028.072) * (-1029.704) (-1027.730) (-1028.849) [-1024.461] -- 0:00:44 275000 -- [-1024.232] (-1024.754) (-1025.386) (-1026.398) * [-1029.449] (-1026.176) (-1028.240) (-1024.716) -- 0:00:44 Average standard deviation of split frequencies: 0.017260 275500 -- [-1029.349] (-1024.291) (-1027.266) (-1026.365) * (-1026.620) (-1034.606) (-1028.177) [-1026.790] -- 0:00:44 276000 -- (-1027.081) (-1023.690) (-1025.848) [-1027.003] * [-1025.878] (-1031.852) (-1025.573) (-1029.091) -- 0:00:44 276500 -- (-1026.324) (-1025.792) [-1026.110] (-1027.009) * (-1025.664) (-1024.791) [-1026.483] (-1026.213) -- 0:00:44 277000 -- [-1023.641] (-1028.312) (-1025.859) (-1023.993) * [-1026.263] (-1024.594) (-1024.684) (-1026.156) -- 0:00:44 277500 -- [-1023.550] (-1027.824) (-1023.898) (-1026.518) * [-1025.153] (-1023.678) (-1027.680) (-1025.339) -- 0:00:44 278000 -- (-1024.287) (-1028.727) (-1023.469) [-1026.698] * [-1023.804] (-1028.203) (-1025.918) (-1024.780) -- 0:00:44 278500 -- (-1023.897) (-1025.248) [-1025.141] (-1025.330) * (-1026.602) (-1028.004) [-1027.226] (-1025.194) -- 0:00:44 279000 -- (-1023.473) [-1023.768] (-1024.741) (-1026.567) * (-1030.580) (-1026.557) (-1028.273) [-1023.975] -- 0:00:43 279500 -- (-1025.271) (-1024.850) (-1024.664) [-1028.295] * (-1026.437) (-1025.531) (-1028.401) [-1024.147] -- 0:00:43 280000 -- [-1024.790] (-1024.096) (-1023.670) (-1026.409) * (-1027.866) (-1024.299) [-1028.221] (-1024.164) -- 0:00:43 Average standard deviation of split frequencies: 0.016884 280500 -- [-1023.290] (-1025.900) (-1023.691) (-1028.037) * (-1024.804) [-1026.217] (-1026.681) (-1025.310) -- 0:00:43 281000 -- (-1025.722) [-1024.342] (-1024.888) (-1028.131) * (-1027.923) (-1027.026) (-1024.102) [-1025.171] -- 0:00:43 281500 -- (-1025.184) (-1024.436) [-1029.161] (-1024.154) * [-1025.836] (-1025.769) (-1024.739) (-1024.739) -- 0:00:43 282000 -- (-1025.252) (-1025.931) (-1027.731) [-1024.305] * [-1025.053] (-1024.899) (-1024.297) (-1024.540) -- 0:00:43 282500 -- [-1024.853] (-1027.574) (-1025.536) (-1025.229) * (-1028.855) (-1027.477) [-1025.707] (-1024.115) -- 0:00:43 283000 -- (-1029.471) [-1024.332] (-1023.288) (-1024.678) * (-1025.369) [-1028.209] (-1024.540) (-1027.136) -- 0:00:45 283500 -- (-1027.382) (-1023.950) (-1023.988) [-1025.655] * (-1024.454) (-1025.344) (-1025.862) [-1025.561] -- 0:00:45 284000 -- (-1024.355) (-1024.058) [-1023.970] (-1024.789) * [-1024.878] (-1025.535) (-1025.062) (-1027.745) -- 0:00:45 284500 -- (-1027.818) (-1024.447) (-1023.703) [-1024.102] * [-1024.751] (-1023.731) (-1024.901) (-1025.047) -- 0:00:45 285000 -- (-1026.178) (-1027.497) [-1025.617] (-1024.667) * (-1024.213) (-1023.673) [-1024.011] (-1025.189) -- 0:00:45 Average standard deviation of split frequencies: 0.016656 285500 -- (-1026.130) (-1027.037) [-1027.798] (-1030.478) * (-1026.854) [-1023.673] (-1023.516) (-1024.542) -- 0:00:45 286000 -- (-1025.432) [-1026.128] (-1027.368) (-1024.627) * (-1024.530) (-1023.374) (-1025.845) [-1023.810] -- 0:00:44 286500 -- (-1026.826) (-1023.890) (-1030.221) [-1024.679] * (-1026.413) (-1024.435) [-1024.897] (-1024.938) -- 0:00:44 287000 -- [-1027.799] (-1024.735) (-1025.145) (-1024.426) * (-1027.126) (-1029.331) [-1027.479] (-1024.966) -- 0:00:44 287500 -- (-1025.780) (-1023.625) (-1026.633) [-1025.820] * (-1024.308) (-1025.262) [-1028.972] (-1025.757) -- 0:00:44 288000 -- (-1026.438) [-1028.297] (-1024.769) (-1025.580) * (-1030.886) (-1026.029) [-1026.185] (-1029.194) -- 0:00:44 288500 -- (-1028.713) (-1024.730) [-1030.858] (-1030.261) * (-1024.563) [-1027.281] (-1028.054) (-1024.695) -- 0:00:44 289000 -- (-1024.957) [-1025.286] (-1027.230) (-1026.088) * [-1024.484] (-1024.890) (-1025.454) (-1024.961) -- 0:00:44 289500 -- (-1024.495) (-1026.966) (-1027.264) [-1025.798] * [-1024.289] (-1025.175) (-1025.897) (-1025.221) -- 0:00:44 290000 -- [-1025.296] (-1025.597) (-1027.479) (-1024.688) * (-1026.950) (-1025.166) [-1025.899] (-1024.934) -- 0:00:44 Average standard deviation of split frequencies: 0.016730 290500 -- (-1023.318) (-1026.386) [-1027.174] (-1024.351) * (-1025.115) (-1028.793) [-1023.654] (-1023.650) -- 0:00:43 291000 -- (-1024.697) (-1026.531) (-1025.032) [-1029.135] * (-1027.355) (-1028.589) [-1027.875] (-1025.428) -- 0:00:43 291500 -- [-1024.330] (-1026.535) (-1024.305) (-1027.536) * (-1025.628) (-1030.953) (-1026.620) [-1024.922] -- 0:00:43 292000 -- [-1024.394] (-1026.633) (-1026.114) (-1026.936) * (-1024.764) (-1031.171) (-1026.882) [-1025.155] -- 0:00:43 292500 -- (-1025.386) [-1030.641] (-1024.956) (-1026.142) * (-1025.415) (-1026.867) (-1024.788) [-1025.470] -- 0:00:43 293000 -- [-1024.149] (-1028.325) (-1026.319) (-1026.339) * (-1025.583) (-1027.436) [-1024.664] (-1023.695) -- 0:00:43 293500 -- (-1028.105) (-1027.839) (-1026.440) [-1025.097] * (-1024.911) (-1028.675) [-1026.202] (-1024.375) -- 0:00:43 294000 -- [-1025.724] (-1030.253) (-1024.822) (-1024.623) * (-1024.066) (-1025.327) [-1025.553] (-1026.296) -- 0:00:43 294500 -- (-1024.728) [-1029.357] (-1023.578) (-1028.305) * (-1024.464) [-1026.919] (-1028.246) (-1029.651) -- 0:00:43 295000 -- (-1026.960) (-1026.163) (-1027.604) [-1025.454] * (-1024.011) [-1028.741] (-1026.253) (-1027.391) -- 0:00:43 Average standard deviation of split frequencies: 0.019279 295500 -- (-1024.989) [-1026.895] (-1027.640) (-1025.918) * [-1024.146] (-1025.656) (-1024.980) (-1028.811) -- 0:00:42 296000 -- (-1026.968) (-1025.629) [-1024.098] (-1025.207) * (-1024.266) [-1024.276] (-1026.189) (-1026.422) -- 0:00:42 296500 -- (-1025.294) (-1024.935) [-1024.251] (-1028.800) * (-1025.270) (-1025.103) (-1027.049) [-1027.372] -- 0:00:42 297000 -- (-1024.027) (-1026.264) [-1024.486] (-1028.105) * (-1024.789) (-1025.628) (-1025.449) [-1027.705] -- 0:00:42 297500 -- (-1023.573) (-1026.815) [-1025.886] (-1032.123) * (-1023.883) (-1026.810) (-1027.998) [-1023.857] -- 0:00:42 298000 -- [-1023.954] (-1024.612) (-1025.201) (-1027.086) * (-1025.091) (-1030.797) (-1027.570) [-1024.876] -- 0:00:42 298500 -- [-1025.250] (-1023.723) (-1024.590) (-1028.235) * (-1025.248) (-1027.990) (-1027.010) [-1024.889] -- 0:00:42 299000 -- (-1026.866) [-1024.210] (-1024.927) (-1026.882) * (-1024.618) [-1026.412] (-1026.375) (-1025.501) -- 0:00:42 299500 -- (-1025.257) (-1026.922) (-1026.944) [-1026.743] * (-1027.130) (-1029.536) [-1027.823] (-1025.530) -- 0:00:44 300000 -- [-1028.173] (-1026.357) (-1030.106) (-1028.359) * (-1027.152) [-1027.626] (-1027.425) (-1024.840) -- 0:00:44 Average standard deviation of split frequencies: 0.018814 300500 -- [-1024.248] (-1027.300) (-1025.953) (-1027.895) * (-1029.017) (-1025.369) (-1028.327) [-1024.966] -- 0:00:44 301000 -- (-1027.457) [-1024.677] (-1027.035) (-1027.296) * (-1025.324) [-1026.679] (-1028.307) (-1025.595) -- 0:00:44 301500 -- (-1024.661) (-1024.677) [-1024.739] (-1030.028) * (-1029.553) (-1025.110) (-1025.806) [-1025.635] -- 0:00:44 302000 -- (-1023.909) (-1029.000) [-1024.305] (-1027.059) * (-1024.734) (-1025.402) [-1024.163] (-1027.169) -- 0:00:43 302500 -- (-1027.437) (-1025.913) (-1023.761) [-1025.242] * (-1024.496) (-1024.266) [-1026.030] (-1029.269) -- 0:00:43 303000 -- (-1028.636) (-1024.051) [-1025.665] (-1024.845) * [-1024.190] (-1026.763) (-1025.242) (-1026.406) -- 0:00:43 303500 -- (-1024.727) (-1025.585) [-1025.532] (-1025.454) * (-1024.329) (-1024.103) [-1023.529] (-1025.046) -- 0:00:43 304000 -- (-1026.598) (-1024.725) (-1027.211) [-1024.676] * (-1026.841) (-1023.833) [-1025.511] (-1026.329) -- 0:00:43 304500 -- (-1026.677) [-1030.846] (-1026.952) (-1026.164) * [-1025.947] (-1025.353) (-1025.758) (-1026.465) -- 0:00:43 305000 -- [-1025.442] (-1027.029) (-1029.523) (-1023.553) * (-1024.305) [-1027.638] (-1024.018) (-1025.155) -- 0:00:43 Average standard deviation of split frequencies: 0.019297 305500 -- [-1025.862] (-1026.137) (-1027.998) (-1027.470) * (-1024.045) (-1028.258) (-1027.169) [-1024.123] -- 0:00:43 306000 -- [-1025.834] (-1026.108) (-1026.589) (-1026.256) * (-1023.705) (-1023.877) (-1024.209) [-1025.416] -- 0:00:43 306500 -- (-1023.885) (-1026.797) (-1027.347) [-1025.265] * (-1024.219) [-1024.780] (-1031.761) (-1026.834) -- 0:00:42 307000 -- (-1026.317) (-1027.384) [-1025.838] (-1027.176) * (-1025.221) (-1023.651) (-1033.783) [-1025.579] -- 0:00:42 307500 -- (-1025.294) [-1025.794] (-1026.019) (-1027.564) * (-1024.720) [-1023.591] (-1033.153) (-1025.727) -- 0:00:42 308000 -- (-1029.909) [-1026.941] (-1023.946) (-1024.603) * (-1026.487) (-1023.529) (-1025.758) [-1025.983] -- 0:00:42 308500 -- (-1030.657) (-1028.235) [-1024.528] (-1028.433) * (-1025.389) [-1024.690] (-1024.318) (-1025.909) -- 0:00:42 309000 -- (-1024.689) (-1024.843) (-1029.263) [-1025.958] * (-1026.576) (-1026.931) (-1024.665) [-1024.386] -- 0:00:42 309500 -- [-1023.791] (-1024.952) (-1027.524) (-1025.360) * [-1024.249] (-1024.588) (-1025.304) (-1024.694) -- 0:00:42 310000 -- (-1023.746) (-1028.775) (-1026.850) [-1028.472] * (-1029.158) [-1024.081] (-1026.500) (-1026.783) -- 0:00:42 Average standard deviation of split frequencies: 0.018768 310500 -- (-1023.553) (-1025.216) [-1030.779] (-1026.671) * (-1028.628) [-1024.059] (-1024.414) (-1026.197) -- 0:00:42 311000 -- [-1023.356] (-1027.198) (-1026.169) (-1026.118) * (-1027.637) (-1023.990) [-1023.917] (-1023.761) -- 0:00:42 311500 -- (-1024.619) [-1025.307] (-1025.725) (-1025.532) * (-1024.709) (-1024.135) [-1024.910] (-1024.406) -- 0:00:41 312000 -- (-1023.775) [-1025.319] (-1025.966) (-1024.618) * (-1029.349) (-1026.430) [-1024.481] (-1024.191) -- 0:00:41 312500 -- (-1024.567) [-1025.247] (-1025.917) (-1031.232) * (-1025.416) (-1024.160) [-1025.869] (-1025.663) -- 0:00:41 313000 -- (-1024.848) [-1026.083] (-1026.650) (-1026.048) * (-1024.717) (-1027.025) [-1026.060] (-1027.887) -- 0:00:41 313500 -- (-1026.241) (-1028.782) [-1024.558] (-1025.668) * [-1024.135] (-1025.475) (-1025.204) (-1023.778) -- 0:00:41 314000 -- (-1025.436) (-1028.589) [-1024.310] (-1027.399) * (-1024.688) (-1025.134) (-1028.045) [-1024.634] -- 0:00:41 314500 -- (-1023.986) [-1026.534] (-1025.100) (-1026.987) * [-1026.692] (-1025.800) (-1025.667) (-1025.241) -- 0:00:41 315000 -- (-1025.598) (-1025.163) (-1028.112) [-1024.287] * (-1024.763) (-1030.302) (-1029.767) [-1025.970] -- 0:00:41 Average standard deviation of split frequencies: 0.017901 315500 -- [-1026.662] (-1025.626) (-1028.078) (-1024.415) * (-1023.812) (-1033.966) (-1028.179) [-1024.182] -- 0:00:41 316000 -- [-1031.031] (-1025.098) (-1026.211) (-1026.010) * (-1023.570) (-1024.477) (-1026.536) [-1024.366] -- 0:00:43 316500 -- (-1028.614) [-1025.204] (-1026.607) (-1024.538) * (-1023.699) (-1023.894) [-1024.847] (-1024.818) -- 0:00:43 317000 -- [-1029.779] (-1024.973) (-1026.556) (-1026.751) * [-1025.273] (-1024.220) (-1026.877) (-1024.802) -- 0:00:43 317500 -- (-1026.021) [-1025.240] (-1023.856) (-1028.398) * (-1025.812) (-1024.202) [-1025.370] (-1024.363) -- 0:00:42 318000 -- [-1026.728] (-1023.847) (-1024.881) (-1023.841) * (-1028.848) (-1023.746) [-1027.057] (-1024.107) -- 0:00:42 318500 -- (-1027.239) (-1024.577) [-1024.701] (-1023.726) * (-1027.279) (-1031.914) [-1026.173] (-1024.574) -- 0:00:42 319000 -- (-1027.246) (-1026.994) [-1025.997] (-1023.726) * [-1024.102] (-1025.124) (-1026.568) (-1030.560) -- 0:00:42 319500 -- [-1027.245] (-1024.355) (-1024.073) (-1028.363) * (-1024.377) (-1025.483) (-1026.596) [-1025.363] -- 0:00:42 320000 -- [-1028.001] (-1024.801) (-1024.083) (-1029.259) * (-1028.518) (-1033.179) (-1025.224) [-1023.732] -- 0:00:42 Average standard deviation of split frequencies: 0.017409 320500 -- (-1030.864) (-1028.096) [-1023.889] (-1026.829) * (-1025.536) (-1027.794) (-1027.871) [-1024.414] -- 0:00:42 321000 -- (-1028.426) (-1030.681) (-1029.188) [-1026.295] * (-1027.208) [-1028.031] (-1031.157) (-1024.878) -- 0:00:42 321500 -- [-1027.698] (-1029.167) (-1024.916) (-1024.483) * (-1027.049) (-1026.858) [-1024.474] (-1027.841) -- 0:00:42 322000 -- (-1027.304) (-1023.768) (-1024.435) [-1024.095] * (-1024.555) (-1025.951) [-1024.246] (-1027.128) -- 0:00:42 322500 -- (-1029.318) (-1026.761) [-1024.494] (-1024.504) * (-1025.105) [-1026.876] (-1026.384) (-1025.531) -- 0:00:42 323000 -- (-1028.442) (-1025.032) (-1026.671) [-1024.155] * (-1024.231) (-1025.364) [-1027.499] (-1023.735) -- 0:00:41 323500 -- (-1026.801) [-1025.263] (-1023.814) (-1023.777) * (-1024.114) (-1026.760) [-1026.415] (-1023.848) -- 0:00:41 324000 -- (-1029.199) [-1024.837] (-1023.869) (-1027.581) * (-1028.332) [-1024.207] (-1025.646) (-1025.322) -- 0:00:41 324500 -- (-1028.862) [-1025.924] (-1025.777) (-1023.470) * (-1026.896) (-1024.009) [-1023.870] (-1028.797) -- 0:00:41 325000 -- [-1026.970] (-1025.976) (-1031.964) (-1024.183) * (-1029.167) (-1024.894) [-1024.852] (-1030.550) -- 0:00:41 Average standard deviation of split frequencies: 0.016972 325500 -- (-1024.921) (-1025.255) (-1023.473) [-1024.810] * (-1027.837) (-1024.547) [-1026.073] (-1025.974) -- 0:00:41 326000 -- (-1028.913) (-1024.079) [-1023.261] (-1025.199) * (-1026.697) (-1024.521) [-1027.595] (-1026.691) -- 0:00:41 326500 -- [-1029.474] (-1024.079) (-1024.193) (-1023.664) * (-1024.746) [-1024.625] (-1028.067) (-1025.973) -- 0:00:41 327000 -- (-1028.034) [-1023.929] (-1024.483) (-1028.061) * (-1029.737) [-1024.544] (-1025.605) (-1026.905) -- 0:00:41 327500 -- (-1029.518) (-1023.925) [-1026.379] (-1024.932) * (-1024.788) (-1026.489) [-1027.230] (-1025.731) -- 0:00:41 328000 -- (-1027.107) (-1025.078) (-1025.787) [-1027.248] * [-1024.265] (-1028.246) (-1026.903) (-1025.797) -- 0:00:40 328500 -- [-1026.917] (-1024.413) (-1026.456) (-1027.607) * (-1025.800) (-1031.292) [-1024.841] (-1029.160) -- 0:00:40 329000 -- (-1025.705) [-1026.292] (-1028.419) (-1030.343) * (-1026.199) (-1029.829) (-1027.183) [-1025.124] -- 0:00:40 329500 -- [-1024.668] (-1026.143) (-1026.504) (-1026.341) * [-1025.342] (-1027.040) (-1026.381) (-1023.921) -- 0:00:40 330000 -- [-1024.430] (-1026.578) (-1028.752) (-1024.672) * (-1024.040) (-1025.516) [-1025.416] (-1024.970) -- 0:00:40 Average standard deviation of split frequencies: 0.017036 330500 -- (-1024.683) [-1028.729] (-1025.323) (-1024.805) * (-1025.230) (-1024.437) [-1024.438] (-1029.582) -- 0:00:40 331000 -- (-1026.675) (-1024.951) (-1025.075) [-1024.995] * (-1026.682) [-1024.581] (-1025.498) (-1025.316) -- 0:00:40 331500 -- (-1024.177) [-1024.613] (-1026.241) (-1027.012) * (-1026.859) [-1027.173] (-1027.530) (-1026.282) -- 0:00:40 332000 -- [-1024.621] (-1025.769) (-1025.964) (-1028.199) * (-1024.884) (-1026.434) [-1027.253] (-1024.688) -- 0:00:40 332500 -- [-1027.580] (-1024.073) (-1024.934) (-1029.110) * [-1031.073] (-1026.494) (-1026.892) (-1029.282) -- 0:00:42 333000 -- (-1024.885) (-1028.739) (-1029.168) [-1025.103] * (-1024.810) [-1027.803] (-1030.922) (-1027.094) -- 0:00:42 333500 -- (-1025.777) (-1031.980) [-1025.631] (-1030.132) * (-1025.420) [-1031.780] (-1024.967) (-1025.500) -- 0:00:41 334000 -- (-1026.377) (-1026.562) [-1026.287] (-1026.357) * (-1023.852) (-1030.958) [-1024.610] (-1026.842) -- 0:00:41 334500 -- (-1026.072) (-1023.945) [-1025.884] (-1026.328) * (-1024.294) (-1025.238) [-1024.333] (-1024.160) -- 0:00:41 335000 -- (-1023.815) (-1028.176) (-1024.640) [-1028.514] * [-1023.433] (-1024.844) (-1024.703) (-1024.597) -- 0:00:41 Average standard deviation of split frequencies: 0.016541 335500 -- (-1024.283) [-1026.467] (-1023.467) (-1030.820) * [-1024.495] (-1025.203) (-1028.107) (-1030.900) -- 0:00:41 336000 -- (-1025.408) [-1025.497] (-1024.246) (-1028.316) * (-1024.346) (-1026.154) [-1025.323] (-1026.985) -- 0:00:41 336500 -- (-1025.112) [-1028.783] (-1025.480) (-1029.372) * [-1026.062] (-1025.705) (-1024.148) (-1024.960) -- 0:00:41 337000 -- (-1027.815) (-1026.461) [-1025.858] (-1029.486) * [-1025.759] (-1024.385) (-1024.767) (-1025.737) -- 0:00:41 337500 -- (-1025.584) (-1023.759) [-1026.329] (-1024.933) * [-1025.063] (-1025.843) (-1024.597) (-1028.143) -- 0:00:41 338000 -- (-1025.276) (-1024.933) [-1028.358] (-1030.780) * (-1026.633) [-1025.345] (-1024.231) (-1024.386) -- 0:00:41 338500 -- [-1026.798] (-1023.521) (-1025.389) (-1025.582) * (-1026.013) [-1026.434] (-1024.732) (-1024.396) -- 0:00:41 339000 -- [-1026.383] (-1023.547) (-1025.166) (-1028.960) * [-1025.625] (-1028.609) (-1025.118) (-1024.769) -- 0:00:40 339500 -- (-1025.624) (-1025.559) [-1026.216] (-1026.635) * (-1025.444) [-1028.423] (-1023.828) (-1025.520) -- 0:00:40 340000 -- [-1023.492] (-1025.014) (-1024.172) (-1026.849) * (-1024.374) (-1027.226) [-1024.154] (-1025.639) -- 0:00:40 Average standard deviation of split frequencies: 0.015983 340500 -- [-1025.996] (-1027.074) (-1024.671) (-1026.595) * (-1025.737) (-1026.338) [-1024.485] (-1025.424) -- 0:00:40 341000 -- [-1024.362] (-1025.084) (-1024.539) (-1024.734) * [-1024.277] (-1025.769) (-1023.893) (-1025.988) -- 0:00:40 341500 -- (-1028.278) (-1024.615) (-1024.110) [-1024.711] * [-1025.889] (-1028.750) (-1025.237) (-1024.553) -- 0:00:40 342000 -- (-1026.027) [-1024.630] (-1025.003) (-1024.008) * (-1023.796) (-1027.784) (-1027.419) [-1024.253] -- 0:00:40 342500 -- [-1025.860] (-1026.604) (-1025.620) (-1026.273) * (-1024.295) (-1024.317) (-1029.391) [-1025.686] -- 0:00:40 343000 -- [-1029.252] (-1025.481) (-1024.675) (-1025.700) * (-1026.383) (-1025.245) (-1029.256) [-1024.502] -- 0:00:40 343500 -- (-1027.686) (-1026.206) [-1026.136] (-1028.598) * (-1024.444) [-1025.244] (-1027.853) (-1024.075) -- 0:00:40 344000 -- (-1024.298) (-1025.976) [-1024.814] (-1025.090) * [-1023.784] (-1026.260) (-1028.459) (-1025.366) -- 0:00:40 344500 -- (-1024.946) (-1023.379) [-1024.791] (-1027.692) * (-1024.983) [-1024.043] (-1026.625) (-1026.827) -- 0:00:39 345000 -- [-1025.114] (-1026.039) (-1025.337) (-1025.798) * (-1027.068) [-1023.545] (-1024.986) (-1023.789) -- 0:00:39 Average standard deviation of split frequencies: 0.015259 345500 -- (-1024.600) (-1028.464) [-1030.485] (-1026.470) * [-1028.657] (-1028.053) (-1025.614) (-1026.450) -- 0:00:39 346000 -- (-1023.891) [-1026.670] (-1027.736) (-1028.309) * (-1028.165) (-1023.445) (-1030.918) [-1026.947] -- 0:00:39 346500 -- (-1024.669) [-1027.731] (-1024.631) (-1025.546) * [-1025.411] (-1026.418) (-1030.464) (-1023.727) -- 0:00:39 347000 -- (-1029.344) [-1025.126] (-1023.842) (-1027.629) * (-1024.794) [-1024.878] (-1025.243) (-1024.104) -- 0:00:39 347500 -- [-1024.178] (-1027.275) (-1027.276) (-1025.279) * (-1027.163) [-1024.818] (-1025.944) (-1025.352) -- 0:00:39 348000 -- (-1026.441) (-1025.037) (-1026.062) [-1025.906] * (-1029.557) (-1026.225) (-1024.441) [-1025.151] -- 0:00:41 348500 -- (-1026.201) (-1026.084) (-1027.361) [-1025.614] * (-1024.870) [-1025.481] (-1024.877) (-1024.218) -- 0:00:41 349000 -- (-1024.318) (-1026.854) [-1025.566] (-1026.621) * (-1025.306) (-1026.163) [-1025.298] (-1025.401) -- 0:00:41 349500 -- [-1029.464] (-1024.184) (-1026.313) (-1025.103) * [-1024.171] (-1025.831) (-1025.693) (-1026.756) -- 0:00:40 350000 -- (-1025.221) [-1024.632] (-1029.356) (-1024.369) * (-1025.935) [-1025.825] (-1024.270) (-1025.721) -- 0:00:40 Average standard deviation of split frequencies: 0.014787 350500 -- (-1027.925) (-1024.154) [-1027.566] (-1024.939) * (-1024.505) (-1029.145) [-1023.580] (-1026.164) -- 0:00:40 351000 -- (-1025.066) (-1027.695) (-1032.373) [-1023.700] * (-1024.751) (-1025.237) [-1023.690] (-1026.858) -- 0:00:40 351500 -- (-1024.332) (-1026.695) (-1029.794) [-1025.569] * [-1024.465] (-1024.511) (-1027.108) (-1027.352) -- 0:00:40 352000 -- (-1028.288) (-1027.432) [-1024.739] (-1023.728) * [-1023.689] (-1025.406) (-1026.288) (-1028.533) -- 0:00:40 352500 -- (-1034.457) (-1025.175) (-1024.339) [-1023.932] * [-1026.854] (-1024.003) (-1024.462) (-1024.315) -- 0:00:40 353000 -- (-1025.252) (-1025.848) (-1026.667) [-1024.888] * (-1025.897) [-1024.976] (-1025.560) (-1027.573) -- 0:00:40 353500 -- [-1024.337] (-1025.291) (-1027.852) (-1023.755) * [-1025.230] (-1024.302) (-1024.672) (-1024.675) -- 0:00:40 354000 -- (-1024.338) (-1032.386) (-1026.680) [-1025.031] * (-1024.686) (-1027.986) (-1024.350) [-1026.238] -- 0:00:40 354500 -- [-1027.352] (-1028.814) (-1025.687) (-1026.963) * [-1026.141] (-1027.994) (-1026.172) (-1025.407) -- 0:00:40 355000 -- (-1032.419) (-1029.046) [-1024.036] (-1026.695) * (-1025.023) (-1031.946) (-1025.921) [-1027.964] -- 0:00:39 Average standard deviation of split frequencies: 0.014496 355500 -- (-1033.540) (-1028.231) (-1026.820) [-1024.442] * [-1024.832] (-1030.437) (-1025.727) (-1027.624) -- 0:00:39 356000 -- (-1025.945) [-1024.461] (-1025.690) (-1023.671) * (-1029.991) (-1028.562) (-1024.290) [-1027.664] -- 0:00:39 356500 -- (-1025.317) (-1026.245) [-1027.795] (-1028.239) * [-1024.495] (-1026.987) (-1026.871) (-1024.851) -- 0:00:39 357000 -- (-1029.509) (-1028.033) [-1025.749] (-1026.789) * (-1026.261) [-1025.313] (-1026.587) (-1025.767) -- 0:00:39 357500 -- (-1025.107) [-1025.010] (-1026.633) (-1026.207) * [-1025.298] (-1024.641) (-1031.907) (-1027.763) -- 0:00:39 358000 -- (-1025.976) (-1027.033) (-1028.542) [-1027.292] * (-1024.563) (-1024.904) [-1025.419] (-1025.370) -- 0:00:39 358500 -- (-1026.111) (-1023.694) (-1024.545) [-1027.164] * (-1025.712) [-1029.355] (-1026.186) (-1028.985) -- 0:00:39 359000 -- (-1023.986) [-1023.726] (-1026.963) (-1027.068) * (-1025.306) [-1026.024] (-1023.569) (-1028.552) -- 0:00:39 359500 -- (-1024.311) [-1023.617] (-1023.502) (-1024.321) * (-1026.764) [-1024.927] (-1023.569) (-1024.891) -- 0:00:39 360000 -- (-1028.714) (-1026.597) [-1025.776] (-1024.931) * (-1025.822) [-1025.402] (-1027.424) (-1025.363) -- 0:00:39 Average standard deviation of split frequencies: 0.013758 360500 -- (-1026.918) [-1025.249] (-1028.592) (-1027.140) * (-1024.116) (-1025.757) (-1025.643) [-1026.898] -- 0:00:39 361000 -- (-1024.261) (-1026.409) [-1029.468] (-1026.576) * (-1024.965) (-1026.721) [-1024.506] (-1024.339) -- 0:00:38 361500 -- [-1025.030] (-1027.439) (-1027.351) (-1024.218) * (-1024.559) [-1025.760] (-1024.267) (-1025.225) -- 0:00:40 362000 -- (-1025.358) (-1026.117) (-1028.871) [-1025.344] * [-1024.923] (-1027.833) (-1025.733) (-1026.579) -- 0:00:40 362500 -- (-1025.828) [-1027.768] (-1025.499) (-1023.914) * (-1025.902) (-1025.335) (-1024.965) [-1026.430] -- 0:00:40 363000 -- (-1025.613) (-1032.609) (-1024.129) [-1025.177] * [-1029.676] (-1025.407) (-1024.705) (-1030.213) -- 0:00:40 363500 -- [-1024.180] (-1032.876) (-1024.277) (-1028.897) * (-1027.692) (-1024.618) (-1025.073) [-1026.138] -- 0:00:40 364000 -- [-1028.146] (-1029.444) (-1024.916) (-1027.641) * (-1029.783) [-1025.271] (-1029.935) (-1025.859) -- 0:00:40 364500 -- (-1027.574) [-1026.756] (-1026.076) (-1024.694) * [-1026.389] (-1026.967) (-1027.906) (-1028.679) -- 0:00:40 365000 -- (-1025.359) (-1026.502) [-1029.477] (-1027.470) * (-1024.431) [-1025.167] (-1023.840) (-1023.799) -- 0:00:40 Average standard deviation of split frequencies: 0.013490 365500 -- (-1027.707) (-1028.716) [-1026.154] (-1027.265) * [-1023.525] (-1025.526) (-1023.712) (-1028.825) -- 0:00:39 366000 -- (-1024.317) [-1026.295] (-1025.601) (-1025.507) * [-1023.554] (-1025.024) (-1026.698) (-1027.135) -- 0:00:39 366500 -- (-1024.893) (-1024.284) (-1024.852) [-1025.406] * (-1024.135) (-1025.745) (-1031.130) [-1024.393] -- 0:00:39 367000 -- (-1028.562) (-1025.270) [-1025.086] (-1029.487) * [-1024.191] (-1026.607) (-1028.611) (-1027.018) -- 0:00:39 367500 -- (-1028.066) (-1025.307) (-1024.794) [-1024.288] * (-1028.590) (-1023.898) [-1028.080] (-1026.102) -- 0:00:39 368000 -- (-1023.516) (-1026.484) (-1025.484) [-1024.448] * [-1024.937] (-1023.609) (-1026.761) (-1025.052) -- 0:00:39 368500 -- [-1024.213] (-1025.275) (-1024.106) (-1024.749) * (-1024.868) [-1023.997] (-1025.115) (-1027.881) -- 0:00:39 369000 -- [-1025.442] (-1025.311) (-1024.750) (-1026.814) * (-1024.489) [-1025.491] (-1025.115) (-1028.497) -- 0:00:39 369500 -- (-1026.267) [-1027.932] (-1025.891) (-1027.572) * (-1024.582) (-1025.629) (-1028.447) [-1024.544] -- 0:00:39 370000 -- (-1027.933) (-1026.529) (-1026.033) [-1026.603] * (-1024.652) [-1027.675] (-1026.353) (-1023.852) -- 0:00:39 Average standard deviation of split frequencies: 0.013521 370500 -- (-1028.827) [-1027.275] (-1025.469) (-1026.408) * (-1030.372) (-1028.478) (-1026.356) [-1025.900] -- 0:00:39 371000 -- (-1024.413) (-1024.898) [-1024.040] (-1026.368) * [-1025.524] (-1024.736) (-1025.735) (-1024.552) -- 0:00:38 371500 -- (-1024.671) (-1025.940) (-1025.683) [-1023.705] * (-1025.153) (-1024.924) (-1026.989) [-1025.198] -- 0:00:38 372000 -- (-1025.233) (-1024.251) [-1024.220] (-1023.976) * (-1024.429) (-1024.767) [-1025.947] (-1029.007) -- 0:00:38 372500 -- [-1024.453] (-1025.762) (-1027.589) (-1023.870) * [-1025.571] (-1029.132) (-1026.089) (-1026.578) -- 0:00:38 373000 -- (-1025.132) [-1025.935] (-1026.463) (-1023.791) * (-1025.644) (-1025.277) (-1025.401) [-1024.112] -- 0:00:38 373500 -- (-1024.473) (-1026.437) (-1024.929) [-1026.556] * [-1025.155] (-1024.086) (-1023.626) (-1026.808) -- 0:00:38 374000 -- (-1026.490) [-1026.472] (-1024.873) (-1025.983) * (-1023.599) (-1024.781) [-1023.628] (-1024.206) -- 0:00:38 374500 -- [-1025.765] (-1025.734) (-1024.086) (-1027.241) * [-1024.085] (-1025.367) (-1026.339) (-1027.147) -- 0:00:38 375000 -- (-1024.205) [-1025.430] (-1025.963) (-1026.588) * (-1029.222) [-1024.217] (-1024.544) (-1025.553) -- 0:00:38 Average standard deviation of split frequencies: 0.012316 375500 -- (-1028.651) (-1024.052) (-1025.681) [-1029.521] * (-1030.008) (-1025.146) (-1024.583) [-1025.510] -- 0:00:38 376000 -- (-1031.182) (-1026.588) [-1025.662] (-1028.368) * (-1024.112) [-1027.014] (-1024.362) (-1027.913) -- 0:00:38 376500 -- (-1025.499) (-1025.712) (-1024.502) [-1024.422] * (-1025.025) (-1025.973) (-1025.580) [-1026.967] -- 0:00:38 377000 -- (-1023.930) (-1026.777) (-1024.245) [-1023.679] * [-1026.980] (-1025.715) (-1029.953) (-1026.777) -- 0:00:39 377500 -- (-1023.493) (-1025.783) [-1024.595] (-1026.203) * (-1024.527) (-1025.116) [-1025.625] (-1026.654) -- 0:00:39 378000 -- (-1026.906) (-1027.145) [-1024.931] (-1025.287) * (-1023.629) (-1028.476) (-1027.216) [-1025.352] -- 0:00:39 378500 -- (-1028.221) [-1025.998] (-1024.534) (-1026.877) * (-1024.164) (-1027.171) [-1025.872] (-1024.573) -- 0:00:39 379000 -- (-1025.509) (-1028.521) (-1026.849) [-1025.568] * [-1025.663] (-1026.037) (-1027.645) (-1024.446) -- 0:00:39 379500 -- (-1027.070) (-1027.242) (-1025.518) [-1027.293] * (-1030.735) (-1024.860) (-1023.748) [-1025.918] -- 0:00:39 380000 -- (-1025.155) (-1026.069) (-1025.637) [-1026.904] * (-1031.118) (-1024.899) (-1024.682) [-1025.701] -- 0:00:39 Average standard deviation of split frequencies: 0.012452 380500 -- (-1026.123) (-1023.622) (-1024.501) [-1027.310] * (-1029.559) (-1026.655) [-1024.682] (-1026.601) -- 0:00:39 381000 -- (-1023.979) (-1024.741) [-1026.863] (-1025.187) * [-1024.611] (-1025.043) (-1026.599) (-1027.151) -- 0:00:38 381500 -- [-1026.453] (-1026.121) (-1025.503) (-1024.315) * (-1026.380) (-1027.065) (-1026.014) [-1025.627] -- 0:00:38 382000 -- (-1024.365) (-1023.601) [-1026.583] (-1024.388) * [-1031.814] (-1025.990) (-1023.459) (-1025.628) -- 0:00:38 382500 -- (-1025.788) (-1023.985) [-1026.351] (-1025.614) * (-1027.195) [-1029.672] (-1023.973) (-1027.725) -- 0:00:38 383000 -- (-1026.668) [-1025.807] (-1025.825) (-1024.321) * (-1026.159) [-1028.109] (-1028.917) (-1025.625) -- 0:00:38 383500 -- (-1025.441) (-1024.613) (-1025.958) [-1023.615] * [-1028.964] (-1030.253) (-1027.510) (-1025.372) -- 0:00:38 384000 -- (-1025.402) (-1026.346) (-1028.443) [-1025.775] * (-1025.574) [-1025.738] (-1025.830) (-1024.957) -- 0:00:38 384500 -- (-1024.768) (-1025.975) [-1025.185] (-1024.670) * (-1026.784) [-1025.919] (-1025.553) (-1026.031) -- 0:00:38 385000 -- (-1024.280) [-1024.650] (-1027.318) (-1024.905) * (-1025.792) [-1024.701] (-1026.742) (-1025.771) -- 0:00:38 Average standard deviation of split frequencies: 0.011873 385500 -- (-1026.738) (-1025.685) [-1023.369] (-1025.283) * [-1023.762] (-1024.540) (-1026.995) (-1027.571) -- 0:00:38 386000 -- (-1027.958) (-1029.901) [-1025.863] (-1026.078) * (-1023.767) [-1025.493] (-1027.733) (-1026.467) -- 0:00:38 386500 -- (-1024.626) [-1028.506] (-1025.448) (-1025.805) * (-1024.355) (-1028.639) [-1025.486] (-1025.325) -- 0:00:38 387000 -- (-1024.055) (-1026.410) [-1027.278] (-1027.648) * (-1024.067) (-1026.968) [-1024.398] (-1024.117) -- 0:00:38 387500 -- (-1024.063) [-1024.600] (-1030.114) (-1025.074) * (-1025.426) (-1025.050) [-1027.061] (-1024.055) -- 0:00:37 388000 -- (-1026.052) [-1023.918] (-1027.723) (-1026.271) * (-1027.135) [-1024.389] (-1028.240) (-1024.742) -- 0:00:37 388500 -- (-1026.860) [-1028.541] (-1026.269) (-1026.545) * (-1026.214) (-1026.427) (-1026.534) [-1024.708] -- 0:00:37 389000 -- (-1025.893) (-1024.442) [-1024.988] (-1030.000) * (-1024.208) [-1025.567] (-1026.961) (-1027.899) -- 0:00:37 389500 -- (-1027.967) [-1024.677] (-1025.661) (-1029.162) * (-1033.024) [-1026.183] (-1026.441) (-1025.055) -- 0:00:37 390000 -- [-1023.449] (-1026.372) (-1027.947) (-1028.356) * (-1036.078) [-1024.538] (-1026.064) (-1027.155) -- 0:00:37 Average standard deviation of split frequencies: 0.012130 390500 -- (-1023.883) (-1026.878) [-1024.898] (-1024.652) * [-1030.648] (-1026.290) (-1025.410) (-1029.181) -- 0:00:37 391000 -- (-1025.326) [-1026.204] (-1024.571) (-1024.813) * [-1024.481] (-1024.590) (-1025.711) (-1027.934) -- 0:00:37 391500 -- (-1023.887) (-1023.596) [-1024.446] (-1024.871) * (-1030.738) [-1024.261] (-1024.659) (-1024.951) -- 0:00:37 392000 -- (-1025.388) (-1023.605) [-1025.462] (-1024.216) * (-1024.627) (-1025.193) (-1024.766) [-1024.408] -- 0:00:37 392500 -- [-1028.821] (-1024.470) (-1025.887) (-1025.680) * (-1026.041) [-1024.980] (-1028.951) (-1025.240) -- 0:00:37 393000 -- [-1024.509] (-1024.600) (-1026.783) (-1028.111) * (-1024.600) (-1024.170) (-1026.826) [-1024.915] -- 0:00:37 393500 -- (-1025.365) (-1024.199) (-1028.734) [-1026.320] * (-1023.869) (-1024.156) (-1025.391) [-1024.160] -- 0:00:38 394000 -- [-1025.763] (-1026.987) (-1029.312) (-1024.952) * (-1024.465) (-1029.261) [-1025.826] (-1025.154) -- 0:00:38 394500 -- (-1025.174) [-1026.306] (-1027.984) (-1030.161) * (-1024.644) [-1027.152] (-1024.573) (-1028.923) -- 0:00:38 395000 -- (-1025.015) (-1023.941) (-1026.167) [-1028.932] * (-1028.137) (-1025.023) (-1025.244) [-1024.150] -- 0:00:38 Average standard deviation of split frequencies: 0.011554 395500 -- (-1025.479) (-1026.707) (-1026.292) [-1026.854] * (-1025.239) (-1026.534) (-1024.164) [-1027.811] -- 0:00:38 396000 -- (-1024.289) (-1023.622) [-1025.751] (-1027.371) * [-1024.260] (-1026.420) (-1027.482) (-1026.945) -- 0:00:38 396500 -- [-1024.246] (-1025.285) (-1023.822) (-1024.600) * (-1027.308) (-1024.467) [-1024.164] (-1023.541) -- 0:00:38 397000 -- (-1025.981) (-1026.254) [-1024.324] (-1025.170) * (-1029.015) [-1024.191] (-1024.882) (-1030.589) -- 0:00:37 397500 -- (-1026.327) [-1024.550] (-1026.371) (-1024.364) * (-1027.064) (-1024.956) (-1027.830) [-1026.699] -- 0:00:37 398000 -- (-1026.314) [-1025.117] (-1025.227) (-1032.439) * (-1030.425) (-1024.241) (-1025.175) [-1028.369] -- 0:00:37 398500 -- (-1026.717) (-1025.424) [-1028.849] (-1027.008) * (-1027.217) [-1024.865] (-1023.889) (-1031.835) -- 0:00:37 399000 -- (-1027.137) [-1024.903] (-1032.578) (-1024.993) * (-1028.918) (-1025.061) [-1024.586] (-1031.301) -- 0:00:37 399500 -- (-1031.151) (-1028.967) [-1025.546] (-1027.690) * (-1025.088) (-1034.065) (-1032.048) [-1026.997] -- 0:00:37 400000 -- [-1024.462] (-1030.849) (-1024.369) (-1027.293) * (-1025.031) (-1028.621) [-1028.918] (-1026.807) -- 0:00:37 Average standard deviation of split frequencies: 0.011439 400500 -- [-1024.231] (-1027.928) (-1028.424) (-1025.574) * (-1025.555) (-1023.509) [-1028.188] (-1027.117) -- 0:00:37 401000 -- (-1025.325) [-1025.069] (-1026.777) (-1024.498) * (-1025.283) (-1023.513) (-1030.743) [-1027.118] -- 0:00:37 401500 -- (-1028.302) [-1025.007] (-1026.968) (-1027.216) * (-1025.555) (-1023.586) [-1027.011] (-1025.026) -- 0:00:37 402000 -- [-1025.272] (-1025.460) (-1024.104) (-1024.496) * (-1025.146) (-1024.005) [-1025.101] (-1027.131) -- 0:00:37 402500 -- [-1024.908] (-1026.122) (-1024.539) (-1024.088) * (-1029.961) [-1024.676] (-1026.089) (-1029.223) -- 0:00:37 403000 -- (-1028.190) (-1024.454) (-1026.914) [-1027.501] * (-1026.029) [-1024.451] (-1023.944) (-1026.373) -- 0:00:37 403500 -- (-1025.570) [-1025.032] (-1023.728) (-1024.718) * (-1024.733) (-1026.995) (-1027.080) [-1026.442] -- 0:00:36 404000 -- (-1023.677) (-1025.157) [-1025.066] (-1024.510) * [-1024.850] (-1025.992) (-1024.689) (-1025.820) -- 0:00:36 404500 -- (-1024.512) [-1027.297] (-1025.679) (-1026.871) * (-1026.580) [-1029.824] (-1028.249) (-1029.607) -- 0:00:36 405000 -- (-1026.129) (-1025.991) [-1023.884] (-1027.864) * [-1026.482] (-1028.903) (-1025.318) (-1028.834) -- 0:00:36 Average standard deviation of split frequencies: 0.012191 405500 -- (-1024.977) [-1024.791] (-1025.870) (-1023.773) * (-1026.348) (-1025.491) [-1027.368] (-1028.469) -- 0:00:36 406000 -- [-1026.435] (-1025.966) (-1024.020) (-1023.727) * (-1025.648) [-1025.637] (-1023.885) (-1024.440) -- 0:00:36 406500 -- (-1027.940) [-1030.234] (-1023.802) (-1023.629) * (-1026.176) (-1024.953) (-1025.668) [-1026.669] -- 0:00:36 407000 -- (-1025.197) (-1025.596) [-1024.524] (-1025.980) * [-1028.967] (-1026.101) (-1025.849) (-1024.140) -- 0:00:36 407500 -- [-1028.096] (-1027.227) (-1025.729) (-1025.172) * (-1027.546) [-1025.287] (-1026.191) (-1025.023) -- 0:00:36 408000 -- (-1027.611) [-1024.424] (-1028.271) (-1026.170) * (-1023.759) (-1026.414) [-1027.315] (-1023.977) -- 0:00:36 408500 -- (-1026.099) (-1027.018) [-1026.039] (-1031.410) * (-1025.590) [-1027.146] (-1027.315) (-1024.018) -- 0:00:36 409000 -- (-1027.930) (-1026.004) [-1024.719] (-1034.773) * (-1026.861) [-1029.579] (-1025.570) (-1026.513) -- 0:00:36 409500 -- [-1027.917] (-1024.659) (-1031.337) (-1033.966) * (-1027.660) [-1027.762] (-1025.044) (-1029.092) -- 0:00:37 410000 -- [-1024.940] (-1026.097) (-1025.435) (-1025.795) * [-1025.242] (-1029.647) (-1025.566) (-1027.150) -- 0:00:37 Average standard deviation of split frequencies: 0.013473 410500 -- (-1024.837) (-1029.958) [-1025.358] (-1024.753) * (-1025.989) (-1027.769) [-1024.865] (-1026.708) -- 0:00:37 411000 -- (-1024.886) (-1026.925) [-1027.538] (-1028.332) * (-1027.331) (-1024.586) [-1027.449] (-1026.587) -- 0:00:37 411500 -- (-1027.420) (-1031.138) [-1025.326] (-1024.945) * [-1024.326] (-1024.345) (-1026.710) (-1024.971) -- 0:00:37 412000 -- (-1027.379) (-1027.872) (-1025.332) [-1024.509] * [-1028.357] (-1025.923) (-1025.152) (-1027.979) -- 0:00:37 412500 -- (-1029.947) [-1026.356] (-1025.055) (-1025.867) * (-1028.769) (-1027.986) [-1025.624] (-1025.654) -- 0:00:37 413000 -- (-1025.818) [-1028.978] (-1024.469) (-1027.328) * [-1026.933] (-1031.086) (-1024.259) (-1024.972) -- 0:00:36 413500 -- [-1023.726] (-1029.285) (-1026.168) (-1026.626) * [-1024.778] (-1031.681) (-1025.433) (-1027.187) -- 0:00:36 414000 -- (-1026.980) (-1025.226) [-1025.423] (-1027.381) * (-1024.248) (-1028.878) [-1025.932] (-1026.503) -- 0:00:36 414500 -- (-1028.115) [-1025.854] (-1023.776) (-1025.016) * (-1023.436) (-1027.605) (-1025.622) [-1027.033] -- 0:00:36 415000 -- (-1024.608) [-1024.243] (-1023.761) (-1024.639) * (-1023.744) [-1029.233] (-1028.182) (-1025.372) -- 0:00:36 Average standard deviation of split frequencies: 0.013265 415500 -- (-1023.865) (-1024.613) [-1024.698] (-1024.093) * [-1024.730] (-1026.959) (-1023.734) (-1025.064) -- 0:00:36 416000 -- [-1026.057] (-1024.989) (-1026.265) (-1024.762) * (-1027.685) (-1024.600) (-1023.723) [-1024.426] -- 0:00:36 416500 -- (-1025.636) (-1024.183) [-1026.125] (-1023.833) * (-1025.468) (-1024.396) [-1024.608] (-1027.625) -- 0:00:36 417000 -- (-1026.980) [-1025.432] (-1027.404) (-1024.554) * (-1027.714) (-1025.820) [-1025.739] (-1030.442) -- 0:00:36 417500 -- (-1026.053) [-1023.752] (-1026.927) (-1025.797) * (-1028.527) (-1025.688) (-1023.930) [-1026.185] -- 0:00:36 418000 -- (-1029.453) (-1024.595) (-1029.122) [-1023.391] * (-1027.463) (-1026.689) [-1023.990] (-1025.099) -- 0:00:36 418500 -- [-1029.333] (-1026.888) (-1028.658) (-1028.996) * [-1026.999] (-1029.327) (-1026.355) (-1025.344) -- 0:00:36 419000 -- (-1029.079) [-1024.632] (-1030.627) (-1030.081) * (-1023.816) (-1024.354) [-1028.241] (-1026.805) -- 0:00:36 419500 -- (-1027.359) [-1024.878] (-1028.917) (-1031.016) * [-1023.902] (-1025.137) (-1025.893) (-1024.116) -- 0:00:35 420000 -- [-1024.959] (-1024.652) (-1027.942) (-1027.237) * (-1024.012) (-1025.046) (-1025.401) [-1024.691] -- 0:00:35 Average standard deviation of split frequencies: 0.013118 420500 -- [-1024.882] (-1024.767) (-1028.348) (-1027.600) * (-1024.549) (-1024.870) (-1024.830) [-1023.946] -- 0:00:35 421000 -- (-1024.675) [-1030.831] (-1023.935) (-1026.208) * (-1026.337) [-1025.965] (-1026.540) (-1023.713) -- 0:00:35 421500 -- (-1027.173) [-1027.104] (-1024.295) (-1025.519) * (-1029.937) [-1026.218] (-1024.816) (-1024.850) -- 0:00:35 422000 -- (-1024.855) (-1025.308) [-1023.594] (-1025.081) * (-1028.685) (-1026.258) [-1024.361] (-1027.385) -- 0:00:35 422500 -- [-1023.744] (-1024.717) (-1025.336) (-1026.225) * (-1028.743) (-1028.751) (-1027.352) [-1024.883] -- 0:00:35 423000 -- (-1023.988) [-1024.735] (-1024.342) (-1031.097) * [-1026.194] (-1024.923) (-1024.897) (-1025.967) -- 0:00:35 423500 -- (-1027.278) [-1024.284] (-1023.714) (-1026.023) * (-1028.130) (-1025.399) [-1023.773] (-1025.232) -- 0:00:35 424000 -- (-1025.773) [-1024.483] (-1026.627) (-1026.413) * [-1024.651] (-1028.358) (-1024.300) (-1026.793) -- 0:00:35 424500 -- (-1026.002) (-1025.192) [-1026.643] (-1027.152) * (-1023.675) [-1027.041] (-1025.216) (-1025.927) -- 0:00:35 425000 -- (-1026.176) (-1027.633) (-1024.501) [-1024.964] * (-1024.717) (-1029.246) [-1024.126] (-1032.548) -- 0:00:35 Average standard deviation of split frequencies: 0.013586 425500 -- [-1025.991] (-1027.506) (-1024.781) (-1024.485) * (-1024.456) (-1025.958) (-1025.358) [-1026.385] -- 0:00:35 426000 -- (-1024.832) (-1029.325) [-1024.948] (-1026.154) * (-1025.400) (-1026.650) (-1023.750) [-1027.349] -- 0:00:36 426500 -- (-1024.562) (-1026.884) [-1024.723] (-1025.268) * [-1025.394] (-1031.759) (-1024.134) (-1025.501) -- 0:00:36 427000 -- [-1026.028] (-1029.843) (-1030.331) (-1024.841) * (-1023.890) (-1025.598) (-1026.631) [-1024.552] -- 0:00:36 427500 -- (-1025.775) (-1026.524) [-1031.105] (-1024.961) * (-1026.115) (-1026.398) (-1025.123) [-1025.411] -- 0:00:36 428000 -- (-1027.314) [-1024.560] (-1024.471) (-1024.914) * [-1025.367] (-1026.756) (-1027.922) (-1024.249) -- 0:00:36 428500 -- (-1023.743) (-1026.305) (-1025.104) [-1030.024] * (-1025.113) (-1029.145) (-1028.106) [-1027.822] -- 0:00:36 429000 -- (-1026.470) (-1025.914) [-1025.178] (-1028.060) * (-1026.244) [-1023.430] (-1029.906) (-1030.115) -- 0:00:35 429500 -- (-1025.768) (-1024.358) [-1025.518] (-1028.989) * (-1026.402) (-1024.590) [-1025.202] (-1027.975) -- 0:00:35 430000 -- [-1027.294] (-1025.366) (-1024.206) (-1031.105) * [-1026.401] (-1028.075) (-1023.555) (-1029.154) -- 0:00:35 Average standard deviation of split frequencies: 0.013199 430500 -- (-1024.400) (-1023.844) (-1026.510) [-1027.695] * (-1029.196) (-1026.157) [-1024.155] (-1025.776) -- 0:00:35 431000 -- (-1025.888) (-1024.726) [-1026.440] (-1024.276) * [-1026.106] (-1026.335) (-1024.964) (-1025.871) -- 0:00:35 431500 -- [-1024.322] (-1024.211) (-1026.494) (-1024.277) * (-1025.404) (-1027.450) (-1025.508) [-1024.275] -- 0:00:35 432000 -- (-1024.192) (-1024.550) (-1027.726) [-1024.603] * (-1027.126) (-1026.679) (-1029.342) [-1024.768] -- 0:00:35 432500 -- (-1026.491) [-1025.333] (-1029.110) (-1029.633) * (-1023.846) [-1031.102] (-1025.449) (-1024.323) -- 0:00:35 433000 -- (-1024.240) (-1025.428) (-1035.181) [-1026.922] * (-1026.288) (-1028.828) [-1025.850] (-1024.318) -- 0:00:35 433500 -- (-1024.014) [-1024.694] (-1026.034) (-1026.110) * (-1025.437) (-1028.276) (-1025.986) [-1026.463] -- 0:00:35 434000 -- (-1025.818) [-1025.791] (-1024.228) (-1026.382) * (-1025.237) (-1027.769) (-1027.174) [-1027.221] -- 0:00:35 434500 -- (-1024.679) (-1026.390) (-1025.373) [-1024.486] * (-1025.115) [-1028.749] (-1024.451) (-1025.981) -- 0:00:35 435000 -- (-1025.047) (-1029.968) (-1025.430) [-1024.408] * (-1026.196) (-1026.335) (-1026.433) [-1024.908] -- 0:00:35 Average standard deviation of split frequencies: 0.012911 435500 -- (-1023.725) (-1024.638) (-1030.094) [-1024.231] * [-1024.586] (-1025.558) (-1025.591) (-1025.826) -- 0:00:34 436000 -- (-1025.736) (-1028.218) (-1024.976) [-1024.411] * (-1024.271) (-1026.598) [-1025.323] (-1024.542) -- 0:00:34 436500 -- [-1026.917] (-1027.159) (-1024.918) (-1023.542) * (-1024.522) (-1024.009) (-1029.441) [-1026.720] -- 0:00:34 437000 -- (-1024.766) (-1026.066) (-1026.253) [-1024.886] * (-1024.953) [-1023.978] (-1028.537) (-1025.461) -- 0:00:34 437500 -- (-1024.589) (-1027.798) (-1025.653) [-1024.306] * (-1026.342) (-1025.208) (-1027.553) [-1025.802] -- 0:00:34 438000 -- (-1024.531) (-1027.217) [-1025.547] (-1024.774) * (-1026.651) (-1024.226) [-1026.640] (-1025.352) -- 0:00:34 438500 -- [-1026.329] (-1024.330) (-1025.975) (-1026.469) * (-1023.512) (-1024.613) (-1030.599) [-1026.833] -- 0:00:34 439000 -- [-1027.994] (-1026.960) (-1027.473) (-1027.785) * (-1024.420) [-1026.102] (-1028.420) (-1028.023) -- 0:00:34 439500 -- (-1025.918) [-1026.454] (-1023.766) (-1030.435) * (-1025.664) [-1023.816] (-1026.387) (-1026.298) -- 0:00:34 440000 -- (-1029.034) (-1025.727) (-1023.351) [-1029.541] * (-1024.917) [-1024.251] (-1024.484) (-1026.231) -- 0:00:34 Average standard deviation of split frequencies: 0.012971 440500 -- (-1026.446) [-1026.819] (-1023.350) (-1027.380) * (-1023.974) [-1026.621] (-1026.559) (-1024.425) -- 0:00:34 441000 -- (-1027.020) [-1024.166] (-1023.364) (-1028.249) * (-1027.221) [-1024.329] (-1027.262) (-1026.641) -- 0:00:34 441500 -- (-1024.943) (-1023.670) [-1024.695] (-1024.853) * (-1025.461) (-1024.324) (-1026.314) [-1026.071] -- 0:00:34 442000 -- (-1024.119) (-1024.162) [-1024.850] (-1024.843) * (-1025.405) (-1027.451) (-1025.758) [-1026.726] -- 0:00:34 442500 -- (-1027.924) (-1024.265) (-1024.366) [-1025.496] * [-1024.449] (-1027.626) (-1027.559) (-1025.185) -- 0:00:35 443000 -- [-1026.391] (-1024.535) (-1024.167) (-1024.105) * (-1025.122) (-1028.025) [-1027.116] (-1026.879) -- 0:00:35 443500 -- (-1024.524) (-1024.818) (-1024.799) [-1024.069] * (-1027.537) (-1024.904) (-1027.487) [-1025.256] -- 0:00:35 444000 -- (-1025.240) [-1024.288] (-1029.295) (-1028.042) * [-1026.715] (-1028.746) (-1026.704) (-1024.563) -- 0:00:35 444500 -- (-1024.754) (-1026.945) (-1025.694) [-1027.245] * [-1025.426] (-1025.524) (-1027.280) (-1024.765) -- 0:00:34 445000 -- (-1026.222) (-1029.787) [-1025.370] (-1028.854) * (-1023.800) (-1029.728) (-1027.771) [-1024.643] -- 0:00:34 Average standard deviation of split frequencies: 0.012684 445500 -- (-1029.692) [-1027.084] (-1028.053) (-1028.931) * (-1023.502) [-1025.870] (-1028.234) (-1024.467) -- 0:00:34 446000 -- (-1029.671) (-1025.909) (-1026.627) [-1025.846] * (-1024.729) (-1024.858) (-1025.541) [-1025.221] -- 0:00:34 446500 -- (-1025.184) [-1025.735] (-1023.917) (-1025.048) * (-1026.364) (-1026.111) (-1029.508) [-1024.509] -- 0:00:34 447000 -- [-1025.974] (-1028.342) (-1025.744) (-1024.548) * [-1026.368] (-1025.982) (-1024.404) (-1032.395) -- 0:00:34 447500 -- (-1032.871) (-1027.058) (-1024.966) [-1026.805] * (-1023.975) (-1025.742) (-1024.427) [-1026.840] -- 0:00:34 448000 -- (-1028.673) (-1026.744) (-1024.444) [-1027.098] * [-1030.155] (-1025.221) (-1025.060) (-1024.068) -- 0:00:34 448500 -- (-1026.624) [-1025.325] (-1023.763) (-1029.182) * (-1025.731) (-1025.289) (-1026.672) [-1024.014] -- 0:00:34 449000 -- (-1024.120) [-1026.978] (-1027.405) (-1024.662) * [-1025.761] (-1024.984) (-1029.865) (-1025.228) -- 0:00:34 449500 -- (-1023.840) (-1033.819) [-1024.870] (-1025.458) * (-1025.694) [-1024.909] (-1026.670) (-1025.918) -- 0:00:34 450000 -- [-1023.533] (-1025.780) (-1024.428) (-1024.342) * (-1026.766) [-1023.736] (-1029.753) (-1025.383) -- 0:00:34 Average standard deviation of split frequencies: 0.012320 450500 -- [-1028.228] (-1030.811) (-1023.928) (-1026.599) * (-1026.089) [-1023.614] (-1026.699) (-1025.453) -- 0:00:34 451000 -- (-1029.228) (-1024.921) [-1025.387] (-1027.779) * [-1026.020] (-1027.086) (-1029.095) (-1026.481) -- 0:00:34 451500 -- (-1026.359) (-1026.280) (-1025.336) [-1029.002] * (-1027.896) [-1026.662] (-1026.170) (-1027.288) -- 0:00:34 452000 -- (-1025.555) [-1026.243] (-1024.259) (-1026.682) * (-1028.079) (-1024.135) [-1025.689] (-1027.340) -- 0:00:33 452500 -- (-1026.299) (-1027.865) (-1029.174) [-1028.849] * [-1025.601] (-1023.955) (-1026.321) (-1027.757) -- 0:00:33 453000 -- (-1026.397) [-1026.315] (-1027.834) (-1024.938) * (-1024.757) (-1025.157) [-1024.766] (-1026.860) -- 0:00:33 453500 -- (-1028.961) (-1023.863) (-1023.664) [-1024.793] * (-1023.741) [-1027.617] (-1024.766) (-1026.160) -- 0:00:33 454000 -- (-1025.654) (-1026.492) [-1025.022] (-1026.849) * [-1025.986] (-1025.042) (-1025.507) (-1025.167) -- 0:00:33 454500 -- (-1024.324) (-1026.746) (-1028.636) [-1028.211] * (-1026.082) (-1025.728) (-1027.561) [-1024.613] -- 0:00:33 455000 -- (-1026.584) [-1025.379] (-1029.673) (-1024.433) * (-1025.895) [-1024.973] (-1029.985) (-1024.274) -- 0:00:33 Average standard deviation of split frequencies: 0.011544 455500 -- (-1027.341) (-1027.792) (-1025.867) [-1027.660] * (-1024.769) (-1025.660) [-1027.643] (-1024.312) -- 0:00:33 456000 -- (-1029.093) [-1029.593] (-1028.062) (-1026.438) * (-1026.935) (-1023.924) [-1026.191] (-1024.474) -- 0:00:33 456500 -- [-1026.616] (-1025.356) (-1024.657) (-1023.899) * (-1028.492) [-1024.418] (-1035.908) (-1024.463) -- 0:00:33 457000 -- (-1027.298) [-1024.870] (-1026.390) (-1036.197) * (-1031.658) (-1026.285) (-1029.377) [-1027.025] -- 0:00:33 457500 -- (-1027.253) [-1024.901] (-1026.188) (-1028.049) * (-1030.924) [-1026.355] (-1027.337) (-1023.601) -- 0:00:33 458000 -- [-1026.196] (-1023.421) (-1025.965) (-1024.625) * (-1026.448) (-1027.063) (-1027.512) [-1023.900] -- 0:00:33 458500 -- (-1025.187) [-1024.463] (-1026.585) (-1028.131) * (-1023.488) (-1026.088) (-1030.322) [-1025.054] -- 0:00:34 459000 -- (-1026.117) [-1024.463] (-1030.259) (-1025.368) * (-1023.460) (-1026.641) (-1026.880) [-1025.661] -- 0:00:34 459500 -- [-1023.850] (-1024.757) (-1027.323) (-1024.507) * (-1029.929) [-1026.082] (-1026.613) (-1026.670) -- 0:00:34 460000 -- (-1024.633) [-1026.121] (-1024.421) (-1024.177) * (-1027.349) (-1027.138) [-1026.269] (-1027.099) -- 0:00:34 Average standard deviation of split frequencies: 0.011001 460500 -- (-1024.253) [-1025.306] (-1025.096) (-1026.036) * (-1027.083) [-1027.335] (-1025.478) (-1025.746) -- 0:00:33 461000 -- [-1025.019] (-1025.948) (-1026.282) (-1026.295) * [-1028.448] (-1025.668) (-1024.700) (-1029.127) -- 0:00:33 461500 -- (-1025.175) (-1027.077) [-1023.915] (-1026.711) * [-1024.543] (-1023.935) (-1024.844) (-1030.133) -- 0:00:33 462000 -- [-1023.775] (-1028.656) (-1025.193) (-1027.804) * (-1024.730) (-1024.906) [-1024.629] (-1028.510) -- 0:00:33 462500 -- (-1027.458) [-1024.599] (-1025.120) (-1024.960) * [-1026.278] (-1027.461) (-1024.876) (-1026.949) -- 0:00:33 463000 -- (-1023.540) [-1024.620] (-1026.429) (-1025.702) * [-1025.182] (-1026.456) (-1026.053) (-1027.444) -- 0:00:33 463500 -- [-1023.547] (-1025.127) (-1024.323) (-1025.545) * (-1027.536) [-1027.707] (-1024.340) (-1026.320) -- 0:00:33 464000 -- (-1023.591) (-1025.270) (-1026.596) [-1025.586] * (-1025.612) (-1026.020) [-1026.193] (-1024.338) -- 0:00:33 464500 -- (-1025.750) (-1028.851) [-1027.955] (-1028.322) * [-1024.966] (-1027.562) (-1026.782) (-1027.441) -- 0:00:33 465000 -- (-1023.943) (-1028.129) (-1026.194) [-1029.792] * (-1025.802) (-1025.742) (-1024.160) [-1024.851] -- 0:00:33 Average standard deviation of split frequencies: 0.010771 465500 -- [-1025.043] (-1023.700) (-1024.894) (-1027.319) * (-1024.199) [-1024.999] (-1024.980) (-1023.953) -- 0:00:33 466000 -- (-1025.848) (-1023.723) [-1025.275] (-1026.638) * (-1031.934) (-1024.907) (-1023.918) [-1024.536] -- 0:00:33 466500 -- (-1023.606) [-1024.082] (-1025.842) (-1025.105) * (-1023.817) (-1024.018) [-1024.165] (-1024.675) -- 0:00:33 467000 -- (-1027.147) (-1023.253) [-1025.414] (-1025.232) * (-1025.080) [-1024.262] (-1024.355) (-1027.601) -- 0:00:33 467500 -- (-1024.048) (-1023.496) [-1024.748] (-1024.574) * [-1024.487] (-1024.518) (-1024.605) (-1027.626) -- 0:00:33 468000 -- (-1026.211) (-1024.049) [-1025.688] (-1024.155) * (-1024.477) (-1027.357) (-1025.869) [-1024.904] -- 0:00:32 468500 -- [-1027.372] (-1024.747) (-1025.087) (-1024.447) * [-1027.136] (-1028.744) (-1025.697) (-1024.845) -- 0:00:32 469000 -- (-1024.940) [-1024.429] (-1026.057) (-1024.509) * (-1028.175) [-1025.216] (-1030.309) (-1029.256) -- 0:00:32 469500 -- (-1027.470) (-1024.836) [-1026.764] (-1024.590) * (-1027.790) (-1026.095) [-1024.889] (-1027.215) -- 0:00:32 470000 -- [-1027.386] (-1025.047) (-1025.356) (-1025.211) * (-1025.204) [-1024.944] (-1024.735) (-1029.729) -- 0:00:32 Average standard deviation of split frequencies: 0.010958 470500 -- (-1029.368) (-1024.009) (-1026.177) [-1025.467] * (-1024.686) (-1023.533) (-1024.777) [-1024.380] -- 0:00:32 471000 -- (-1025.607) (-1026.751) (-1024.515) [-1024.390] * (-1025.314) (-1025.623) (-1027.820) [-1023.799] -- 0:00:32 471500 -- (-1025.016) (-1028.158) (-1025.913) [-1025.677] * (-1026.653) [-1025.330] (-1024.341) (-1024.758) -- 0:00:32 472000 -- (-1024.017) [-1025.515] (-1024.645) (-1026.879) * (-1029.693) [-1024.642] (-1024.054) (-1025.292) -- 0:00:32 472500 -- (-1024.500) (-1025.742) (-1028.413) [-1027.784] * (-1026.032) (-1027.320) (-1025.307) [-1024.592] -- 0:00:32 473000 -- (-1027.683) (-1025.752) [-1026.079] (-1027.297) * (-1027.372) [-1028.857] (-1024.789) (-1024.748) -- 0:00:32 473500 -- (-1023.854) (-1024.388) (-1023.894) [-1025.276] * (-1024.185) (-1024.249) (-1025.847) [-1025.165] -- 0:00:32 474000 -- (-1025.145) [-1027.034] (-1025.899) (-1026.214) * [-1024.520] (-1028.428) (-1025.963) (-1026.366) -- 0:00:32 474500 -- [-1025.872] (-1025.356) (-1028.093) (-1025.848) * (-1025.538) [-1025.741] (-1026.245) (-1024.754) -- 0:00:33 475000 -- (-1026.435) (-1025.355) (-1027.454) [-1024.238] * (-1024.002) (-1028.486) (-1025.171) [-1024.311] -- 0:00:33 Average standard deviation of split frequencies: 0.009408 475500 -- (-1025.101) (-1024.448) (-1026.608) [-1030.185] * (-1025.025) [-1027.760] (-1025.843) (-1026.713) -- 0:00:33 476000 -- (-1028.239) (-1026.821) (-1026.320) [-1026.715] * (-1024.334) (-1023.850) (-1025.268) [-1027.653] -- 0:00:33 476500 -- (-1025.652) [-1026.729] (-1025.748) (-1024.490) * [-1024.519] (-1025.032) (-1025.242) (-1024.122) -- 0:00:32 477000 -- [-1023.855] (-1029.624) (-1023.625) (-1024.161) * (-1025.194) (-1026.089) [-1026.165] (-1025.421) -- 0:00:32 477500 -- (-1026.719) (-1030.311) [-1023.964] (-1024.563) * (-1027.585) (-1026.231) (-1024.832) [-1025.505] -- 0:00:32 478000 -- [-1024.578] (-1025.665) (-1028.754) (-1024.261) * (-1032.756) (-1024.454) [-1026.229] (-1025.095) -- 0:00:32 478500 -- (-1027.184) (-1027.353) (-1026.175) [-1025.125] * (-1028.623) (-1025.830) (-1029.308) [-1030.729] -- 0:00:32 479000 -- [-1032.834] (-1027.140) (-1027.570) (-1024.217) * [-1025.807] (-1027.257) (-1026.252) (-1026.671) -- 0:00:32 479500 -- (-1024.465) (-1025.111) (-1024.199) [-1024.118] * (-1025.369) [-1025.045] (-1027.609) (-1027.048) -- 0:00:32 480000 -- (-1025.303) [-1025.084] (-1027.615) (-1033.365) * (-1028.061) (-1024.114) (-1025.379) [-1025.880] -- 0:00:32 Average standard deviation of split frequencies: 0.009072 480500 -- (-1024.276) (-1026.821) [-1024.077] (-1026.492) * (-1027.584) [-1026.526] (-1024.777) (-1029.058) -- 0:00:32 481000 -- [-1024.044] (-1024.999) (-1025.413) (-1027.631) * (-1025.853) (-1025.355) [-1025.129] (-1028.544) -- 0:00:32 481500 -- (-1028.083) (-1023.608) (-1025.150) [-1025.404] * (-1025.712) [-1024.605] (-1025.781) (-1028.334) -- 0:00:32 482000 -- [-1028.272] (-1024.399) (-1028.454) (-1031.800) * (-1025.665) (-1026.297) (-1030.084) [-1024.792] -- 0:00:32 482500 -- (-1029.773) [-1026.745] (-1026.855) (-1024.106) * (-1025.568) (-1027.205) (-1026.115) [-1024.600] -- 0:00:32 483000 -- (-1028.868) (-1028.801) [-1025.147] (-1027.896) * (-1025.784) (-1025.634) (-1027.390) [-1025.081] -- 0:00:32 483500 -- [-1031.233] (-1025.883) (-1023.526) (-1025.239) * (-1027.171) (-1024.308) (-1025.954) [-1025.424] -- 0:00:32 484000 -- [-1028.662] (-1026.291) (-1024.072) (-1023.953) * [-1026.722] (-1025.948) (-1028.342) (-1024.375) -- 0:00:31 484500 -- (-1027.965) (-1024.285) [-1024.020] (-1023.935) * (-1024.628) [-1023.916] (-1027.413) (-1024.875) -- 0:00:31 485000 -- [-1027.858] (-1025.343) (-1025.843) (-1030.580) * (-1025.294) [-1024.321] (-1027.304) (-1026.697) -- 0:00:31 Average standard deviation of split frequencies: 0.009015 485500 -- (-1026.564) (-1023.842) (-1026.072) [-1026.553] * (-1025.454) [-1024.329] (-1024.873) (-1026.150) -- 0:00:31 486000 -- [-1023.891] (-1026.026) (-1028.676) (-1027.456) * (-1025.695) [-1024.239] (-1024.078) (-1024.705) -- 0:00:31 486500 -- (-1027.028) (-1025.961) (-1027.569) [-1026.412] * (-1025.961) (-1026.664) (-1025.849) [-1026.835] -- 0:00:31 487000 -- (-1026.024) [-1030.731] (-1028.125) (-1027.803) * (-1024.719) (-1024.075) [-1025.019] (-1025.848) -- 0:00:31 487500 -- (-1026.091) (-1030.253) (-1026.437) [-1024.850] * (-1026.967) (-1026.813) (-1023.890) [-1025.517] -- 0:00:31 488000 -- (-1026.920) (-1028.701) [-1024.250] (-1024.261) * (-1027.360) [-1029.210] (-1024.650) (-1026.675) -- 0:00:31 488500 -- (-1026.294) [-1027.542] (-1023.363) (-1024.465) * (-1025.869) (-1026.689) [-1026.054] (-1025.850) -- 0:00:31 489000 -- [-1026.479] (-1027.068) (-1025.895) (-1025.417) * (-1027.410) (-1025.368) [-1024.876] (-1026.594) -- 0:00:31 489500 -- [-1024.324] (-1030.603) (-1028.453) (-1026.969) * (-1025.492) (-1024.413) (-1025.646) [-1027.279] -- 0:00:31 490000 -- [-1025.706] (-1028.180) (-1024.074) (-1029.549) * (-1024.643) (-1026.177) [-1025.740] (-1025.052) -- 0:00:31 Average standard deviation of split frequencies: 0.009067 490500 -- (-1029.392) (-1028.476) (-1027.327) [-1026.264] * (-1024.391) (-1025.447) (-1027.769) [-1025.849] -- 0:00:31 491000 -- (-1026.873) [-1024.092] (-1024.348) (-1028.416) * [-1026.303] (-1025.556) (-1030.679) (-1026.552) -- 0:00:32 491500 -- (-1024.962) [-1025.748] (-1024.994) (-1024.376) * (-1024.481) (-1023.940) (-1026.747) [-1026.123] -- 0:00:32 492000 -- (-1025.452) (-1026.657) (-1029.139) [-1024.685] * (-1026.784) (-1024.688) (-1023.771) [-1025.429] -- 0:00:32 492500 -- (-1028.305) (-1032.228) [-1024.041] (-1024.311) * [-1026.244] (-1024.400) (-1024.065) (-1025.710) -- 0:00:31 493000 -- (-1025.692) [-1025.285] (-1029.841) (-1024.381) * [-1023.654] (-1024.005) (-1026.407) (-1026.470) -- 0:00:31 493500 -- (-1025.858) (-1025.286) (-1030.426) [-1027.362] * [-1024.163] (-1025.761) (-1028.411) (-1026.970) -- 0:00:31 494000 -- (-1030.156) (-1026.324) (-1024.335) [-1024.414] * (-1023.997) (-1026.088) [-1029.530] (-1024.533) -- 0:00:31 494500 -- (-1029.273) (-1029.478) (-1026.693) [-1024.905] * (-1024.623) (-1025.320) (-1025.920) [-1025.291] -- 0:00:31 495000 -- (-1029.694) [-1025.304] (-1024.461) (-1024.307) * (-1028.783) [-1025.044] (-1027.373) (-1023.606) -- 0:00:31 Average standard deviation of split frequencies: 0.009861 495500 -- (-1027.895) [-1024.617] (-1026.107) (-1024.493) * (-1024.323) [-1024.046] (-1026.286) (-1027.579) -- 0:00:31 496000 -- (-1024.635) [-1027.080] (-1028.179) (-1024.716) * (-1025.458) [-1024.920] (-1023.656) (-1026.975) -- 0:00:31 496500 -- (-1027.779) (-1029.984) (-1026.518) [-1029.503] * (-1028.149) (-1024.238) [-1023.577] (-1025.402) -- 0:00:31 497000 -- (-1025.558) (-1026.414) (-1024.412) [-1028.834] * [-1026.790] (-1024.246) (-1024.665) (-1029.963) -- 0:00:31 497500 -- (-1025.111) [-1024.793] (-1025.803) (-1028.327) * (-1026.100) (-1029.233) (-1028.129) [-1028.542] -- 0:00:31 498000 -- [-1023.461] (-1026.513) (-1030.683) (-1026.426) * (-1026.535) (-1027.228) [-1025.229] (-1028.131) -- 0:00:31 498500 -- (-1023.444) (-1025.256) [-1024.215] (-1026.694) * (-1024.688) [-1029.311] (-1026.467) (-1025.403) -- 0:00:31 499000 -- [-1024.509] (-1026.002) (-1028.427) (-1026.454) * [-1025.986] (-1030.694) (-1024.878) (-1030.440) -- 0:00:31 499500 -- (-1024.240) (-1025.698) [-1027.538] (-1027.690) * (-1026.806) (-1025.914) [-1023.686] (-1027.159) -- 0:00:31 500000 -- [-1025.027] (-1025.778) (-1026.871) (-1028.251) * (-1024.426) [-1025.697] (-1025.763) (-1025.810) -- 0:00:31 Average standard deviation of split frequencies: 0.009180 500500 -- (-1024.665) (-1024.141) (-1026.167) [-1024.988] * (-1024.292) [-1025.495] (-1024.166) (-1024.994) -- 0:00:30 501000 -- [-1024.817] (-1024.750) (-1027.131) (-1024.687) * [-1025.504] (-1030.761) (-1024.693) (-1025.938) -- 0:00:30 501500 -- (-1024.257) [-1025.646] (-1025.377) (-1024.251) * (-1025.604) (-1030.152) [-1027.278] (-1026.257) -- 0:00:30 502000 -- (-1024.989) [-1028.065] (-1025.031) (-1024.249) * (-1026.620) (-1025.691) (-1027.990) [-1026.012] -- 0:00:30 502500 -- (-1028.353) (-1025.447) [-1030.471] (-1023.882) * (-1024.847) (-1024.321) (-1023.530) [-1026.261] -- 0:00:30 503000 -- (-1027.918) (-1031.454) [-1028.431] (-1024.137) * (-1024.847) (-1030.707) [-1025.374] (-1023.991) -- 0:00:30 503500 -- (-1031.197) [-1028.459] (-1027.853) (-1025.752) * [-1025.481] (-1027.883) (-1025.520) (-1025.487) -- 0:00:30 504000 -- (-1025.483) [-1026.227] (-1023.476) (-1025.254) * (-1024.974) [-1025.718] (-1024.224) (-1026.079) -- 0:00:30 504500 -- [-1025.191] (-1023.605) (-1025.481) (-1025.587) * (-1027.559) (-1025.098) (-1026.846) [-1026.530] -- 0:00:30 505000 -- [-1024.609] (-1027.043) (-1024.692) (-1024.924) * (-1026.253) [-1026.091] (-1026.110) (-1028.338) -- 0:00:30 Average standard deviation of split frequencies: 0.008850 505500 -- (-1027.013) [-1025.492] (-1025.931) (-1026.056) * (-1026.276) (-1025.411) (-1026.574) [-1025.615] -- 0:00:30 506000 -- (-1026.316) [-1026.328] (-1024.266) (-1025.766) * (-1026.413) (-1024.632) [-1027.126] (-1025.470) -- 0:00:30 506500 -- (-1028.855) (-1024.737) (-1026.754) [-1024.336] * (-1024.356) (-1025.205) [-1025.844] (-1025.092) -- 0:00:30 507000 -- [-1028.847] (-1026.075) (-1028.900) (-1028.835) * [-1025.043] (-1025.192) (-1025.460) (-1024.626) -- 0:00:30 507500 -- (-1024.032) [-1024.507] (-1027.153) (-1024.893) * (-1025.960) (-1023.793) (-1023.851) [-1024.535] -- 0:00:31 508000 -- (-1023.942) (-1024.790) [-1029.569] (-1024.611) * [-1027.364] (-1027.833) (-1026.253) (-1029.090) -- 0:00:30 508500 -- [-1025.879] (-1025.332) (-1025.440) (-1025.636) * (-1025.818) (-1029.461) (-1025.030) [-1025.943] -- 0:00:30 509000 -- (-1026.370) (-1030.503) [-1026.481] (-1024.336) * (-1025.818) (-1027.428) [-1024.197] (-1024.499) -- 0:00:30 509500 -- (-1025.848) (-1024.262) [-1027.635] (-1023.831) * (-1025.361) (-1026.491) [-1024.981] (-1024.311) -- 0:00:30 510000 -- (-1027.891) [-1025.048] (-1027.713) (-1025.227) * (-1025.442) (-1027.867) (-1025.088) [-1026.546] -- 0:00:30 Average standard deviation of split frequencies: 0.008712 510500 -- (-1024.911) (-1025.627) [-1023.931] (-1024.035) * (-1024.026) (-1025.503) [-1024.920] (-1024.818) -- 0:00:30 511000 -- (-1025.177) (-1026.674) [-1023.630] (-1023.377) * (-1024.530) (-1024.936) [-1026.936] (-1030.772) -- 0:00:30 511500 -- (-1025.489) [-1024.653] (-1025.677) (-1024.310) * [-1024.923] (-1024.107) (-1024.513) (-1027.614) -- 0:00:30 512000 -- (-1025.816) (-1024.317) (-1027.117) [-1026.391] * (-1026.379) (-1025.420) (-1023.903) [-1025.282] -- 0:00:30 512500 -- (-1029.721) [-1024.752] (-1025.424) (-1026.552) * (-1024.792) (-1023.551) (-1024.116) [-1025.462] -- 0:00:30 513000 -- (-1026.653) (-1031.985) (-1026.145) [-1025.198] * [-1025.280] (-1024.289) (-1025.679) (-1026.293) -- 0:00:30 513500 -- [-1024.420] (-1024.345) (-1028.205) (-1024.490) * (-1028.876) [-1024.495] (-1024.742) (-1029.799) -- 0:00:30 514000 -- (-1028.244) (-1027.803) (-1024.569) [-1025.735] * (-1027.134) (-1025.114) (-1024.203) [-1027.883] -- 0:00:30 514500 -- (-1025.425) (-1023.598) (-1023.909) [-1027.886] * (-1028.250) (-1027.178) [-1024.454] (-1030.797) -- 0:00:30 515000 -- [-1028.823] (-1027.923) (-1025.514) (-1027.982) * (-1028.780) (-1031.083) (-1026.769) [-1024.466] -- 0:00:30 Average standard deviation of split frequencies: 0.008793 515500 -- (-1026.885) (-1025.414) [-1026.100] (-1026.051) * [-1025.864] (-1029.180) (-1028.425) (-1023.848) -- 0:00:30 516000 -- (-1027.541) (-1027.781) (-1027.379) [-1024.493] * [-1025.855] (-1027.593) (-1028.545) (-1023.818) -- 0:00:30 516500 -- [-1024.978] (-1025.690) (-1024.017) (-1025.260) * (-1028.167) [-1024.697] (-1028.447) (-1025.165) -- 0:00:29 517000 -- [-1027.058] (-1028.027) (-1026.377) (-1025.859) * (-1025.974) (-1025.604) [-1024.082] (-1024.244) -- 0:00:29 517500 -- (-1025.505) (-1027.424) [-1024.079] (-1025.750) * (-1028.201) (-1026.548) (-1024.477) [-1025.614] -- 0:00:29 518000 -- (-1025.618) [-1026.582] (-1024.198) (-1024.898) * (-1024.537) (-1026.979) [-1024.994] (-1024.789) -- 0:00:29 518500 -- (-1030.319) [-1023.339] (-1025.082) (-1025.191) * [-1026.630] (-1026.527) (-1025.479) (-1026.077) -- 0:00:29 519000 -- (-1029.960) [-1024.677] (-1027.809) (-1026.783) * (-1028.492) (-1023.565) (-1027.338) [-1025.869] -- 0:00:29 519500 -- [-1024.554] (-1029.376) (-1027.682) (-1025.909) * (-1026.803) [-1026.419] (-1028.555) (-1024.885) -- 0:00:29 520000 -- (-1027.051) (-1024.792) [-1024.505] (-1026.359) * (-1023.781) (-1028.185) [-1024.836] (-1027.545) -- 0:00:29 Average standard deviation of split frequencies: 0.009280 520500 -- (-1027.003) (-1025.128) [-1025.324] (-1025.182) * (-1026.421) [-1025.052] (-1025.666) (-1026.267) -- 0:00:29 521000 -- (-1028.328) [-1031.162] (-1025.412) (-1025.830) * (-1028.328) (-1025.679) [-1023.985] (-1023.860) -- 0:00:29 521500 -- (-1026.648) (-1024.407) (-1026.230) [-1027.963] * (-1024.445) (-1028.719) [-1028.089] (-1026.436) -- 0:00:29 522000 -- (-1025.491) (-1025.608) (-1026.849) [-1027.621] * (-1025.829) [-1026.453] (-1025.333) (-1024.283) -- 0:00:29 522500 -- (-1024.352) [-1026.752] (-1024.345) (-1025.962) * (-1026.341) (-1025.672) [-1024.856] (-1024.442) -- 0:00:29 523000 -- (-1027.473) [-1023.938] (-1024.729) (-1024.022) * (-1026.167) [-1025.724] (-1030.281) (-1026.508) -- 0:00:29 523500 -- [-1024.922] (-1025.803) (-1025.028) (-1026.422) * (-1025.801) [-1025.055] (-1026.132) (-1026.565) -- 0:00:30 524000 -- (-1028.727) (-1026.482) (-1027.055) [-1024.085] * [-1026.316] (-1028.089) (-1026.507) (-1026.972) -- 0:00:29 524500 -- [-1024.033] (-1023.667) (-1027.056) (-1028.741) * (-1027.907) (-1028.643) [-1024.453] (-1027.350) -- 0:00:29 525000 -- (-1023.759) (-1025.425) [-1027.509] (-1024.111) * [-1024.782] (-1025.025) (-1023.816) (-1025.093) -- 0:00:29 Average standard deviation of split frequencies: 0.009242 525500 -- [-1025.763] (-1023.896) (-1027.310) (-1024.293) * (-1026.472) (-1025.070) [-1028.473] (-1027.313) -- 0:00:29 526000 -- [-1025.223] (-1024.481) (-1025.476) (-1028.232) * [-1025.679] (-1026.286) (-1026.895) (-1027.516) -- 0:00:29 526500 -- (-1025.542) (-1024.826) [-1031.707] (-1027.361) * (-1025.667) (-1028.963) [-1026.903] (-1025.217) -- 0:00:29 527000 -- [-1025.015] (-1024.732) (-1029.909) (-1025.960) * (-1027.470) (-1026.389) (-1025.823) [-1025.427] -- 0:00:29 527500 -- [-1026.073] (-1027.754) (-1026.120) (-1027.258) * (-1032.673) (-1025.832) (-1027.644) [-1024.732] -- 0:00:29 528000 -- (-1025.597) (-1025.282) (-1026.646) [-1026.845] * [-1028.575] (-1024.950) (-1028.738) (-1027.174) -- 0:00:29 528500 -- (-1023.727) (-1024.271) (-1024.925) [-1023.758] * (-1027.979) (-1024.769) (-1026.553) [-1026.232] -- 0:00:29 529000 -- [-1025.849] (-1025.254) (-1025.493) (-1027.934) * [-1024.093] (-1025.572) (-1028.318) (-1024.444) -- 0:00:29 529500 -- [-1025.252] (-1028.581) (-1026.448) (-1024.524) * [-1024.200] (-1024.866) (-1026.031) (-1027.254) -- 0:00:29 530000 -- (-1026.424) (-1027.347) (-1028.218) [-1030.418] * [-1023.820] (-1027.101) (-1029.653) (-1026.041) -- 0:00:29 Average standard deviation of split frequencies: 0.008409 530500 -- [-1027.764] (-1028.564) (-1025.348) (-1029.185) * (-1025.740) (-1024.821) [-1024.367] (-1026.422) -- 0:00:29 531000 -- [-1026.497] (-1031.880) (-1025.019) (-1024.318) * (-1024.649) (-1024.914) [-1026.608] (-1026.554) -- 0:00:29 531500 -- (-1025.041) (-1031.099) (-1024.982) [-1026.712] * (-1026.931) [-1025.540] (-1026.147) (-1028.172) -- 0:00:29 532000 -- (-1023.914) (-1026.884) (-1027.261) [-1025.881] * (-1024.763) (-1025.639) [-1025.456] (-1029.646) -- 0:00:29 532500 -- [-1025.676] (-1024.752) (-1024.957) (-1025.704) * [-1026.091] (-1026.365) (-1024.020) (-1023.785) -- 0:00:28 533000 -- (-1025.492) [-1026.510] (-1025.190) (-1024.990) * (-1024.551) (-1023.605) [-1024.968] (-1024.551) -- 0:00:28 533500 -- (-1024.771) (-1026.654) (-1024.308) [-1024.910] * (-1030.566) (-1023.852) (-1027.811) [-1025.098] -- 0:00:28 534000 -- [-1028.475] (-1028.254) (-1024.225) (-1025.572) * (-1027.480) [-1024.642] (-1029.191) (-1025.888) -- 0:00:28 534500 -- (-1026.844) (-1027.115) [-1023.896] (-1024.473) * (-1024.551) [-1024.591] (-1030.799) (-1026.593) -- 0:00:28 535000 -- (-1024.900) [-1028.281] (-1028.231) (-1029.736) * (-1024.398) (-1025.151) (-1025.280) [-1025.890] -- 0:00:28 Average standard deviation of split frequencies: 0.008678 535500 -- (-1025.536) [-1026.282] (-1023.946) (-1026.285) * [-1023.679] (-1026.998) (-1025.599) (-1027.113) -- 0:00:28 536000 -- (-1026.493) (-1027.343) [-1023.736] (-1028.069) * (-1030.121) (-1034.235) [-1025.328] (-1024.004) -- 0:00:28 536500 -- (-1027.101) [-1024.285] (-1028.038) (-1023.976) * (-1023.459) (-1033.409) [-1026.316] (-1025.828) -- 0:00:28 537000 -- (-1024.829) (-1024.508) [-1023.634] (-1027.198) * (-1031.534) (-1024.973) [-1024.586] (-1027.808) -- 0:00:28 537500 -- [-1028.648] (-1029.009) (-1023.536) (-1028.724) * (-1025.616) [-1024.977] (-1028.320) (-1025.667) -- 0:00:28 538000 -- (-1027.956) (-1026.086) [-1027.204] (-1025.127) * [-1025.175] (-1030.927) (-1024.584) (-1025.359) -- 0:00:28 538500 -- (-1025.788) (-1026.312) (-1024.331) [-1024.699] * (-1024.959) (-1026.169) (-1026.115) [-1026.494] -- 0:00:28 539000 -- [-1026.279] (-1023.888) (-1024.215) (-1025.323) * (-1027.227) (-1025.360) [-1031.064] (-1028.895) -- 0:00:28 539500 -- (-1025.476) [-1023.638] (-1031.121) (-1027.289) * (-1024.907) (-1025.388) [-1028.518] (-1026.928) -- 0:00:28 540000 -- (-1029.593) (-1024.322) [-1026.258] (-1025.452) * [-1027.605] (-1028.006) (-1026.657) (-1024.467) -- 0:00:28 Average standard deviation of split frequencies: 0.008951 540500 -- [-1024.720] (-1025.447) (-1030.063) (-1026.353) * (-1024.299) [-1025.496] (-1024.870) (-1026.194) -- 0:00:28 541000 -- [-1025.419] (-1024.259) (-1028.479) (-1025.977) * (-1023.391) [-1025.160] (-1024.893) (-1025.795) -- 0:00:28 541500 -- [-1028.894] (-1027.153) (-1026.152) (-1025.532) * (-1023.572) (-1032.093) (-1027.731) [-1026.061] -- 0:00:28 542000 -- (-1026.803) (-1029.032) (-1027.248) [-1024.272] * (-1029.862) [-1025.216] (-1026.629) (-1025.937) -- 0:00:28 542500 -- (-1024.770) (-1028.892) (-1033.691) [-1024.528] * [-1028.262] (-1028.407) (-1026.687) (-1024.707) -- 0:00:28 543000 -- (-1025.681) (-1027.958) (-1028.622) [-1023.697] * (-1024.922) (-1027.475) (-1027.421) [-1023.501] -- 0:00:28 543500 -- (-1025.684) (-1026.515) (-1027.940) [-1026.320] * (-1024.931) (-1026.527) (-1027.232) [-1023.620] -- 0:00:28 544000 -- [-1028.969] (-1024.499) (-1028.189) (-1026.499) * [-1026.014] (-1024.088) (-1026.339) (-1024.998) -- 0:00:28 544500 -- (-1026.972) (-1027.572) (-1027.793) [-1025.628] * (-1024.474) (-1025.489) [-1025.501] (-1026.343) -- 0:00:28 545000 -- (-1025.931) (-1026.403) [-1026.395] (-1029.177) * (-1024.105) (-1024.854) [-1024.419] (-1028.586) -- 0:00:28 Average standard deviation of split frequencies: 0.008404 545500 -- (-1026.870) (-1028.781) (-1026.174) [-1027.430] * (-1026.526) (-1024.578) [-1024.103] (-1024.181) -- 0:00:28 546000 -- (-1026.290) (-1025.571) [-1024.425] (-1026.160) * [-1024.228] (-1029.125) (-1023.436) (-1027.144) -- 0:00:28 546500 -- (-1026.232) (-1026.705) (-1025.319) [-1025.392] * (-1030.570) (-1027.771) [-1023.707] (-1027.396) -- 0:00:28 547000 -- (-1024.852) (-1024.127) (-1029.192) [-1024.842] * (-1027.507) (-1026.405) [-1027.782] (-1027.348) -- 0:00:28 547500 -- [-1024.845] (-1024.247) (-1026.115) (-1026.047) * (-1027.787) [-1025.644] (-1023.649) (-1026.736) -- 0:00:28 548000 -- (-1024.928) [-1026.401] (-1024.550) (-1024.982) * (-1024.746) (-1026.935) [-1024.376] (-1027.396) -- 0:00:28 548500 -- (-1025.437) (-1028.339) (-1024.447) [-1024.930] * [-1024.279] (-1023.554) (-1024.921) (-1029.648) -- 0:00:27 549000 -- (-1024.992) (-1029.066) (-1026.317) [-1026.588] * (-1026.123) [-1024.361] (-1025.168) (-1027.010) -- 0:00:27 549500 -- (-1023.708) (-1027.384) [-1025.011] (-1025.361) * [-1033.513] (-1025.769) (-1024.247) (-1024.089) -- 0:00:27 550000 -- (-1025.335) (-1029.351) [-1024.426] (-1025.507) * [-1026.261] (-1025.219) (-1024.749) (-1026.926) -- 0:00:27 Average standard deviation of split frequencies: 0.008504 550500 -- (-1025.688) (-1027.596) (-1024.581) [-1025.294] * (-1030.925) (-1027.277) (-1023.639) [-1025.527] -- 0:00:27 551000 -- [-1027.611] (-1024.054) (-1024.719) (-1025.779) * (-1025.374) [-1029.869] (-1029.041) (-1029.717) -- 0:00:27 551500 -- [-1028.280] (-1026.644) (-1024.160) (-1026.536) * (-1026.239) (-1026.488) (-1024.578) [-1026.180] -- 0:00:27 552000 -- (-1027.607) (-1024.757) [-1027.264] (-1026.668) * (-1024.686) (-1025.785) [-1024.770] (-1025.222) -- 0:00:27 552500 -- (-1