--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 17:50:04 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0513/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -759.31 -764.70 2 -759.24 -762.25 -------------------------------------- TOTAL -759.28 -764.09 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.871156 0.088380 0.328458 1.439747 0.837733 1501.00 1501.00 1.000 r(A<->C){all} 0.149309 0.016849 0.000022 0.402140 0.114843 242.53 290.18 1.000 r(A<->G){all} 0.167178 0.020430 0.000006 0.449695 0.124687 284.45 293.45 1.001 r(A<->T){all} 0.150999 0.015644 0.000205 0.396451 0.120602 130.63 149.25 1.000 r(C<->G){all} 0.130760 0.014715 0.000016 0.378455 0.092014 173.78 263.62 1.003 r(C<->T){all} 0.222545 0.025538 0.000024 0.535819 0.195817 218.83 244.78 1.000 r(G<->T){all} 0.179210 0.021796 0.000068 0.468571 0.141471 194.53 195.52 1.000 pi(A){all} 0.175291 0.000261 0.145043 0.207123 0.174994 1272.69 1319.63 1.001 pi(C){all} 0.287616 0.000359 0.252462 0.326704 0.287634 1034.17 1254.96 1.000 pi(G){all} 0.338994 0.000395 0.303089 0.379160 0.339247 1233.42 1277.36 1.000 pi(T){all} 0.198100 0.000280 0.166785 0.231848 0.197840 1203.00 1280.94 1.000 alpha{1,2} 0.315244 0.140951 0.000160 1.004412 0.201657 797.93 1091.76 1.000 alpha{3} 0.404918 0.225307 0.000200 1.373809 0.240165 1286.92 1294.69 1.000 pinvar{all} 0.993789 0.000024 0.984459 0.999861 0.994988 1337.26 1373.24 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -732.857398 Model 2: PositiveSelection -732.389473 Model 0: one-ratio -732.411807 Model 7: beta -732.857288 Model 8: beta&w>1 -732.389473 Model 0 vs 1 0.8911820000000716 Model 2 vs 1 0.9358500000000731 Model 8 vs 7 0.9356300000001738
>C1 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C2 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C3 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C4 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C5 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C6 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=184 C1 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C2 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C3 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C4 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C5 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C6 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA ************************************************** C1 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C2 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C3 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C4 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C5 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C6 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI ************************************************** C1 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C2 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C3 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C4 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C5 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C6 DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA ******.******************************************* C1 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C2 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C3 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C4 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C5 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C6 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG ********************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5520] Library Relaxation: Multi_proc [96] Relaxation Summary: [5520]--->[5520] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.476 Mb, Max= 30.724 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C2 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C3 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C4 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C5 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA C6 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA ************************************************** C1 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C2 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C3 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C4 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C5 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI C6 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI ************************************************** C1 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C2 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C3 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C4 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C5 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA C6 DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA ******.******************************************* C1 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C2 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C3 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C4 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C5 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG C6 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG ********************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 99.46 C1 C6 99.46 TOP 5 0 99.46 C6 C1 99.46 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 99.46 C2 C6 99.46 TOP 5 1 99.46 C6 C2 99.46 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 99.46 C3 C6 99.46 TOP 5 2 99.46 C6 C3 99.46 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 99.46 C4 C6 99.46 TOP 5 3 99.46 C6 C4 99.46 BOT 4 5 99.46 C5 C6 99.46 TOP 5 4 99.46 C6 C5 99.46 AVG 0 C1 * 99.89 AVG 1 C2 * 99.89 AVG 2 C3 * 99.89 AVG 3 C4 * 99.89 AVG 4 C5 * 99.89 AVG 5 C6 * 99.46 TOT TOT * 99.82 CLUSTAL W (1.83) multiple sequence alignment C1 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT C2 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT C3 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT C4 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT C5 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT C6 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT ************************************************** C1 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG C2 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG C3 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG C4 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG C5 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG C6 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG ************************************************** C1 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT C2 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT C3 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT C4 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT C5 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT C6 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ************************************************** C1 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG C2 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG C3 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG C4 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG C5 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG C6 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ************************************************** C1 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT C2 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT C3 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT C4 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT C5 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT C6 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT ************************************************** C1 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC C2 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC C3 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC C4 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC C5 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC C6 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC ************************************************** C1 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT C2 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT C3 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT C4 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT C5 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT C6 GACACCGCCGAGGCACTAGTACGGCGGGTTGCTCCGGTACCGGTTCGACT ******************* ****************************** C1 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG C2 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG C3 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG C4 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG C5 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG C6 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG ************************************************** C1 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG C2 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG C3 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG C4 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG C5 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG C6 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG ************************************************** C1 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC C2 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC C3 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC C4 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC C5 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC C6 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC ************************************************** C1 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG C2 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG C3 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG C4 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG C5 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG C6 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG ************************************************** C1 GG C2 GG C3 GG C4 GG C5 GG C6 GG ** >C1 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >C2 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >C3 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >C4 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >C5 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >C6 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGTACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >C1 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C2 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C3 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C4 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C5 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >C6 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 552 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579801704 Setting output file names to "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1792720655 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 1859468447 Seed = 460686294 Swapseed = 1579801704 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 5 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1238.805252 -- -24.965149 Chain 2 -- -1238.805070 -- -24.965149 Chain 3 -- -1238.805252 -- -24.965149 Chain 4 -- -1238.803702 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1238.805252 -- -24.965149 Chain 2 -- -1238.805252 -- -24.965149 Chain 3 -- -1238.805323 -- -24.965149 Chain 4 -- -1238.805323 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1238.805] (-1238.805) (-1238.805) (-1238.804) * [-1238.805] (-1238.805) (-1238.805) (-1238.805) 500 -- (-768.468) (-774.488) [-771.314] (-778.643) * [-768.633] (-774.008) (-762.815) (-768.527) -- 0:00:00 1000 -- (-766.151) (-770.064) [-772.336] (-769.366) * [-760.766] (-764.710) (-764.420) (-766.033) -- 0:00:00 1500 -- [-765.519] (-775.655) (-764.120) (-768.542) * (-762.272) (-765.923) [-763.334] (-768.246) -- 0:00:00 2000 -- [-763.203] (-767.016) (-764.665) (-764.078) * (-760.563) (-764.871) [-761.770] (-764.843) -- 0:00:00 2500 -- [-762.152] (-768.507) (-764.865) (-767.207) * (-775.815) [-764.504] (-771.803) (-765.281) -- 0:00:00 3000 -- (-765.611) (-762.961) [-760.832] (-767.405) * (-765.166) [-764.125] (-774.842) (-763.913) -- 0:00:00 3500 -- (-767.256) (-768.603) (-764.476) [-768.426] * [-766.279] (-764.638) (-762.399) (-771.099) -- 0:00:00 4000 -- (-770.536) (-763.198) [-767.387] (-760.587) * [-759.537] (-774.861) (-764.307) (-763.334) -- 0:00:00 4500 -- (-773.763) (-764.556) [-760.894] (-763.989) * (-765.775) [-763.544] (-762.527) (-772.561) -- 0:00:00 5000 -- [-770.297] (-766.327) (-766.712) (-760.981) * (-768.594) [-767.926] (-766.108) (-769.143) -- 0:00:00 Average standard deviation of split frequencies: 0.111304 5500 -- [-762.763] (-769.571) (-768.313) (-765.801) * (-765.226) (-767.851) (-774.299) [-761.785] -- 0:00:00 6000 -- [-765.416] (-766.548) (-767.776) (-769.578) * (-763.665) [-763.425] (-769.602) (-764.088) -- 0:00:00 6500 -- (-767.779) (-766.560) (-771.693) [-765.933] * (-766.718) (-771.429) [-762.534] (-762.870) -- 0:00:00 7000 -- (-764.186) (-767.955) (-764.577) [-759.766] * [-767.705] (-766.559) (-764.556) (-767.434) -- 0:00:00 7500 -- (-771.068) [-761.719] (-769.999) (-761.153) * (-764.909) (-771.556) (-760.449) [-763.517] -- 0:00:00 8000 -- [-762.689] (-762.689) (-763.107) (-761.941) * [-763.012] (-769.775) (-759.206) (-763.904) -- 0:02:04 8500 -- (-758.229) (-776.951) (-762.931) [-759.832] * [-759.796] (-762.447) (-763.594) (-771.788) -- 0:01:56 9000 -- (-762.376) (-768.475) [-762.364] (-763.205) * [-762.607] (-769.569) (-769.195) (-768.822) -- 0:01:50 9500 -- [-762.627] (-763.875) (-766.185) (-762.336) * (-761.901) (-769.591) [-760.413] (-760.505) -- 0:01:44 10000 -- (-763.315) [-762.221] (-762.122) (-759.871) * (-766.793) (-762.418) (-765.224) [-763.301] -- 0:01:39 Average standard deviation of split frequencies: 0.081759 10500 -- (-766.317) (-769.424) [-760.705] (-761.216) * [-762.048] (-770.116) (-767.248) (-770.699) -- 0:01:34 11000 -- (-766.127) (-777.646) [-763.187] (-760.111) * (-763.416) (-773.660) [-760.422] (-765.876) -- 0:01:29 11500 -- [-765.042] (-778.594) (-766.522) (-759.864) * [-760.431] (-764.840) (-759.752) (-763.689) -- 0:01:25 12000 -- [-772.472] (-758.220) (-770.700) (-761.379) * [-761.474] (-771.440) (-767.126) (-767.288) -- 0:01:22 12500 -- (-773.465) [-760.422] (-765.773) (-759.211) * (-768.713) (-768.541) [-763.463] (-768.235) -- 0:01:19 13000 -- (-767.250) [-758.070] (-762.786) (-765.327) * [-761.504] (-759.944) (-762.685) (-769.128) -- 0:01:15 13500 -- (-766.716) (-757.904) (-770.676) [-760.276] * (-768.980) (-759.149) (-770.495) [-775.216] -- 0:01:13 14000 -- (-761.633) [-757.829] (-772.543) (-760.936) * (-766.959) (-760.879) [-764.642] (-770.380) -- 0:01:10 14500 -- (-765.896) [-759.040] (-771.064) (-760.721) * (-761.617) (-759.011) (-766.854) [-762.934] -- 0:01:07 15000 -- (-761.004) [-757.468] (-770.955) (-761.570) * [-764.113] (-758.690) (-763.880) (-764.372) -- 0:01:05 Average standard deviation of split frequencies: 0.057375 15500 -- (-763.263) (-758.064) (-760.237) [-761.439] * (-771.960) (-759.315) (-760.571) [-761.769] -- 0:01:03 16000 -- (-761.909) [-759.318] (-763.146) (-761.973) * (-761.939) [-756.973] (-767.112) (-763.750) -- 0:01:01 16500 -- (-762.293) [-760.107] (-760.321) (-763.279) * (-767.897) (-758.460) (-764.638) [-765.985] -- 0:00:59 17000 -- (-760.942) [-759.129] (-761.474) (-761.034) * (-767.917) (-759.058) [-764.176] (-764.654) -- 0:00:57 17500 -- [-765.571] (-763.023) (-762.989) (-762.085) * (-764.078) (-757.567) [-763.250] (-767.389) -- 0:00:56 18000 -- (-761.847) (-761.227) (-770.543) [-762.795] * [-762.569] (-763.630) (-770.379) (-766.803) -- 0:00:54 18500 -- (-758.716) [-761.167] (-762.123) (-765.197) * [-768.718] (-757.629) (-763.091) (-764.338) -- 0:00:53 19000 -- (-765.205) (-760.342) [-761.563] (-759.707) * [-763.815] (-759.842) (-772.097) (-767.322) -- 0:00:51 19500 -- (-759.466) (-760.313) [-759.203] (-762.345) * (-768.225) (-758.786) [-764.710] (-768.979) -- 0:00:50 20000 -- (-758.355) (-758.726) [-760.689] (-761.468) * (-760.917) (-758.177) (-768.458) [-762.204] -- 0:00:49 Average standard deviation of split frequencies: 0.057785 20500 -- [-762.123] (-758.761) (-761.974) (-761.192) * (-766.773) (-757.169) (-763.939) [-767.126] -- 0:00:47 21000 -- (-763.341) (-764.776) [-760.495] (-759.162) * (-772.193) (-757.295) (-764.550) [-760.262] -- 0:00:46 21500 -- [-758.571] (-766.857) (-761.126) (-759.888) * (-770.183) (-757.310) (-765.442) [-761.115] -- 0:00:45 22000 -- (-759.222) (-762.106) (-759.770) [-762.384] * (-765.140) (-761.512) (-764.443) [-767.131] -- 0:00:44 22500 -- (-759.791) [-761.338] (-761.031) (-762.730) * (-769.134) (-758.259) [-766.006] (-764.636) -- 0:00:43 23000 -- [-759.861] (-764.003) (-763.956) (-762.992) * (-763.881) [-757.976] (-767.575) (-771.508) -- 0:00:42 23500 -- (-759.253) (-760.042) (-762.213) [-761.500] * (-766.583) (-759.551) [-765.736] (-767.497) -- 0:01:23 24000 -- [-758.212] (-761.036) (-761.685) (-760.594) * (-769.311) [-757.559] (-763.024) (-762.530) -- 0:01:21 24500 -- [-758.648] (-759.067) (-761.336) (-759.796) * (-768.346) (-760.764) [-766.289] (-761.885) -- 0:01:19 25000 -- [-760.940] (-761.859) (-760.791) (-761.233) * [-762.152] (-758.358) (-766.824) (-768.608) -- 0:01:18 Average standard deviation of split frequencies: 0.039558 25500 -- (-759.556) (-757.858) [-760.506] (-758.036) * [-762.593] (-756.981) (-768.080) (-761.312) -- 0:01:16 26000 -- [-765.643] (-758.905) (-761.664) (-759.431) * (-769.736) [-760.519] (-762.712) (-767.497) -- 0:01:14 26500 -- (-759.180) (-767.912) [-757.820] (-761.496) * [-766.159] (-763.302) (-768.134) (-770.692) -- 0:01:13 27000 -- (-760.970) (-760.967) (-760.814) [-760.946] * [-757.020] (-762.885) (-766.728) (-770.852) -- 0:01:12 27500 -- (-758.791) (-759.929) (-760.742) [-760.075] * [-766.843] (-758.786) (-762.577) (-764.507) -- 0:01:10 28000 -- [-762.544] (-760.112) (-762.173) (-759.085) * (-780.203) (-759.157) [-762.669] (-769.004) -- 0:01:09 28500 -- (-762.550) [-759.619] (-762.321) (-762.127) * [-765.939] (-762.529) (-763.519) (-765.500) -- 0:01:08 29000 -- (-758.350) [-760.545] (-761.743) (-758.007) * [-762.575] (-761.812) (-763.168) (-761.817) -- 0:01:06 29500 -- (-759.058) (-761.705) (-762.130) [-760.791] * [-766.397] (-762.700) (-760.993) (-763.473) -- 0:01:05 30000 -- (-758.366) (-758.300) [-760.463] (-760.796) * (-759.526) (-758.228) [-761.199] (-762.528) -- 0:01:04 Average standard deviation of split frequencies: 0.038430 30500 -- (-762.536) [-758.747] (-762.590) (-762.069) * (-771.061) (-761.105) [-759.735] (-764.480) -- 0:01:03 31000 -- (-763.774) (-762.755) (-764.347) [-758.517] * (-775.700) (-760.344) (-757.558) [-766.355] -- 0:01:02 31500 -- (-759.870) [-760.542] (-768.821) (-760.881) * (-769.040) (-759.938) [-767.466] (-784.232) -- 0:01:01 32000 -- (-759.240) (-757.625) (-763.518) [-757.618] * (-776.906) (-762.667) [-760.559] (-767.050) -- 0:01:00 32500 -- (-758.389) [-758.048] (-758.200) (-758.871) * (-773.418) (-762.882) [-759.947] (-761.889) -- 0:00:59 33000 -- (-758.665) (-757.195) (-759.425) [-761.785] * (-764.050) (-757.305) [-766.400] (-761.669) -- 0:00:58 33500 -- [-760.743] (-759.216) (-759.752) (-761.436) * [-766.041] (-758.258) (-765.478) (-758.901) -- 0:00:57 34000 -- [-759.748] (-759.828) (-760.250) (-762.800) * (-762.318) (-758.517) [-763.825] (-761.414) -- 0:00:56 34500 -- (-766.260) (-758.705) [-762.665] (-762.386) * [-760.541] (-760.278) (-766.894) (-760.801) -- 0:00:55 35000 -- (-766.565) [-761.442] (-761.109) (-761.531) * (-767.439) [-762.341] (-766.317) (-758.796) -- 0:00:55 Average standard deviation of split frequencies: 0.035712 35500 -- [-762.933] (-761.771) (-762.020) (-762.449) * (-764.224) (-762.420) [-762.954] (-759.558) -- 0:00:54 36000 -- (-761.319) (-762.520) [-759.012] (-762.828) * (-770.850) (-764.938) [-764.531] (-760.216) -- 0:00:53 36500 -- [-760.004] (-761.865) (-760.654) (-761.745) * [-760.148] (-766.851) (-771.825) (-760.206) -- 0:00:52 37000 -- (-758.113) (-760.369) [-759.332] (-760.991) * (-772.692) [-762.844] (-767.395) (-761.719) -- 0:00:52 37500 -- [-757.382] (-761.241) (-762.570) (-758.247) * (-767.494) (-759.865) [-773.192] (-761.856) -- 0:00:51 38000 -- [-758.948] (-759.577) (-758.937) (-760.110) * [-763.263] (-763.168) (-764.390) (-761.116) -- 0:00:50 38500 -- (-760.296) (-757.331) (-763.468) [-756.982] * (-764.645) (-765.978) [-767.080] (-764.327) -- 0:00:49 39000 -- (-758.425) [-761.772] (-761.257) (-757.992) * [-762.820] (-761.817) (-765.702) (-762.057) -- 0:01:13 39500 -- [-762.226] (-759.060) (-760.011) (-763.871) * (-761.162) (-758.313) [-763.456] (-766.373) -- 0:01:12 40000 -- (-759.382) (-760.142) [-760.385] (-757.496) * (-760.142) (-759.983) (-759.357) [-759.364] -- 0:01:12 Average standard deviation of split frequencies: 0.035328 40500 -- (-760.685) (-760.915) (-760.747) [-758.522] * [-758.775] (-759.806) (-776.653) (-768.121) -- 0:01:11 41000 -- (-757.909) [-759.743] (-759.114) (-760.350) * (-761.529) (-760.262) [-760.083] (-760.550) -- 0:01:10 41500 -- (-759.685) [-758.469] (-759.206) (-761.693) * (-759.382) [-758.593] (-757.538) (-761.071) -- 0:01:09 42000 -- (-759.217) [-757.885] (-761.788) (-760.118) * (-759.277) (-759.902) (-760.946) [-760.136] -- 0:01:08 42500 -- (-757.764) [-762.085] (-765.496) (-759.264) * (-762.275) (-759.509) (-761.260) [-763.142] -- 0:01:07 43000 -- [-759.003] (-761.717) (-760.278) (-758.737) * (-759.541) [-758.488] (-758.753) (-759.482) -- 0:01:06 43500 -- (-761.320) [-758.881] (-758.588) (-758.587) * [-757.857] (-758.313) (-761.570) (-760.364) -- 0:01:05 44000 -- (-762.487) [-759.633] (-762.864) (-756.880) * (-758.545) (-759.692) (-763.070) [-760.671] -- 0:01:05 44500 -- (-758.767) [-757.688] (-758.219) (-762.017) * (-762.384) (-758.809) [-763.017] (-762.373) -- 0:01:04 45000 -- (-757.701) (-761.539) [-757.337] (-761.821) * (-762.314) (-759.602) [-761.111] (-759.365) -- 0:01:03 Average standard deviation of split frequencies: 0.030744 45500 -- (-760.651) (-757.684) [-759.962] (-761.475) * (-760.729) (-762.646) [-763.516] (-760.770) -- 0:01:02 46000 -- [-761.571] (-761.827) (-758.021) (-759.057) * (-760.184) (-761.793) (-761.701) [-759.966] -- 0:01:02 46500 -- (-761.748) [-760.201] (-761.781) (-761.489) * (-760.237) [-760.579] (-766.282) (-759.883) -- 0:01:01 47000 -- (-760.462) (-762.011) [-762.116] (-764.059) * (-760.667) (-758.720) (-761.260) [-759.055] -- 0:01:00 47500 -- (-759.388) (-759.112) (-762.633) [-762.122] * (-759.177) (-759.493) (-761.484) [-760.862] -- 0:01:00 48000 -- (-758.643) [-761.277] (-759.939) (-759.721) * (-760.435) (-757.658) (-760.443) [-759.841] -- 0:00:59 48500 -- [-757.444] (-759.344) (-759.929) (-763.699) * [-763.656] (-762.262) (-759.656) (-758.452) -- 0:00:58 49000 -- (-758.999) [-759.596] (-760.946) (-759.337) * (-765.826) [-760.478] (-762.406) (-759.282) -- 0:00:58 49500 -- [-759.827] (-759.935) (-760.525) (-760.880) * (-760.025) (-759.718) [-761.805] (-758.897) -- 0:00:57 50000 -- (-757.137) (-758.762) (-763.544) [-760.249] * (-765.383) (-759.002) (-763.136) [-759.466] -- 0:00:57 Average standard deviation of split frequencies: 0.027912 50500 -- (-758.170) (-760.857) (-764.029) [-760.009] * [-763.444] (-763.364) (-760.701) (-758.641) -- 0:00:56 51000 -- (-758.428) [-761.716] (-762.219) (-761.152) * [-761.696] (-761.321) (-761.771) (-761.360) -- 0:00:55 51500 -- (-756.827) (-760.721) (-757.940) [-762.508] * (-760.182) (-759.248) (-760.217) [-761.062] -- 0:00:55 52000 -- (-758.368) [-757.933] (-758.947) (-760.637) * (-766.222) [-760.333] (-758.602) (-760.367) -- 0:00:54 52500 -- [-758.579] (-760.618) (-760.476) (-759.991) * (-762.621) (-760.913) [-759.310] (-761.002) -- 0:00:54 53000 -- [-760.487] (-758.618) (-757.437) (-762.613) * (-762.857) [-759.483] (-762.627) (-765.117) -- 0:00:53 53500 -- [-760.562] (-760.098) (-758.210) (-761.638) * [-760.719] (-759.881) (-764.753) (-762.600) -- 0:00:53 54000 -- [-758.973] (-761.228) (-763.024) (-761.839) * (-759.901) (-760.483) [-763.630] (-765.045) -- 0:00:52 54500 -- (-760.303) (-760.649) (-758.204) [-761.648] * (-762.379) (-763.516) (-762.885) [-760.039] -- 0:01:09 55000 -- (-761.140) [-760.129] (-760.457) (-762.756) * [-760.030] (-763.438) (-760.986) (-763.677) -- 0:01:08 Average standard deviation of split frequencies: 0.039143 55500 -- (-760.304) (-762.501) (-758.525) [-758.961] * [-761.758] (-759.534) (-762.423) (-762.409) -- 0:01:08 56000 -- (-759.600) (-761.717) [-759.305] (-758.786) * (-761.883) [-757.978] (-760.225) (-761.004) -- 0:01:07 56500 -- (-761.285) (-761.711) (-763.684) [-759.592] * (-759.590) (-760.049) [-759.421] (-761.840) -- 0:01:06 57000 -- (-762.009) (-758.841) [-758.444] (-761.349) * [-759.832] (-759.929) (-761.569) (-760.722) -- 0:01:06 57500 -- (-761.739) (-759.955) [-760.614] (-760.616) * (-759.735) (-759.865) [-757.474] (-761.128) -- 0:01:05 58000 -- (-762.394) (-761.598) (-763.068) [-761.355] * (-760.347) [-760.831] (-758.309) (-760.679) -- 0:01:04 58500 -- [-760.156] (-761.156) (-765.186) (-761.465) * (-759.429) (-760.948) [-760.881] (-764.264) -- 0:01:04 59000 -- [-758.595] (-761.399) (-760.501) (-760.735) * [-764.556] (-759.333) (-758.206) (-762.164) -- 0:01:03 59500 -- (-758.443) (-763.510) [-762.730] (-761.359) * (-764.180) [-761.919] (-759.447) (-761.567) -- 0:01:03 60000 -- (-760.288) [-759.702] (-760.578) (-759.801) * (-761.152) (-760.401) [-758.672] (-761.205) -- 0:01:02 Average standard deviation of split frequencies: 0.041442 60500 -- (-760.006) (-759.572) [-758.910] (-762.489) * (-762.051) [-761.556] (-758.042) (-762.284) -- 0:01:02 61000 -- (-757.068) (-761.047) [-759.117] (-762.277) * [-760.343] (-762.565) (-762.101) (-760.366) -- 0:01:01 61500 -- (-758.215) [-760.595] (-758.226) (-761.204) * [-760.291] (-759.531) (-762.091) (-759.695) -- 0:01:01 62000 -- (-758.281) (-765.329) [-760.715] (-760.876) * (-759.097) (-763.941) [-762.153] (-760.678) -- 0:01:00 62500 -- (-757.671) (-764.101) [-761.924] (-761.084) * (-758.154) (-760.180) [-760.152] (-769.163) -- 0:01:00 63000 -- [-761.751] (-760.216) (-763.481) (-759.948) * (-759.116) (-760.487) [-759.965] (-761.398) -- 0:00:59 63500 -- (-758.410) [-760.059] (-762.257) (-759.767) * [-758.465] (-759.995) (-761.740) (-760.060) -- 0:00:58 64000 -- (-760.118) (-759.385) (-759.639) [-761.558] * [-762.865] (-758.481) (-764.938) (-760.618) -- 0:00:58 64500 -- (-763.099) (-761.479) [-762.200] (-760.006) * [-759.375] (-758.333) (-760.712) (-763.595) -- 0:00:58 65000 -- (-761.134) (-763.779) [-758.714] (-759.441) * [-758.542] (-760.904) (-761.770) (-760.311) -- 0:00:57 Average standard deviation of split frequencies: 0.038212 65500 -- [-758.236] (-760.761) (-759.236) (-761.518) * [-760.839] (-758.608) (-761.959) (-761.257) -- 0:00:57 66000 -- (-762.428) (-760.241) [-759.284] (-761.959) * (-762.260) [-759.914] (-763.153) (-760.733) -- 0:00:56 66500 -- [-759.851] (-761.371) (-760.990) (-761.425) * (-764.071) [-764.863] (-765.478) (-762.954) -- 0:00:56 67000 -- [-759.863] (-760.477) (-760.342) (-763.346) * (-762.891) (-759.238) (-760.340) [-764.716] -- 0:00:55 67500 -- (-757.384) (-759.832) [-759.006] (-761.907) * (-760.795) [-759.298] (-760.548) (-761.729) -- 0:00:55 68000 -- (-758.721) (-761.035) [-758.136] (-761.602) * (-762.085) (-760.640) (-759.785) [-767.095] -- 0:00:54 68500 -- (-759.338) [-760.966] (-760.842) (-761.395) * (-760.951) (-760.554) [-760.481] (-766.424) -- 0:00:54 69000 -- (-760.013) (-762.843) [-757.734] (-762.050) * [-759.759] (-763.739) (-759.001) (-762.837) -- 0:00:53 69500 -- (-761.271) [-759.154] (-756.857) (-760.790) * (-759.155) (-760.037) [-758.862] (-763.027) -- 0:00:53 70000 -- (-758.640) (-760.516) [-759.190] (-760.293) * (-758.626) (-762.248) [-759.754] (-763.867) -- 0:01:06 Average standard deviation of split frequencies: 0.037801 70500 -- [-760.685] (-760.504) (-763.909) (-760.600) * (-762.759) (-758.872) (-761.511) [-760.900] -- 0:01:05 71000 -- (-758.409) [-758.594] (-763.030) (-761.754) * (-757.797) [-759.419] (-761.755) (-761.238) -- 0:01:05 71500 -- (-758.789) (-760.885) (-762.967) [-760.595] * (-759.796) (-759.385) [-760.192] (-763.936) -- 0:01:04 72000 -- (-759.748) (-759.553) [-762.023] (-762.974) * (-759.776) [-760.086] (-764.778) (-760.258) -- 0:01:04 72500 -- [-758.392] (-761.051) (-758.365) (-761.283) * (-760.617) [-760.169] (-762.165) (-762.408) -- 0:01:03 73000 -- (-758.661) (-760.317) [-757.734] (-763.691) * (-760.360) [-762.791] (-763.781) (-764.336) -- 0:01:03 73500 -- [-762.972] (-771.941) (-760.181) (-760.170) * (-758.061) (-760.815) (-764.744) [-761.154] -- 0:01:03 74000 -- [-760.280] (-761.944) (-761.380) (-761.595) * (-762.047) [-760.032] (-761.735) (-764.063) -- 0:01:02 74500 -- [-760.179] (-765.668) (-760.864) (-761.626) * (-759.469) [-758.569] (-762.885) (-763.768) -- 0:01:02 75000 -- (-759.987) (-765.526) [-759.253] (-760.217) * [-758.018] (-760.840) (-760.550) (-764.817) -- 0:01:01 Average standard deviation of split frequencies: 0.037836 75500 -- [-759.370] (-762.350) (-757.925) (-760.539) * (-757.938) (-759.091) (-760.985) [-762.418] -- 0:01:01 76000 -- (-760.794) [-759.707] (-762.504) (-762.184) * [-759.235] (-762.151) (-761.015) (-759.990) -- 0:01:00 76500 -- [-760.861] (-760.124) (-761.406) (-760.227) * [-760.243] (-762.303) (-759.899) (-763.509) -- 0:01:00 77000 -- (-760.818) [-760.148] (-764.458) (-762.191) * (-759.126) (-761.254) [-760.769] (-761.688) -- 0:00:59 77500 -- (-760.528) [-759.799] (-759.824) (-761.364) * [-760.917] (-763.745) (-759.880) (-759.478) -- 0:00:59 78000 -- (-759.555) [-757.784] (-760.120) (-765.426) * (-760.049) [-762.824] (-761.418) (-760.522) -- 0:00:59 78500 -- (-763.749) [-759.804] (-758.258) (-770.066) * (-758.875) (-763.216) [-760.642] (-762.143) -- 0:00:58 79000 -- (-759.472) (-762.293) (-761.786) [-764.874] * (-759.155) (-761.470) (-760.852) [-758.550] -- 0:00:58 79500 -- (-759.602) (-758.710) (-762.054) [-761.133] * (-759.682) (-761.912) [-758.588] (-762.884) -- 0:00:57 80000 -- (-760.472) [-761.432] (-760.822) (-762.445) * (-758.380) [-759.435] (-759.068) (-759.029) -- 0:00:57 Average standard deviation of split frequencies: 0.034448 80500 -- (-760.962) (-760.879) [-760.948] (-763.036) * (-765.217) [-760.369] (-761.887) (-764.270) -- 0:00:57 81000 -- (-760.176) (-760.660) [-760.382] (-761.300) * (-764.775) (-762.258) [-761.316] (-759.502) -- 0:00:56 81500 -- (-759.684) (-760.675) [-759.260] (-758.227) * (-758.696) (-764.286) [-760.517] (-760.693) -- 0:00:56 82000 -- (-760.171) (-761.280) (-760.977) [-762.124] * (-763.367) (-760.876) [-761.046] (-762.566) -- 0:00:55 82500 -- (-760.751) (-760.000) [-758.043] (-760.589) * (-762.171) (-760.503) (-759.266) [-758.434] -- 0:00:55 83000 -- (-759.368) (-760.327) [-757.683] (-763.755) * (-761.730) (-761.628) [-760.662] (-762.261) -- 0:00:55 83500 -- [-757.558] (-760.986) (-758.920) (-764.557) * [-760.076] (-760.052) (-760.800) (-762.947) -- 0:00:54 84000 -- (-759.967) (-760.870) [-760.802] (-760.172) * (-763.207) [-758.652] (-764.149) (-759.810) -- 0:00:54 84500 -- [-760.404] (-765.580) (-762.191) (-763.766) * (-759.852) [-760.758] (-760.457) (-762.689) -- 0:00:54 85000 -- [-758.285] (-760.284) (-762.202) (-760.796) * (-759.210) [-763.434] (-760.891) (-760.446) -- 0:00:53 Average standard deviation of split frequencies: 0.034043 85500 -- (-767.453) [-761.807] (-760.249) (-758.481) * (-759.260) (-759.847) [-760.594] (-758.979) -- 0:01:04 86000 -- (-761.754) [-762.095] (-760.112) (-761.381) * (-759.346) (-759.606) [-762.664] (-761.089) -- 0:01:03 86500 -- [-760.475] (-760.188) (-760.668) (-760.934) * (-760.058) (-759.911) (-762.169) [-759.663] -- 0:01:03 87000 -- [-758.577] (-760.903) (-760.084) (-762.238) * (-760.720) [-759.368] (-759.250) (-760.829) -- 0:01:02 87500 -- (-758.756) [-758.638] (-760.156) (-763.791) * (-760.057) (-761.318) [-761.988] (-760.605) -- 0:01:02 88000 -- (-760.045) (-758.759) [-760.179] (-762.113) * (-759.639) [-760.846] (-762.343) (-762.280) -- 0:01:02 88500 -- [-758.821] (-758.611) (-759.602) (-760.213) * [-761.772] (-762.290) (-759.247) (-760.264) -- 0:01:01 89000 -- (-759.359) (-759.044) [-760.883] (-760.747) * (-758.916) (-762.349) (-761.697) [-763.232] -- 0:01:01 89500 -- (-765.932) [-759.557] (-763.174) (-761.237) * (-762.859) (-760.608) [-758.835] (-765.355) -- 0:01:01 90000 -- (-760.831) (-766.132) (-760.762) [-759.378] * [-760.259] (-762.312) (-761.054) (-764.160) -- 0:01:00 Average standard deviation of split frequencies: 0.031470 90500 -- (-765.619) (-764.021) [-761.721] (-759.833) * (-761.209) (-759.751) [-760.458] (-760.224) -- 0:01:00 91000 -- (-759.746) (-760.361) [-761.336] (-762.143) * (-761.572) [-760.323] (-761.493) (-761.028) -- 0:00:59 91500 -- [-762.174] (-760.314) (-761.330) (-768.588) * (-761.198) [-760.196] (-762.373) (-760.673) -- 0:00:59 92000 -- (-759.849) (-761.360) [-763.360] (-764.339) * [-761.128] (-760.083) (-761.480) (-765.205) -- 0:00:59 92500 -- (-760.150) (-761.118) [-759.991] (-761.499) * (-763.978) (-761.189) [-762.647] (-760.352) -- 0:00:58 93000 -- (-760.169) (-765.034) (-758.825) [-766.301] * (-763.913) (-760.350) (-760.612) [-760.647] -- 0:00:58 93500 -- [-759.840] (-760.380) (-762.162) (-761.049) * (-763.425) (-762.002) (-761.040) [-759.171] -- 0:00:58 94000 -- [-759.051] (-761.656) (-765.289) (-762.671) * (-761.311) (-759.980) [-759.830] (-760.547) -- 0:00:57 94500 -- (-759.119) (-761.887) [-760.820] (-761.353) * (-758.473) (-762.479) [-760.174] (-761.401) -- 0:00:57 95000 -- (-760.458) [-760.934] (-762.330) (-761.642) * (-761.945) (-759.754) (-760.403) [-761.504] -- 0:00:57 Average standard deviation of split frequencies: 0.024307 95500 -- [-761.765] (-761.032) (-761.262) (-761.832) * (-757.032) (-765.706) [-761.849] (-763.106) -- 0:00:56 96000 -- [-763.595] (-762.038) (-762.245) (-761.992) * (-760.055) (-758.996) (-760.206) [-760.980] -- 0:00:56 96500 -- (-760.023) [-759.678] (-762.462) (-759.322) * (-762.393) [-761.285] (-760.827) (-759.466) -- 0:00:56 97000 -- (-760.973) (-761.750) [-758.314] (-764.398) * (-759.972) (-760.134) (-759.320) [-759.960] -- 0:00:55 97500 -- [-763.096] (-761.051) (-759.719) (-765.308) * [-760.211] (-760.350) (-760.241) (-762.347) -- 0:00:55 98000 -- (-760.585) (-771.491) (-759.715) [-761.477] * [-759.523] (-768.014) (-762.590) (-761.616) -- 0:00:55 98500 -- (-759.942) [-762.030] (-760.493) (-759.360) * [-759.976] (-768.302) (-761.399) (-762.070) -- 0:00:54 99000 -- (-759.844) (-763.565) (-758.359) [-761.670] * (-759.743) (-761.794) (-763.552) [-759.871] -- 0:00:54 99500 -- [-758.572] (-763.381) (-760.487) (-760.237) * (-760.989) (-760.500) (-761.581) [-760.566] -- 0:00:54 100000 -- (-762.504) (-759.533) (-761.224) [-763.569] * [-759.876] (-763.166) (-761.150) (-759.200) -- 0:00:54 Average standard deviation of split frequencies: 0.024715 100500 -- [-759.068] (-760.017) (-762.885) (-761.752) * (-761.717) (-765.890) [-759.917] (-760.142) -- 0:00:53 101000 -- (-763.207) [-759.224] (-760.863) (-762.713) * (-761.854) (-766.538) (-761.734) [-759.805] -- 0:01:02 101500 -- (-760.711) (-759.018) (-763.000) [-761.165] * (-762.021) (-761.994) [-759.209] (-759.698) -- 0:01:01 102000 -- (-760.728) (-760.520) [-761.228] (-761.436) * (-762.549) (-760.151) [-758.818] (-759.531) -- 0:01:01 102500 -- (-758.066) (-760.537) (-760.938) [-758.537] * (-761.152) (-759.190) (-760.625) [-759.492] -- 0:01:01 103000 -- (-758.210) (-759.246) (-758.810) [-759.527] * (-761.774) (-762.030) (-761.818) [-759.908] -- 0:01:00 103500 -- (-763.843) (-759.023) (-759.741) [-759.199] * (-761.188) (-767.113) (-760.713) [-759.294] -- 0:01:00 104000 -- (-762.180) (-759.854) [-758.577] (-759.630) * (-763.406) (-759.861) (-766.812) [-759.283] -- 0:01:00 104500 -- (-761.792) (-759.958) [-760.308] (-760.210) * (-761.552) (-760.223) [-761.465] (-760.569) -- 0:00:59 105000 -- (-760.379) (-761.198) (-759.097) [-760.828] * (-759.941) (-761.280) [-759.909] (-758.782) -- 0:00:59 Average standard deviation of split frequencies: 0.024707 105500 -- (-758.982) (-761.238) (-759.000) [-762.003] * (-764.292) (-760.599) [-760.275] (-761.279) -- 0:00:59 106000 -- [-759.490] (-761.867) (-759.264) (-760.694) * [-757.550] (-764.506) (-760.758) (-759.563) -- 0:00:59 106500 -- (-760.138) (-762.938) [-757.744] (-759.634) * [-760.013] (-762.656) (-761.099) (-762.195) -- 0:00:58 107000 -- [-762.760] (-761.210) (-758.721) (-761.873) * (-760.102) (-762.978) (-760.927) [-761.000] -- 0:00:58 107500 -- [-758.700] (-759.833) (-758.855) (-758.951) * (-765.307) (-760.410) (-760.217) [-762.878] -- 0:00:58 108000 -- (-758.414) [-758.294] (-760.101) (-759.798) * [-764.112] (-760.755) (-761.980) (-762.739) -- 0:00:57 108500 -- [-757.888] (-761.260) (-757.835) (-764.884) * [-760.503] (-761.845) (-761.324) (-762.742) -- 0:00:57 109000 -- (-758.595) (-767.591) [-758.503] (-759.901) * [-762.957] (-761.666) (-761.797) (-760.760) -- 0:00:57 109500 -- (-759.746) (-760.256) (-761.334) [-759.668] * (-765.555) [-759.710] (-762.005) (-761.655) -- 0:00:56 110000 -- [-761.444] (-761.287) (-760.038) (-760.184) * (-762.053) [-761.361] (-762.302) (-759.468) -- 0:00:56 Average standard deviation of split frequencies: 0.023316 110500 -- (-759.728) (-760.378) (-765.757) [-759.067] * (-760.446) (-761.025) (-766.919) [-760.414] -- 0:00:56 111000 -- (-759.571) (-761.851) (-760.061) [-761.160] * (-764.391) (-762.381) (-760.251) [-763.023] -- 0:00:56 111500 -- (-760.881) (-761.113) [-763.237] (-761.134) * (-764.513) (-761.328) [-760.997] (-764.897) -- 0:00:55 112000 -- (-759.456) (-761.833) [-757.696] (-762.383) * (-761.200) (-762.629) [-760.719] (-762.082) -- 0:00:55 112500 -- (-765.658) [-762.574] (-761.181) (-761.239) * (-762.457) (-760.056) (-763.652) [-761.732] -- 0:00:55 113000 -- [-761.459] (-762.122) (-759.839) (-760.755) * (-762.205) (-761.407) [-757.986] (-760.037) -- 0:00:54 113500 -- (-758.759) (-759.889) [-761.623] (-763.468) * (-760.434) [-762.486] (-759.471) (-760.565) -- 0:00:54 114000 -- [-761.336] (-760.057) (-759.702) (-761.027) * [-760.048] (-760.431) (-762.661) (-762.112) -- 0:00:54 114500 -- [-761.353] (-759.357) (-759.052) (-766.746) * (-762.608) [-760.315] (-764.380) (-760.981) -- 0:00:54 115000 -- [-760.824] (-758.214) (-761.626) (-763.067) * (-759.278) (-760.579) [-763.505] (-761.928) -- 0:00:53 Average standard deviation of split frequencies: 0.022030 115500 -- (-759.537) (-759.702) [-761.738] (-761.441) * (-759.079) [-760.471] (-764.170) (-761.784) -- 0:00:53 116000 -- (-760.039) (-761.387) (-759.958) [-760.307] * (-759.627) (-762.895) [-762.585] (-759.922) -- 0:00:53 116500 -- (-759.711) (-762.527) [-759.806] (-763.890) * [-758.580] (-761.861) (-759.169) (-763.184) -- 0:01:00 117000 -- [-758.830] (-758.560) (-760.127) (-761.969) * (-757.121) [-761.604] (-759.235) (-763.231) -- 0:01:00 117500 -- (-761.502) (-760.221) [-759.108] (-763.247) * (-758.720) (-761.170) [-761.514] (-761.989) -- 0:01:00 118000 -- (-760.413) (-759.073) (-760.288) [-760.879] * [-758.063] (-759.685) (-760.012) (-760.283) -- 0:00:59 118500 -- (-759.812) (-760.605) [-759.658] (-762.944) * (-758.006) (-763.886) [-759.065] (-764.310) -- 0:00:59 119000 -- [-757.889] (-759.074) (-759.078) (-759.419) * (-760.059) (-760.004) (-758.153) [-759.509] -- 0:00:59 119500 -- (-760.552) (-757.185) [-760.473] (-759.506) * (-761.285) (-759.932) (-760.351) [-759.653] -- 0:00:58 120000 -- (-759.736) [-760.711] (-761.361) (-760.655) * (-763.497) [-760.056] (-759.375) (-761.336) -- 0:00:58 Average standard deviation of split frequencies: 0.021270 120500 -- [-759.679] (-760.828) (-761.263) (-760.060) * [-759.017] (-760.193) (-759.101) (-765.881) -- 0:00:58 121000 -- (-763.392) [-761.307] (-759.475) (-760.621) * (-759.135) (-762.558) (-762.301) [-759.657] -- 0:00:58 121500 -- (-761.480) (-761.565) (-759.945) [-760.306] * (-761.394) (-760.436) [-758.567] (-760.731) -- 0:00:57 122000 -- (-760.093) [-763.929] (-763.910) (-761.246) * [-762.231] (-760.636) (-766.656) (-760.930) -- 0:00:57 122500 -- (-760.037) [-761.336] (-762.078) (-759.685) * [-759.841] (-760.637) (-765.860) (-763.268) -- 0:00:57 123000 -- (-760.619) (-758.694) (-759.355) [-765.076] * (-760.292) (-764.370) (-760.097) [-760.872] -- 0:00:57 123500 -- (-762.054) (-761.728) (-760.257) [-760.619] * (-760.901) (-761.190) (-761.908) [-760.684] -- 0:00:56 124000 -- (-760.677) [-760.436] (-761.599) (-760.671) * [-763.609] (-765.101) (-764.408) (-762.767) -- 0:00:56 124500 -- (-761.552) (-763.306) (-758.759) [-761.801] * (-760.810) [-759.622] (-764.962) (-760.887) -- 0:00:56 125000 -- (-762.321) (-763.351) [-757.960] (-767.680) * [-757.892] (-759.390) (-765.271) (-758.932) -- 0:00:56 Average standard deviation of split frequencies: 0.020785 125500 -- (-760.368) (-759.928) (-760.236) [-762.149] * [-758.929] (-763.361) (-758.957) (-761.714) -- 0:00:55 126000 -- (-760.662) [-761.134] (-760.487) (-761.700) * (-759.025) (-761.349) (-763.109) [-768.321] -- 0:00:55 126500 -- (-760.911) (-767.671) (-758.680) [-757.723] * [-760.304] (-764.184) (-759.816) (-761.724) -- 0:00:55 127000 -- (-760.804) [-760.540] (-758.473) (-757.971) * (-758.319) (-761.841) [-764.463] (-760.729) -- 0:00:54 127500 -- (-762.188) (-762.129) [-760.709] (-761.790) * (-761.827) (-761.541) (-765.679) [-759.941] -- 0:00:54 128000 -- (-769.173) (-761.446) (-759.431) [-758.063] * (-762.053) (-760.470) [-760.225] (-758.549) -- 0:00:54 128500 -- (-764.366) (-761.166) [-758.312] (-759.312) * (-760.258) (-761.881) (-764.428) [-760.746] -- 0:00:54 129000 -- (-761.161) (-762.078) [-758.721] (-765.046) * [-759.221] (-765.764) (-766.816) (-760.194) -- 0:00:54 129500 -- (-760.567) (-760.903) [-760.611] (-762.004) * [-759.427] (-759.347) (-762.866) (-762.135) -- 0:00:53 130000 -- (-761.004) (-761.754) (-758.403) [-758.013] * (-763.546) (-760.034) (-760.464) [-760.367] -- 0:00:53 Average standard deviation of split frequencies: 0.019482 130500 -- (-764.379) (-760.685) (-760.548) [-759.308] * [-760.560] (-762.533) (-759.340) (-762.107) -- 0:00:53 131000 -- [-762.211] (-760.431) (-762.785) (-760.179) * (-761.062) [-760.833] (-760.483) (-761.106) -- 0:00:53 131500 -- (-761.880) [-761.981] (-764.092) (-760.235) * (-761.579) [-764.706] (-761.331) (-761.550) -- 0:00:52 132000 -- (-761.071) (-759.992) [-761.752] (-760.400) * (-760.827) (-762.499) (-763.457) [-761.545] -- 0:00:59 132500 -- (-762.349) (-762.323) (-761.087) [-764.049] * [-757.449] (-761.423) (-763.201) (-761.182) -- 0:00:58 133000 -- (-760.616) [-762.305] (-760.648) (-762.386) * [-758.924] (-758.753) (-758.960) (-762.930) -- 0:00:58 133500 -- (-761.277) (-760.833) [-757.423] (-758.153) * (-758.811) (-759.146) (-762.032) [-761.917] -- 0:00:58 134000 -- (-760.905) (-764.549) (-758.126) [-758.337] * (-761.243) [-757.675] (-759.126) (-760.709) -- 0:00:58 134500 -- (-762.001) (-760.574) [-762.960] (-760.593) * (-758.720) (-759.986) (-758.614) [-763.779] -- 0:00:57 135000 -- (-760.770) [-760.807] (-762.369) (-759.162) * [-759.821] (-760.043) (-760.440) (-762.464) -- 0:00:57 Average standard deviation of split frequencies: 0.021491 135500 -- [-764.297] (-760.942) (-758.452) (-761.343) * (-760.937) (-761.397) [-759.762] (-762.941) -- 0:00:57 136000 -- (-760.522) (-762.714) [-760.329] (-763.300) * [-762.527] (-762.595) (-760.918) (-762.071) -- 0:00:57 136500 -- (-759.882) [-761.172] (-758.599) (-761.414) * (-758.213) (-761.135) (-761.110) [-760.757] -- 0:00:56 137000 -- (-763.695) (-763.068) [-762.464] (-758.829) * [-758.934] (-764.752) (-759.338) (-760.528) -- 0:00:56 137500 -- (-762.250) (-761.245) (-761.979) [-757.359] * (-759.576) [-761.201] (-758.021) (-760.840) -- 0:00:56 138000 -- [-763.276] (-761.612) (-765.661) (-758.442) * (-759.673) (-762.224) [-758.377] (-760.307) -- 0:00:56 138500 -- (-761.676) (-763.776) [-759.317] (-759.903) * (-759.801) [-764.515] (-757.683) (-762.250) -- 0:00:55 139000 -- [-760.970] (-761.481) (-759.915) (-762.264) * (-760.615) (-765.350) [-758.434] (-764.408) -- 0:00:55 139500 -- (-761.440) (-761.966) [-762.836] (-759.390) * (-759.597) (-761.288) (-759.975) [-761.537] -- 0:00:55 140000 -- (-761.579) (-761.197) (-761.167) [-765.264] * (-758.283) (-760.409) (-759.627) [-762.903] -- 0:00:55 Average standard deviation of split frequencies: 0.022453 140500 -- (-762.596) [-761.230] (-761.700) (-760.056) * (-760.426) (-760.390) (-758.659) [-759.715] -- 0:00:55 141000 -- [-760.835] (-765.849) (-765.196) (-759.248) * (-759.839) [-759.422] (-762.064) (-761.384) -- 0:00:54 141500 -- [-759.770] (-762.596) (-767.411) (-763.450) * [-757.820] (-761.320) (-763.940) (-760.406) -- 0:00:54 142000 -- (-759.750) [-761.831] (-761.404) (-759.016) * (-760.654) (-762.519) (-765.488) [-762.466] -- 0:00:54 142500 -- (-760.144) (-760.459) [-764.501] (-759.204) * (-762.217) (-765.722) (-757.892) [-763.337] -- 0:00:54 143000 -- (-759.978) (-760.817) (-765.359) [-762.294] * [-758.132] (-762.254) (-759.160) (-761.281) -- 0:00:53 143500 -- [-760.652] (-760.892) (-766.213) (-759.810) * (-763.594) (-763.923) [-758.941] (-761.100) -- 0:00:53 144000 -- (-760.246) (-759.872) [-762.845] (-761.174) * (-759.213) [-760.943] (-758.421) (-763.264) -- 0:00:53 144500 -- (-761.954) [-757.750] (-761.612) (-759.144) * (-764.049) [-759.403] (-760.815) (-766.845) -- 0:00:53 145000 -- (-766.404) [-761.128] (-760.325) (-760.478) * (-760.924) (-762.416) [-759.879] (-761.894) -- 0:00:53 Average standard deviation of split frequencies: 0.022924 145500 -- [-758.640] (-762.909) (-759.545) (-761.712) * (-760.751) (-764.443) (-759.698) [-760.108] -- 0:00:52 146000 -- (-760.329) (-764.154) (-759.195) [-760.531] * [-757.871] (-761.287) (-761.746) (-760.686) -- 0:00:52 146500 -- (-760.299) (-759.401) [-759.440] (-762.455) * (-759.156) [-764.812] (-757.566) (-762.747) -- 0:00:52 147000 -- [-761.284] (-764.082) (-760.140) (-758.183) * (-760.524) [-762.517] (-759.992) (-760.440) -- 0:00:52 147500 -- (-760.596) (-762.268) (-760.163) [-759.999] * [-759.754] (-759.875) (-761.398) (-761.626) -- 0:00:52 148000 -- [-764.081] (-762.933) (-759.351) (-759.768) * [-757.952] (-760.986) (-762.133) (-764.791) -- 0:00:57 148500 -- (-762.303) [-761.362] (-760.134) (-759.195) * (-761.577) [-760.199] (-761.303) (-763.268) -- 0:00:57 149000 -- [-763.096] (-760.498) (-759.587) (-762.211) * (-761.112) (-760.701) [-759.484] (-762.595) -- 0:00:57 149500 -- (-760.281) (-761.417) (-769.316) [-760.297] * [-763.500] (-766.104) (-761.674) (-763.851) -- 0:00:56 150000 -- (-765.094) (-760.635) [-760.081] (-762.790) * (-759.581) (-763.392) (-761.970) [-759.984] -- 0:00:56 Average standard deviation of split frequencies: 0.018616 150500 -- (-760.224) (-759.582) [-762.246] (-759.756) * (-759.118) (-762.530) [-761.576] (-759.577) -- 0:00:56 151000 -- (-762.673) (-765.172) (-760.155) [-758.680] * (-765.148) [-760.322] (-760.923) (-763.398) -- 0:00:56 151500 -- (-761.823) (-760.509) (-760.334) [-758.255] * (-760.112) (-760.152) (-760.090) [-760.722] -- 0:00:56 152000 -- (-762.643) [-759.581] (-761.387) (-760.480) * (-763.288) (-761.427) (-759.921) [-761.575] -- 0:00:55 152500 -- (-760.505) [-761.853] (-761.466) (-767.725) * (-763.027) (-760.228) [-759.248] (-760.568) -- 0:00:55 153000 -- (-760.333) (-760.989) (-760.251) [-761.920] * [-760.425] (-761.073) (-760.215) (-759.493) -- 0:00:55 153500 -- (-764.253) (-760.422) [-761.125] (-760.208) * (-761.220) (-763.567) (-762.416) [-758.662] -- 0:00:55 154000 -- (-761.893) (-760.766) [-759.916] (-761.650) * (-760.614) (-759.492) [-759.710] (-759.760) -- 0:00:54 154500 -- (-760.490) [-760.879] (-761.204) (-757.137) * (-760.654) [-762.727] (-763.079) (-760.287) -- 0:00:54 155000 -- (-762.616) (-760.512) [-762.312] (-761.447) * (-760.782) [-758.494] (-759.049) (-760.605) -- 0:00:54 Average standard deviation of split frequencies: 0.017829 155500 -- [-760.218] (-764.933) (-758.018) (-758.419) * (-763.278) [-760.015] (-763.609) (-761.313) -- 0:00:54 156000 -- (-759.643) [-763.170] (-763.608) (-759.405) * (-762.026) (-762.475) (-770.090) [-760.284] -- 0:00:54 156500 -- (-764.136) (-761.363) (-760.993) [-760.445] * (-761.863) [-759.022] (-761.078) (-760.560) -- 0:00:53 157000 -- (-762.434) [-756.776] (-759.675) (-759.371) * (-764.339) (-759.052) (-758.426) [-759.201] -- 0:00:53 157500 -- (-761.456) (-759.839) (-760.004) [-759.478] * (-764.910) [-759.638] (-759.542) (-759.307) -- 0:00:53 158000 -- (-757.989) [-759.978] (-759.106) (-761.783) * (-763.207) (-759.106) [-758.842] (-761.472) -- 0:00:53 158500 -- (-761.006) [-757.660] (-762.935) (-757.921) * [-761.279] (-762.411) (-760.174) (-762.997) -- 0:00:53 159000 -- (-760.814) (-758.270) [-760.252] (-757.695) * [-760.018] (-759.858) (-759.767) (-767.990) -- 0:00:52 159500 -- (-761.618) (-761.071) [-760.174] (-760.983) * (-760.003) [-761.721] (-761.289) (-757.811) -- 0:00:52 160000 -- (-764.273) (-761.235) (-759.155) [-759.656] * [-757.517] (-760.133) (-760.475) (-759.300) -- 0:00:52 Average standard deviation of split frequencies: 0.017604 160500 -- (-763.324) (-761.970) (-759.973) [-760.420] * (-759.279) [-761.804] (-762.847) (-759.535) -- 0:00:52 161000 -- [-759.397] (-760.412) (-759.169) (-761.897) * (-764.239) (-760.742) (-762.199) [-759.299] -- 0:00:52 161500 -- (-759.103) (-763.394) (-760.986) [-761.907] * (-760.125) (-761.399) [-760.613] (-762.949) -- 0:00:51 162000 -- (-760.704) (-761.374) [-757.887] (-760.021) * [-760.690] (-760.486) (-758.659) (-762.136) -- 0:00:51 162500 -- (-760.416) [-760.509] (-761.271) (-759.980) * (-766.227) (-766.469) [-765.511] (-760.166) -- 0:00:51 163000 -- (-760.853) (-765.074) [-761.111] (-762.752) * (-762.574) (-765.334) [-760.483] (-758.990) -- 0:00:51 163500 -- (-759.588) [-762.901] (-761.883) (-760.478) * (-758.973) [-760.405] (-758.278) (-759.247) -- 0:00:56 164000 -- (-760.032) (-762.694) [-759.738] (-760.669) * [-763.412] (-762.762) (-760.197) (-759.208) -- 0:00:56 164500 -- (-763.601) (-763.305) [-762.672] (-759.637) * (-760.042) (-761.000) [-760.286] (-759.236) -- 0:00:55 165000 -- (-759.143) [-761.291] (-762.084) (-760.769) * (-758.997) (-760.834) [-761.322] (-758.286) -- 0:00:55 Average standard deviation of split frequencies: 0.016881 165500 -- (-759.655) (-760.970) [-757.671] (-760.851) * (-762.800) (-760.820) [-761.516] (-759.624) -- 0:00:55 166000 -- (-764.764) (-759.859) [-759.588] (-761.702) * [-762.670] (-766.279) (-760.071) (-762.286) -- 0:00:55 166500 -- [-758.009] (-759.934) (-764.836) (-758.878) * (-759.238) [-763.403] (-758.515) (-760.589) -- 0:00:55 167000 -- (-763.940) (-763.310) (-760.787) [-758.847] * (-760.391) (-760.762) (-760.824) [-759.221] -- 0:00:54 167500 -- (-759.507) (-763.173) (-760.789) [-759.319] * (-760.866) (-760.669) (-759.528) [-759.570] -- 0:00:54 168000 -- [-758.162] (-764.789) (-760.863) (-760.913) * (-761.086) (-760.913) (-761.215) [-763.874] -- 0:00:54 168500 -- (-759.311) (-760.866) [-763.740] (-758.923) * (-764.599) (-760.361) (-764.298) [-758.267] -- 0:00:54 169000 -- (-761.128) (-764.034) [-760.416] (-759.187) * (-761.126) [-761.759] (-761.204) (-761.309) -- 0:00:54 169500 -- (-762.573) (-761.839) (-762.241) [-758.225] * (-759.645) (-761.857) (-762.012) [-760.585] -- 0:00:53 170000 -- (-761.392) [-763.018] (-760.554) (-760.879) * (-759.547) (-760.886) (-762.413) [-763.600] -- 0:00:53 Average standard deviation of split frequencies: 0.016266 170500 -- (-759.725) [-763.177] (-763.361) (-760.572) * (-761.860) [-760.045] (-763.190) (-758.812) -- 0:00:53 171000 -- (-760.966) (-763.154) (-762.563) [-759.032] * (-761.405) (-760.911) (-762.920) [-758.421] -- 0:00:53 171500 -- [-760.998] (-761.112) (-759.229) (-759.813) * (-761.680) (-767.820) (-761.618) [-759.929] -- 0:00:53 172000 -- (-762.069) (-760.268) [-760.152] (-768.347) * (-759.649) (-761.917) (-758.680) [-760.507] -- 0:00:52 172500 -- [-759.433] (-760.168) (-760.791) (-761.643) * (-760.476) (-761.542) [-758.217] (-761.116) -- 0:00:52 173000 -- (-758.029) [-760.344] (-761.086) (-760.254) * (-761.311) (-764.687) (-759.963) [-762.105] -- 0:00:52 173500 -- (-757.976) [-761.965] (-759.012) (-758.402) * [-763.908] (-760.540) (-763.416) (-762.534) -- 0:00:52 174000 -- (-758.005) [-763.128] (-763.794) (-760.469) * (-766.342) (-761.249) (-758.338) [-759.093] -- 0:00:52 174500 -- (-760.797) (-759.363) (-763.186) [-762.100] * (-761.967) (-760.353) [-759.874] (-761.078) -- 0:00:52 175000 -- [-760.359] (-760.494) (-761.481) (-762.155) * (-759.781) (-761.514) (-765.544) [-758.605] -- 0:00:51 Average standard deviation of split frequencies: 0.016071 175500 -- (-760.164) (-762.793) [-758.904] (-760.351) * [-764.304] (-759.316) (-763.913) (-762.316) -- 0:00:51 176000 -- (-762.342) (-763.336) [-762.726] (-760.181) * (-761.726) (-759.933) (-763.747) [-759.974] -- 0:00:51 176500 -- (-761.971) (-760.951) (-759.484) [-759.057] * [-760.830] (-761.684) (-760.098) (-757.958) -- 0:00:51 177000 -- (-763.900) (-759.550) (-763.403) [-757.764] * (-760.171) (-761.910) (-759.891) [-757.725] -- 0:00:51 177500 -- (-763.754) (-762.565) (-763.330) [-759.394] * (-760.185) (-758.895) (-760.942) [-762.932] -- 0:00:50 178000 -- (-760.968) [-761.000] (-762.379) (-759.035) * (-762.004) (-760.566) [-760.024] (-763.004) -- 0:00:50 178500 -- [-761.621] (-758.245) (-765.339) (-759.254) * (-759.003) [-761.324] (-761.454) (-761.582) -- 0:00:50 179000 -- (-759.641) [-761.400] (-762.992) (-759.688) * (-760.584) (-759.121) [-759.528] (-761.130) -- 0:00:55 179500 -- (-758.287) (-760.153) [-759.673] (-765.167) * (-758.027) (-759.146) [-760.514] (-759.177) -- 0:00:54 180000 -- (-761.223) (-761.819) [-758.327] (-759.123) * (-764.795) (-761.633) (-763.687) [-761.568] -- 0:00:54 Average standard deviation of split frequencies: 0.015076 180500 -- (-762.878) (-759.750) [-761.066] (-758.378) * (-761.757) [-759.904] (-763.995) (-760.681) -- 0:00:54 181000 -- (-765.058) (-762.636) [-761.768] (-762.335) * (-760.643) (-761.749) (-760.725) [-759.954] -- 0:00:54 181500 -- (-761.836) [-761.042] (-760.822) (-758.275) * [-762.135] (-761.989) (-760.579) (-759.731) -- 0:00:54 182000 -- (-760.627) (-763.980) (-760.323) [-760.644] * (-761.332) (-762.551) (-762.245) [-758.304] -- 0:00:53 182500 -- (-761.263) (-762.461) (-761.445) [-760.079] * (-760.603) [-761.325] (-760.549) (-759.352) -- 0:00:53 183000 -- (-760.597) (-762.934) [-762.582] (-757.081) * (-762.417) (-765.356) [-760.913] (-760.943) -- 0:00:53 183500 -- [-760.448] (-763.255) (-763.078) (-759.429) * (-761.668) (-763.452) [-763.543] (-759.502) -- 0:00:53 184000 -- (-763.549) (-762.341) [-759.044] (-759.749) * (-764.237) [-760.930] (-762.661) (-761.748) -- 0:00:53 184500 -- (-760.965) [-762.047] (-758.436) (-758.006) * (-761.702) (-759.845) (-759.386) [-761.560] -- 0:00:53 185000 -- (-762.569) (-763.672) [-760.887] (-760.819) * [-757.907] (-760.029) (-762.907) (-763.796) -- 0:00:52 Average standard deviation of split frequencies: 0.014273 185500 -- (-760.358) [-760.746] (-761.626) (-760.419) * (-759.712) (-762.515) [-761.987] (-762.547) -- 0:00:52 186000 -- (-761.956) [-762.198] (-760.173) (-759.780) * (-764.041) (-762.662) [-761.624] (-764.797) -- 0:00:52 186500 -- [-760.561] (-761.437) (-759.004) (-758.609) * (-760.869) (-759.221) (-759.056) [-758.389] -- 0:00:52 187000 -- (-760.642) (-761.168) [-759.123] (-761.379) * [-758.937] (-761.646) (-763.779) (-761.080) -- 0:00:52 187500 -- (-764.091) (-763.084) [-758.889] (-759.303) * (-758.352) (-760.738) (-758.139) [-759.783] -- 0:00:52 188000 -- (-761.569) (-767.916) [-762.877] (-759.971) * (-758.617) (-760.565) [-761.845] (-762.314) -- 0:00:51 188500 -- (-764.743) (-759.178) (-760.254) [-757.701] * [-758.782] (-759.164) (-758.545) (-763.139) -- 0:00:51 189000 -- [-758.978] (-763.242) (-762.070) (-758.028) * [-758.260] (-761.549) (-759.729) (-760.486) -- 0:00:51 189500 -- [-759.217] (-765.026) (-763.374) (-760.890) * [-763.533] (-760.273) (-761.630) (-763.678) -- 0:00:51 190000 -- [-761.077] (-763.846) (-759.278) (-757.853) * [-761.181] (-759.389) (-760.830) (-762.931) -- 0:00:51 Average standard deviation of split frequencies: 0.012798 190500 -- (-758.755) [-762.291] (-762.898) (-759.010) * [-759.360] (-758.613) (-760.570) (-761.850) -- 0:00:50 191000 -- [-761.146] (-761.085) (-763.010) (-761.147) * (-760.583) (-758.532) [-759.763] (-759.672) -- 0:00:50 191500 -- (-759.214) (-760.254) (-760.030) [-758.604] * (-759.917) (-759.893) (-760.348) [-763.340] -- 0:00:50 192000 -- (-761.123) [-760.709] (-759.608) (-758.885) * (-759.288) (-763.099) [-760.780] (-758.914) -- 0:00:50 192500 -- [-761.463] (-760.610) (-759.243) (-757.965) * (-758.097) (-759.010) [-761.146] (-758.733) -- 0:00:50 193000 -- (-757.839) (-762.430) (-758.548) [-759.975] * [-760.564] (-759.498) (-760.025) (-759.659) -- 0:00:50 193500 -- (-761.134) [-759.849] (-758.366) (-762.025) * (-761.623) (-759.201) (-761.616) [-761.247] -- 0:00:50 194000 -- (-762.556) (-762.270) [-758.991] (-759.927) * (-758.554) [-758.839] (-763.707) (-758.698) -- 0:00:49 194500 -- (-761.966) (-761.446) (-758.300) [-760.131] * (-762.715) (-758.086) [-758.477] (-761.899) -- 0:00:49 195000 -- [-760.270] (-761.067) (-760.374) (-759.414) * (-759.921) (-761.424) (-758.193) [-760.811] -- 0:00:53 Average standard deviation of split frequencies: 0.013469 195500 -- (-760.048) (-761.321) [-760.476] (-760.880) * [-759.320] (-762.139) (-761.896) (-764.533) -- 0:00:53 196000 -- (-761.330) [-760.906] (-761.100) (-761.387) * (-761.543) (-758.578) [-760.968] (-758.471) -- 0:00:53 196500 -- [-761.775] (-763.475) (-759.267) (-761.459) * (-761.178) (-762.119) [-757.128] (-759.364) -- 0:00:53 197000 -- [-762.617] (-762.887) (-763.113) (-762.198) * (-757.276) (-764.014) (-758.379) [-760.269] -- 0:00:52 197500 -- (-762.049) (-761.143) (-761.970) [-759.548] * [-761.146] (-760.607) (-759.155) (-762.975) -- 0:00:52 198000 -- (-762.041) (-762.541) (-759.900) [-761.918] * [-762.243] (-760.936) (-759.347) (-757.787) -- 0:00:52 198500 -- [-760.893] (-764.164) (-759.461) (-764.324) * (-759.635) (-762.287) (-759.664) [-763.455] -- 0:00:52 199000 -- (-760.644) (-760.423) [-759.215] (-760.124) * (-761.934) (-764.722) (-758.519) [-760.145] -- 0:00:52 199500 -- [-761.972] (-759.050) (-766.350) (-762.515) * [-761.083] (-762.059) (-759.767) (-760.981) -- 0:00:52 200000 -- (-764.752) (-762.290) (-762.716) [-760.805] * [-759.441] (-760.586) (-760.274) (-762.260) -- 0:00:51 Average standard deviation of split frequencies: 0.012982 200500 -- (-766.328) (-761.126) (-761.828) [-762.174] * [-759.977] (-763.317) (-762.468) (-760.050) -- 0:00:51 201000 -- (-763.505) [-760.329] (-762.262) (-760.101) * (-761.074) [-761.321] (-764.457) (-760.080) -- 0:00:51 201500 -- (-761.146) [-761.563] (-761.673) (-758.597) * (-761.777) (-759.571) [-760.246] (-765.135) -- 0:00:51 202000 -- (-760.516) [-759.212] (-761.610) (-761.819) * (-762.076) (-760.609) [-761.858] (-760.777) -- 0:00:51 202500 -- [-760.208] (-760.593) (-760.981) (-760.530) * (-767.020) [-764.226] (-760.682) (-760.477) -- 0:00:51 203000 -- (-758.517) (-761.343) (-760.697) [-761.169] * (-763.288) [-758.505] (-760.423) (-763.420) -- 0:00:51 203500 -- (-762.534) (-762.944) [-758.731] (-764.558) * [-760.907] (-760.495) (-760.476) (-762.061) -- 0:00:50 204000 -- (-763.474) (-759.825) (-761.267) [-762.971] * (-759.494) (-759.668) (-758.648) [-759.169] -- 0:00:50 204500 -- [-763.686] (-762.749) (-763.290) (-764.745) * (-760.293) [-761.092] (-758.946) (-760.674) -- 0:00:50 205000 -- (-760.837) (-764.915) [-762.029] (-760.672) * (-759.375) [-759.485] (-757.937) (-763.113) -- 0:00:50 Average standard deviation of split frequencies: 0.012967 205500 -- (-760.098) [-759.007] (-762.630) (-762.251) * (-762.439) [-761.495] (-766.524) (-761.025) -- 0:00:50 206000 -- [-759.077] (-760.643) (-761.492) (-760.538) * [-757.337] (-760.796) (-761.647) (-760.031) -- 0:00:50 206500 -- [-760.716] (-759.237) (-759.112) (-760.473) * (-759.238) (-766.907) [-760.145] (-761.808) -- 0:00:49 207000 -- (-761.290) [-762.856] (-760.516) (-760.289) * (-760.467) (-760.744) [-759.667] (-761.558) -- 0:00:49 207500 -- (-759.950) (-762.899) [-758.999] (-760.883) * (-758.467) [-760.484] (-758.742) (-762.444) -- 0:00:49 208000 -- [-758.713] (-761.048) (-762.507) (-757.496) * [-759.320] (-759.468) (-761.491) (-763.902) -- 0:00:49 208500 -- (-760.511) [-761.849] (-761.111) (-765.410) * (-764.672) (-760.575) (-765.014) [-765.398] -- 0:00:49 209000 -- (-761.034) (-760.282) (-760.845) [-760.479] * (-761.535) (-766.135) (-762.040) [-759.555] -- 0:00:49 209500 -- (-759.262) (-761.609) [-756.398] (-760.657) * (-759.763) [-758.852] (-761.369) (-760.410) -- 0:00:49 210000 -- (-762.966) (-760.582) [-757.731] (-759.254) * (-759.849) (-758.756) (-759.555) [-760.553] -- 0:00:48 Average standard deviation of split frequencies: 0.012366 210500 -- (-764.646) [-759.337] (-758.714) (-760.208) * [-759.217] (-762.836) (-759.535) (-762.247) -- 0:00:52 211000 -- [-758.409] (-759.359) (-758.751) (-766.618) * (-765.400) [-759.841] (-760.096) (-760.559) -- 0:00:52 211500 -- [-761.595] (-758.211) (-760.388) (-762.254) * (-763.746) [-760.164] (-759.708) (-759.975) -- 0:00:52 212000 -- (-758.145) (-759.657) [-760.547] (-760.436) * (-761.587) [-761.437] (-759.602) (-760.448) -- 0:00:52 212500 -- (-761.054) [-758.250] (-759.901) (-759.037) * (-764.053) [-757.508] (-759.256) (-759.828) -- 0:00:51 213000 -- (-758.910) [-761.543] (-761.816) (-759.519) * (-759.066) (-757.538) [-761.385] (-762.092) -- 0:00:51 213500 -- (-761.516) (-760.928) [-759.402] (-759.545) * (-759.979) [-758.071] (-760.842) (-761.270) -- 0:00:51 214000 -- (-760.964) (-761.744) (-760.023) [-759.458] * (-761.407) (-765.474) (-763.777) [-759.877] -- 0:00:51 214500 -- [-761.456] (-761.253) (-758.717) (-762.508) * (-762.725) [-761.197] (-761.628) (-760.818) -- 0:00:51 215000 -- [-761.548] (-760.916) (-759.371) (-759.649) * (-763.861) (-760.459) [-760.838] (-758.559) -- 0:00:51 Average standard deviation of split frequencies: 0.010655 215500 -- (-761.448) [-760.196] (-758.753) (-763.136) * (-764.926) [-759.449] (-764.346) (-762.795) -- 0:00:50 216000 -- (-761.127) (-761.441) (-761.448) [-761.845] * (-762.229) (-759.279) [-761.214] (-761.474) -- 0:00:50 216500 -- (-758.627) (-760.668) (-760.911) [-758.084] * (-760.506) (-759.678) (-765.360) [-759.065] -- 0:00:50 217000 -- [-761.651] (-760.505) (-762.336) (-760.117) * (-762.892) [-760.503] (-764.358) (-759.434) -- 0:00:50 217500 -- (-758.649) (-762.089) [-760.245] (-758.653) * (-761.625) [-760.509] (-759.631) (-760.905) -- 0:00:50 218000 -- (-760.382) (-758.432) [-760.406] (-759.496) * (-761.604) (-761.720) (-761.577) [-760.917] -- 0:00:50 218500 -- (-759.038) (-764.562) (-759.003) [-759.704] * [-763.907] (-760.434) (-763.869) (-759.153) -- 0:00:50 219000 -- (-762.819) (-761.060) (-759.340) [-759.702] * (-760.404) [-759.676] (-765.822) (-762.172) -- 0:00:49 219500 -- (-759.518) (-760.845) [-759.681] (-760.929) * (-761.885) (-759.804) [-759.521] (-762.012) -- 0:00:49 220000 -- (-768.349) [-758.608] (-759.412) (-760.805) * (-760.583) (-759.923) (-762.016) [-760.296] -- 0:00:49 Average standard deviation of split frequencies: 0.010304 220500 -- (-761.705) [-762.126] (-760.386) (-763.080) * [-760.131] (-758.595) (-762.392) (-761.629) -- 0:00:49 221000 -- (-764.936) [-762.312] (-761.649) (-761.995) * (-762.828) (-763.758) [-760.588] (-763.332) -- 0:00:49 221500 -- (-767.509) (-761.575) (-762.059) [-759.663] * (-760.082) (-760.819) (-759.762) [-759.183] -- 0:00:49 222000 -- [-760.226] (-760.418) (-761.690) (-760.608) * (-763.245) [-760.610] (-757.880) (-760.960) -- 0:00:49 222500 -- [-761.527] (-759.334) (-759.053) (-758.924) * (-760.711) (-761.256) [-760.889] (-761.027) -- 0:00:48 223000 -- [-761.011] (-762.030) (-760.715) (-758.036) * (-763.108) (-759.219) (-761.405) [-758.978] -- 0:00:48 223500 -- (-763.726) (-761.123) (-762.778) [-757.747] * (-760.225) (-758.994) (-761.564) [-760.165] -- 0:00:48 224000 -- [-758.761] (-760.279) (-761.058) (-761.210) * [-760.128] (-761.749) (-763.307) (-762.208) -- 0:00:48 224500 -- (-761.930) [-759.395] (-762.589) (-761.378) * (-761.570) (-761.841) [-759.005] (-761.101) -- 0:00:48 225000 -- (-765.412) (-759.601) (-762.676) [-759.866] * [-760.136] (-761.514) (-759.983) (-760.840) -- 0:00:48 Average standard deviation of split frequencies: 0.012863 225500 -- (-759.099) [-758.481] (-760.522) (-758.826) * (-760.683) (-759.964) (-763.344) [-759.830] -- 0:00:51 226000 -- (-759.814) [-757.432] (-769.147) (-759.295) * (-763.657) [-765.538] (-760.878) (-766.723) -- 0:00:51 226500 -- (-767.423) [-758.001] (-759.352) (-757.094) * (-761.634) (-762.884) (-760.723) [-759.689] -- 0:00:51 227000 -- (-760.361) [-758.225] (-759.689) (-758.243) * (-762.300) (-762.526) [-760.688] (-763.527) -- 0:00:51 227500 -- (-760.974) (-760.609) (-759.946) [-760.466] * (-758.743) (-761.130) (-761.002) [-760.233] -- 0:00:50 228000 -- [-760.597] (-760.617) (-760.973) (-758.138) * (-761.873) (-763.944) [-760.273] (-763.183) -- 0:00:50 228500 -- [-764.238] (-759.318) (-760.109) (-760.479) * (-767.005) (-760.213) [-763.276] (-759.570) -- 0:00:50 229000 -- [-759.387] (-760.863) (-760.690) (-768.865) * (-762.270) (-758.296) [-760.280] (-760.299) -- 0:00:50 229500 -- (-760.262) (-760.686) (-759.788) [-761.352] * (-761.515) [-759.684] (-759.668) (-760.436) -- 0:00:50 230000 -- (-761.227) [-759.610] (-760.971) (-765.444) * (-765.595) [-758.154] (-761.344) (-760.833) -- 0:00:50 Average standard deviation of split frequencies: 0.011541 230500 -- [-758.920] (-759.600) (-760.478) (-758.924) * (-760.057) (-759.717) [-759.333] (-761.395) -- 0:00:50 231000 -- (-759.514) (-759.544) (-761.481) [-760.934] * (-762.309) (-759.520) (-759.904) [-759.823] -- 0:00:49 231500 -- [-760.055] (-760.439) (-759.843) (-761.277) * (-761.916) (-760.929) (-763.354) [-759.227] -- 0:00:49 232000 -- (-760.253) [-757.078] (-760.661) (-763.880) * (-759.936) (-761.991) (-763.593) [-760.371] -- 0:00:49 232500 -- (-760.322) [-760.326] (-762.282) (-759.451) * (-759.237) [-760.871] (-761.714) (-765.548) -- 0:00:49 233000 -- (-759.697) (-759.308) (-761.981) [-759.020] * (-760.058) (-760.958) [-758.402] (-759.993) -- 0:00:49 233500 -- [-760.115] (-760.690) (-762.648) (-760.487) * [-760.459] (-761.247) (-759.978) (-760.085) -- 0:00:49 234000 -- (-770.113) (-760.435) (-762.344) [-763.267] * (-762.658) [-762.111] (-761.734) (-759.335) -- 0:00:49 234500 -- (-769.187) (-760.502) (-763.351) [-760.503] * (-766.317) [-760.434] (-765.007) (-758.281) -- 0:00:48 235000 -- (-761.880) (-761.813) (-764.228) [-761.993] * (-763.826) [-763.580] (-764.933) (-759.668) -- 0:00:48 Average standard deviation of split frequencies: 0.012455 235500 -- (-759.505) (-760.903) [-763.784] (-759.449) * (-758.785) (-758.239) (-765.817) [-759.459] -- 0:00:48 236000 -- (-761.073) (-761.621) [-760.826] (-761.478) * [-759.522] (-760.858) (-760.174) (-759.333) -- 0:00:48 236500 -- (-766.780) (-765.031) (-759.166) [-759.539] * (-761.439) (-761.502) (-760.442) [-756.897] -- 0:00:48 237000 -- (-760.619) (-763.167) (-759.416) [-762.153] * (-762.441) [-760.601] (-759.761) (-756.989) -- 0:00:48 237500 -- (-758.403) (-764.557) [-760.280] (-760.184) * [-759.581] (-759.964) (-757.713) (-761.576) -- 0:00:48 238000 -- (-760.282) (-762.114) (-762.206) [-761.987] * (-760.421) (-760.063) (-760.813) [-759.676] -- 0:00:48 238500 -- (-761.145) [-760.544] (-761.369) (-759.395) * (-764.527) (-762.679) [-758.063] (-758.655) -- 0:00:47 239000 -- (-761.206) (-761.105) (-758.341) [-761.483] * [-758.958] (-761.736) (-763.677) (-761.388) -- 0:00:47 239500 -- (-761.303) (-763.703) (-758.854) [-760.237] * (-762.740) (-765.604) (-760.710) [-764.102] -- 0:00:47 240000 -- (-760.775) (-761.757) [-761.886] (-757.641) * [-759.277] (-760.836) (-761.200) (-759.337) -- 0:00:47 Average standard deviation of split frequencies: 0.013366 240500 -- [-761.237] (-762.738) (-759.139) (-760.738) * [-759.197] (-759.512) (-759.508) (-760.738) -- 0:00:47 241000 -- [-760.786] (-764.437) (-759.946) (-759.552) * (-757.995) (-763.470) (-759.686) [-757.493] -- 0:00:47 241500 -- (-760.586) (-760.526) (-764.766) [-758.159] * [-760.362] (-759.691) (-760.768) (-757.951) -- 0:00:50 242000 -- (-759.852) [-759.752] (-767.330) (-761.113) * (-762.565) [-759.154] (-761.202) (-760.707) -- 0:00:50 242500 -- (-760.586) (-760.380) (-764.169) [-760.402] * (-761.034) (-760.501) (-760.196) [-757.456] -- 0:00:49 243000 -- (-762.552) [-759.224] (-761.879) (-758.333) * [-757.643] (-759.401) (-761.869) (-758.687) -- 0:00:49 243500 -- (-761.345) [-760.224] (-761.024) (-761.891) * [-759.195] (-757.722) (-762.520) (-763.191) -- 0:00:49 244000 -- [-761.304] (-759.176) (-759.710) (-762.281) * [-757.832] (-761.194) (-762.049) (-757.844) -- 0:00:49 244500 -- (-760.805) (-760.626) [-758.623] (-759.168) * (-761.572) (-761.355) [-759.742] (-758.672) -- 0:00:49 245000 -- [-763.793] (-761.081) (-760.102) (-760.882) * (-759.538) [-760.137] (-762.521) (-758.937) -- 0:00:49 Average standard deviation of split frequencies: 0.014053 245500 -- (-765.426) (-762.547) (-763.323) [-761.101] * [-760.213] (-757.755) (-761.978) (-759.190) -- 0:00:49 246000 -- (-763.225) (-762.924) (-763.516) [-760.683] * (-763.929) [-759.295] (-761.064) (-760.293) -- 0:00:49 246500 -- (-762.539) (-760.532) (-761.270) [-760.865] * [-764.013] (-762.730) (-759.726) (-759.998) -- 0:00:48 247000 -- (-761.127) (-761.968) [-759.630] (-760.603) * [-757.785] (-763.421) (-761.177) (-764.002) -- 0:00:48 247500 -- [-761.406] (-764.685) (-759.623) (-764.354) * [-763.375] (-761.667) (-761.177) (-766.588) -- 0:00:48 248000 -- [-765.461] (-766.081) (-760.014) (-761.764) * (-759.150) [-762.770] (-760.980) (-764.465) -- 0:00:48 248500 -- (-762.410) [-762.240] (-760.529) (-761.823) * (-759.349) (-763.138) (-759.891) [-761.177] -- 0:00:48 249000 -- (-760.894) (-762.562) (-759.463) [-764.300] * (-759.975) (-759.230) [-760.700] (-761.573) -- 0:00:48 249500 -- (-760.577) [-761.704] (-759.199) (-762.257) * [-759.399] (-759.912) (-764.084) (-759.921) -- 0:00:48 250000 -- [-758.130] (-763.735) (-758.359) (-762.699) * (-759.748) (-762.025) [-759.316] (-760.740) -- 0:00:48 Average standard deviation of split frequencies: 0.014550 250500 -- (-759.964) [-760.391] (-761.499) (-762.830) * (-758.873) [-757.157] (-759.409) (-759.179) -- 0:00:47 251000 -- [-761.121] (-761.513) (-762.056) (-762.855) * (-758.570) [-760.235] (-759.630) (-765.828) -- 0:00:47 251500 -- (-761.158) (-762.404) [-760.201] (-763.996) * [-758.743] (-760.137) (-759.883) (-763.500) -- 0:00:47 252000 -- (-759.133) (-761.173) (-761.936) [-763.071] * [-761.048] (-761.932) (-764.425) (-763.200) -- 0:00:47 252500 -- (-759.998) (-759.974) [-757.322] (-760.698) * [-760.083] (-760.714) (-763.249) (-761.660) -- 0:00:47 253000 -- [-761.624] (-758.553) (-758.872) (-759.179) * [-758.506] (-760.087) (-762.915) (-760.690) -- 0:00:47 253500 -- [-763.120] (-761.506) (-763.486) (-761.839) * (-759.900) [-758.405] (-759.418) (-761.256) -- 0:00:50 254000 -- (-761.483) (-760.145) (-759.584) [-759.980] * (-760.735) [-759.259] (-761.683) (-760.237) -- 0:00:49 254500 -- [-760.583] (-762.149) (-759.932) (-760.782) * (-766.160) [-758.182] (-764.822) (-765.318) -- 0:00:49 255000 -- [-758.899] (-762.483) (-761.185) (-759.223) * (-761.438) (-760.106) [-762.287] (-764.101) -- 0:00:49 Average standard deviation of split frequencies: 0.014629 255500 -- (-761.688) (-764.091) (-759.889) [-760.092] * (-758.883) (-760.479) (-760.603) [-762.629] -- 0:00:49 256000 -- [-758.768] (-761.142) (-764.363) (-763.256) * (-763.353) [-759.241] (-762.243) (-761.196) -- 0:00:49 256500 -- (-759.252) (-760.423) [-762.139] (-758.964) * (-761.353) (-760.058) (-763.760) [-760.172] -- 0:00:49 257000 -- (-759.915) [-761.169] (-760.568) (-762.508) * (-760.169) (-760.165) (-762.886) [-758.816] -- 0:00:49 257500 -- (-761.158) (-760.513) (-761.735) [-762.140] * (-760.149) [-761.041] (-760.865) (-765.862) -- 0:00:49 258000 -- [-758.676] (-760.675) (-761.450) (-760.230) * (-759.710) [-758.909] (-762.171) (-761.484) -- 0:00:48 258500 -- (-761.442) (-760.734) (-761.513) [-758.550] * [-758.631] (-758.908) (-759.572) (-762.756) -- 0:00:48 259000 -- (-762.755) [-762.550] (-762.108) (-760.997) * [-761.299] (-760.038) (-760.297) (-765.952) -- 0:00:48 259500 -- (-763.224) (-760.898) [-759.201] (-760.898) * (-761.001) [-758.275] (-759.786) (-758.356) -- 0:00:48 260000 -- (-763.162) [-762.194] (-759.749) (-762.671) * (-765.708) (-758.991) [-760.920] (-760.580) -- 0:00:48 Average standard deviation of split frequencies: 0.011808 260500 -- (-765.908) (-761.559) (-759.172) [-761.406] * [-761.513] (-758.555) (-761.301) (-764.872) -- 0:00:48 261000 -- (-760.429) [-759.760] (-758.164) (-764.274) * (-762.900) [-759.870] (-761.263) (-763.989) -- 0:00:48 261500 -- (-763.302) (-759.983) (-760.342) [-761.299] * (-760.275) [-760.779] (-764.079) (-761.213) -- 0:00:48 262000 -- (-762.632) (-763.372) [-759.729] (-764.638) * (-761.119) (-760.977) [-761.231] (-762.955) -- 0:00:47 262500 -- (-762.553) [-762.517] (-760.639) (-763.332) * (-759.987) [-760.170] (-761.666) (-762.002) -- 0:00:47 263000 -- (-763.544) (-763.918) (-763.447) [-761.260] * (-760.567) [-761.393] (-762.636) (-761.348) -- 0:00:47 263500 -- (-760.883) (-760.990) [-765.191] (-759.566) * [-760.146] (-763.375) (-761.533) (-761.339) -- 0:00:47 264000 -- (-760.131) (-764.201) [-761.456] (-760.291) * (-760.282) (-761.203) (-762.662) [-759.617] -- 0:00:47 264500 -- [-759.500] (-761.806) (-763.494) (-762.124) * (-758.937) [-762.277] (-766.753) (-760.239) -- 0:00:47 265000 -- [-759.252] (-763.059) (-762.757) (-760.026) * (-759.461) (-758.455) (-762.220) [-759.329] -- 0:00:47 Average standard deviation of split frequencies: 0.013431 265500 -- (-760.441) (-761.684) [-759.636] (-760.137) * (-759.372) [-758.332] (-763.125) (-760.101) -- 0:00:49 266000 -- [-761.517] (-762.422) (-765.807) (-762.321) * [-762.790] (-760.236) (-763.527) (-759.454) -- 0:00:49 266500 -- (-759.411) (-761.468) (-762.447) [-760.931] * (-762.057) (-761.092) [-764.863] (-761.063) -- 0:00:49 267000 -- (-759.127) (-759.161) [-762.279] (-760.684) * (-759.949) (-758.551) (-762.248) [-758.775] -- 0:00:49 267500 -- (-762.501) (-760.269) (-759.031) [-758.028] * [-761.261] (-764.518) (-762.836) (-762.069) -- 0:00:49 268000 -- (-761.081) [-760.085] (-760.834) (-760.905) * [-758.220] (-760.484) (-760.512) (-759.736) -- 0:00:49 268500 -- (-759.538) (-761.130) (-760.884) [-761.836] * [-757.558] (-762.876) (-761.636) (-758.802) -- 0:00:49 269000 -- (-759.795) (-760.235) (-763.402) [-760.792] * (-759.123) (-758.712) (-761.269) [-761.050] -- 0:00:48 269500 -- [-761.282] (-763.337) (-759.467) (-759.225) * (-767.349) [-758.732] (-759.666) (-761.425) -- 0:00:48 270000 -- (-759.991) (-763.177) (-760.890) [-759.609] * (-762.592) [-758.646] (-765.208) (-761.194) -- 0:00:48 Average standard deviation of split frequencies: 0.013108 270500 -- (-759.446) [-760.659] (-758.795) (-762.635) * (-759.273) [-760.546] (-759.224) (-763.117) -- 0:00:48 271000 -- (-759.063) (-759.116) [-759.162] (-759.999) * (-760.253) [-760.358] (-760.616) (-760.548) -- 0:00:48 271500 -- (-758.663) [-759.554] (-759.697) (-761.645) * (-763.332) (-759.307) [-760.389] (-762.358) -- 0:00:48 272000 -- (-760.778) [-760.271] (-763.325) (-758.375) * (-760.623) (-761.085) (-760.372) [-758.967] -- 0:00:48 272500 -- [-761.186] (-758.752) (-762.755) (-759.261) * (-758.573) (-763.309) [-759.635] (-761.567) -- 0:00:48 273000 -- (-759.820) [-761.160] (-760.581) (-762.760) * (-759.703) [-758.177] (-763.323) (-764.019) -- 0:00:47 273500 -- (-759.745) [-765.499] (-760.123) (-760.982) * (-761.636) (-763.659) [-759.577] (-759.090) -- 0:00:47 274000 -- (-760.610) (-759.907) (-758.989) [-763.590] * (-761.468) (-760.840) (-758.994) [-761.541] -- 0:00:47 274500 -- (-761.229) [-762.159] (-761.952) (-765.577) * (-758.224) (-758.702) [-760.230] (-759.200) -- 0:00:47 275000 -- (-763.136) (-762.830) (-762.301) [-759.417] * (-761.550) (-758.016) (-760.024) [-763.292] -- 0:00:47 Average standard deviation of split frequencies: 0.012525 275500 -- [-761.829] (-762.403) (-759.934) (-761.731) * (-760.922) [-763.465] (-758.978) (-761.804) -- 0:00:47 276000 -- (-763.881) (-760.710) [-760.494] (-760.824) * (-760.701) [-762.046] (-759.789) (-758.515) -- 0:00:47 276500 -- [-758.503] (-759.901) (-758.425) (-759.732) * (-760.580) (-761.200) (-756.819) [-759.829] -- 0:00:47 277000 -- (-760.868) (-760.400) [-759.565] (-762.688) * (-762.598) [-758.744] (-756.767) (-762.116) -- 0:00:46 277500 -- (-759.466) (-763.852) [-763.021] (-758.305) * [-759.674] (-759.360) (-761.895) (-760.648) -- 0:00:46 278000 -- [-757.712] (-760.152) (-760.061) (-764.136) * (-758.827) [-760.073] (-760.307) (-761.318) -- 0:00:46 278500 -- [-761.346] (-760.442) (-760.670) (-761.581) * (-758.948) (-763.770) [-757.475] (-761.004) -- 0:00:46 279000 -- [-759.944] (-761.105) (-761.487) (-760.459) * [-759.081] (-761.580) (-759.768) (-757.901) -- 0:00:46 279500 -- (-764.003) (-760.765) [-765.316] (-761.082) * (-760.017) (-759.861) (-758.443) [-759.682] -- 0:00:48 280000 -- (-760.078) (-761.166) (-761.230) [-760.178] * (-757.789) [-761.373] (-760.805) (-760.108) -- 0:00:48 Average standard deviation of split frequencies: 0.012784 280500 -- (-760.980) (-759.316) [-759.403] (-759.280) * (-757.758) [-759.980] (-760.043) (-761.520) -- 0:00:48 281000 -- (-762.394) (-762.294) [-759.851] (-759.085) * (-761.001) (-758.723) [-760.140] (-763.838) -- 0:00:48 281500 -- (-761.508) (-759.523) (-760.725) [-759.972] * (-765.322) (-761.854) (-761.758) [-760.206] -- 0:00:48 282000 -- (-762.823) [-760.191] (-765.091) (-758.934) * (-759.318) [-760.466] (-761.602) (-759.101) -- 0:00:48 282500 -- (-768.973) (-758.004) [-758.357] (-762.880) * [-759.424] (-761.796) (-761.045) (-763.383) -- 0:00:48 283000 -- (-767.643) (-761.986) (-757.333) [-761.984] * (-760.689) [-757.802] (-757.233) (-758.976) -- 0:00:48 283500 -- [-761.425] (-760.452) (-759.090) (-760.337) * (-761.206) [-759.417] (-761.795) (-758.567) -- 0:00:48 284000 -- (-760.190) (-760.490) [-758.749] (-760.142) * (-760.572) [-760.688] (-763.233) (-760.166) -- 0:00:47 284500 -- (-762.220) (-763.777) (-758.746) [-759.914] * (-761.377) (-761.074) (-761.169) [-758.845] -- 0:00:47 285000 -- (-762.683) (-761.555) (-760.168) [-758.084] * (-760.249) [-759.752] (-759.317) (-761.961) -- 0:00:47 Average standard deviation of split frequencies: 0.012666 285500 -- [-760.010] (-760.765) (-758.904) (-761.451) * (-759.176) (-759.755) (-759.027) [-760.824] -- 0:00:47 286000 -- (-759.343) [-760.866] (-760.567) (-763.275) * (-759.335) (-759.806) (-759.932) [-759.478] -- 0:00:47 286500 -- [-759.728] (-763.256) (-758.828) (-763.110) * (-759.847) (-759.521) [-759.632] (-758.827) -- 0:00:47 287000 -- (-759.947) (-765.041) (-758.501) [-763.634] * [-759.637] (-761.373) (-762.206) (-759.029) -- 0:00:47 287500 -- (-761.644) (-760.800) [-759.167] (-758.903) * (-761.189) (-761.276) (-760.220) [-756.501] -- 0:00:47 288000 -- [-760.845] (-761.897) (-764.381) (-758.583) * (-762.101) (-761.091) (-759.325) [-758.167] -- 0:00:46 288500 -- (-760.048) (-761.472) [-758.670] (-759.949) * (-760.238) [-759.493] (-760.794) (-762.475) -- 0:00:46 289000 -- (-760.921) (-760.810) (-761.950) [-757.235] * (-760.602) [-762.408] (-763.129) (-758.592) -- 0:00:46 289500 -- (-759.114) [-761.688] (-759.532) (-762.434) * [-760.157] (-759.728) (-760.481) (-759.845) -- 0:00:46 290000 -- (-759.736) (-761.268) [-759.225] (-764.257) * (-761.207) (-758.469) [-760.679] (-763.775) -- 0:00:46 Average standard deviation of split frequencies: 0.013948 290500 -- (-757.874) (-762.216) (-762.088) [-764.697] * (-760.100) (-760.020) [-764.042] (-759.633) -- 0:00:46 291000 -- (-759.273) [-762.360] (-758.679) (-764.190) * (-763.399) (-761.996) [-761.686] (-759.574) -- 0:00:46 291500 -- (-760.778) [-761.461] (-760.671) (-762.854) * (-758.833) [-760.636] (-764.422) (-758.395) -- 0:00:46 292000 -- (-760.186) (-764.614) [-758.472] (-760.608) * [-762.673] (-761.213) (-760.715) (-758.999) -- 0:00:46 292500 -- (-759.746) [-764.064] (-760.818) (-762.351) * (-760.598) (-761.840) (-761.937) [-758.696] -- 0:00:45 293000 -- [-759.998] (-758.866) (-763.300) (-759.839) * [-760.171] (-760.879) (-761.091) (-759.298) -- 0:00:45 293500 -- (-761.266) [-759.328] (-758.674) (-759.463) * (-761.303) (-760.855) (-758.139) [-759.646] -- 0:00:45 294000 -- [-760.119] (-760.187) (-764.715) (-758.630) * [-761.894] (-764.188) (-762.533) (-762.689) -- 0:00:48 294500 -- [-758.975] (-761.545) (-760.032) (-762.610) * (-760.126) (-761.508) [-760.163] (-762.039) -- 0:00:47 295000 -- [-758.836] (-759.937) (-758.681) (-764.937) * [-760.666] (-760.193) (-761.217) (-765.904) -- 0:00:47 Average standard deviation of split frequencies: 0.011325 295500 -- (-758.641) (-766.147) (-759.082) [-762.226] * (-761.804) (-760.070) [-760.983] (-764.345) -- 0:00:47 296000 -- (-758.648) (-759.668) (-759.329) [-758.427] * [-760.207] (-757.785) (-760.713) (-760.027) -- 0:00:47 296500 -- [-757.965] (-760.719) (-760.419) (-760.690) * (-760.801) (-757.520) [-761.005] (-760.034) -- 0:00:47 297000 -- [-760.428] (-761.148) (-758.294) (-759.035) * (-760.255) (-760.956) [-760.866] (-762.454) -- 0:00:47 297500 -- (-758.845) [-759.138] (-759.214) (-759.549) * (-761.403) (-760.259) [-759.505] (-765.848) -- 0:00:47 298000 -- (-761.794) (-761.639) [-759.845] (-758.267) * (-758.805) (-758.935) [-762.271] (-761.694) -- 0:00:47 298500 -- (-763.409) (-762.363) [-760.205] (-761.554) * (-761.438) [-760.113] (-760.683) (-760.069) -- 0:00:47 299000 -- (-761.786) (-758.721) (-763.552) [-763.757] * [-760.768] (-759.170) (-762.232) (-758.765) -- 0:00:46 299500 -- (-760.874) (-760.086) (-760.468) [-761.846] * (-760.559) (-759.016) [-760.030] (-760.412) -- 0:00:46 300000 -- [-763.053] (-759.975) (-767.301) (-762.289) * (-762.043) (-758.680) [-761.471] (-759.314) -- 0:00:46 Average standard deviation of split frequencies: 0.011323 300500 -- [-759.137] (-758.720) (-758.387) (-759.231) * [-758.088] (-759.236) (-759.330) (-760.475) -- 0:00:46 301000 -- (-760.156) [-759.472] (-759.901) (-760.833) * (-760.231) (-759.320) (-761.944) [-758.729] -- 0:00:46 301500 -- (-765.044) (-758.200) (-762.043) [-760.172] * [-758.861] (-759.718) (-761.431) (-759.617) -- 0:00:46 302000 -- (-762.288) (-762.269) [-760.210] (-761.640) * (-758.818) (-758.486) [-760.259] (-761.543) -- 0:00:46 302500 -- (-758.754) [-761.663] (-764.834) (-764.901) * (-760.803) (-760.019) [-760.618] (-758.892) -- 0:00:46 303000 -- (-762.657) (-760.704) [-763.301] (-768.360) * (-762.170) [-758.859] (-760.099) (-761.851) -- 0:00:46 303500 -- (-762.688) [-760.898] (-763.571) (-759.884) * (-759.577) (-762.713) (-759.659) [-759.809] -- 0:00:45 304000 -- (-762.125) [-760.404] (-762.426) (-762.871) * (-761.252) (-760.895) [-761.712] (-758.111) -- 0:00:45 304500 -- (-760.332) (-762.760) (-761.704) [-761.392] * (-760.109) [-760.888] (-761.728) (-762.730) -- 0:00:45 305000 -- [-758.540] (-760.959) (-760.264) (-761.288) * (-760.366) [-760.710] (-760.851) (-763.775) -- 0:00:45 Average standard deviation of split frequencies: 0.010955 305500 -- [-761.698] (-761.190) (-759.304) (-763.041) * (-760.874) [-763.735] (-759.640) (-765.356) -- 0:00:45 306000 -- (-760.589) (-761.043) [-762.260] (-759.538) * (-760.367) (-760.363) (-762.401) [-762.344] -- 0:00:45 306500 -- (-761.294) [-758.166] (-761.812) (-764.530) * (-765.665) (-763.723) (-760.647) [-758.495] -- 0:00:45 307000 -- [-762.333] (-760.475) (-760.412) (-765.295) * [-763.521] (-761.146) (-760.090) (-758.516) -- 0:00:45 307500 -- (-760.400) (-761.227) [-760.602] (-759.905) * (-761.305) (-759.394) [-761.131] (-759.124) -- 0:00:45 308000 -- (-760.295) [-759.807] (-759.696) (-759.912) * (-759.861) (-765.843) (-761.072) [-757.167] -- 0:00:44 308500 -- (-760.066) (-764.411) [-765.817] (-760.523) * [-760.576] (-760.737) (-761.115) (-762.238) -- 0:00:44 309000 -- (-763.292) [-760.762] (-761.890) (-761.071) * [-759.475] (-761.069) (-760.781) (-759.901) -- 0:00:46 309500 -- (-765.081) (-760.278) (-761.969) [-758.850] * (-760.000) [-759.884] (-761.474) (-759.693) -- 0:00:46 310000 -- (-765.014) (-759.838) [-762.032] (-759.157) * [-757.302] (-762.361) (-761.705) (-761.542) -- 0:00:46 Average standard deviation of split frequencies: 0.011820 310500 -- (-764.990) [-763.217] (-761.592) (-758.630) * (-757.656) (-762.775) (-760.100) [-759.002] -- 0:00:46 311000 -- (-761.627) (-761.537) (-760.359) [-758.598] * [-760.089] (-760.719) (-761.630) (-759.084) -- 0:00:46 311500 -- (-761.045) (-760.599) (-760.409) [-758.375] * (-757.739) (-761.432) (-760.640) [-757.836] -- 0:00:46 312000 -- [-760.130] (-760.046) (-762.170) (-760.494) * (-757.439) [-760.680] (-761.609) (-760.277) -- 0:00:46 312500 -- (-758.795) (-761.879) [-758.563] (-764.784) * [-758.178] (-760.393) (-762.978) (-763.806) -- 0:00:46 313000 -- [-759.072] (-764.652) (-762.999) (-758.654) * (-760.075) (-761.339) [-761.756] (-761.920) -- 0:00:46 313500 -- (-759.343) [-760.223] (-758.606) (-758.962) * [-759.584] (-760.872) (-758.499) (-758.549) -- 0:00:45 314000 -- (-761.540) (-759.137) (-758.421) [-759.022] * [-757.527] (-760.316) (-759.815) (-760.595) -- 0:00:45 314500 -- (-759.163) (-761.106) [-758.448] (-769.153) * (-761.301) (-762.676) [-759.626] (-760.853) -- 0:00:45 315000 -- (-758.569) (-766.765) (-759.841) [-763.239] * (-760.419) (-762.917) (-758.056) [-759.514] -- 0:00:45 Average standard deviation of split frequencies: 0.010618 315500 -- (-761.533) [-761.372] (-759.078) (-759.927) * (-759.840) (-761.416) [-761.149] (-758.964) -- 0:00:45 316000 -- (-764.667) (-758.989) [-760.928] (-768.264) * [-759.245] (-761.665) (-760.726) (-758.362) -- 0:00:45 316500 -- (-762.847) (-760.517) (-761.092) [-758.128] * (-759.169) [-760.023] (-759.497) (-760.985) -- 0:00:45 317000 -- (-761.204) [-759.691] (-759.404) (-759.660) * (-759.953) [-759.865] (-758.589) (-762.185) -- 0:00:45 317500 -- (-760.871) (-763.413) (-761.274) [-758.090] * (-759.643) (-767.855) (-761.020) [-761.719] -- 0:00:45 318000 -- [-760.762] (-760.884) (-762.071) (-758.555) * [-761.074] (-761.147) (-760.352) (-763.844) -- 0:00:45 318500 -- (-759.596) [-760.935] (-758.183) (-762.584) * (-762.940) [-762.005] (-766.034) (-759.455) -- 0:00:44 319000 -- (-760.363) (-760.356) (-761.165) [-758.566] * (-757.977) [-763.044] (-760.038) (-758.375) -- 0:00:44 319500 -- (-761.811) (-761.136) (-763.440) [-757.555] * (-758.983) (-763.886) (-759.305) [-758.438] -- 0:00:44 320000 -- [-758.786] (-757.134) (-759.764) (-760.550) * [-760.351] (-759.710) (-758.399) (-760.341) -- 0:00:44 Average standard deviation of split frequencies: 0.010550 320500 -- (-757.559) (-759.959) [-761.004] (-758.841) * [-761.093] (-759.237) (-763.392) (-757.720) -- 0:00:44 321000 -- (-758.889) (-764.758) [-760.992] (-760.859) * (-761.288) (-760.405) [-762.461] (-757.546) -- 0:00:44 321500 -- (-759.206) [-760.064] (-763.059) (-762.994) * (-760.631) (-760.360) [-760.352] (-758.221) -- 0:00:44 322000 -- (-760.024) (-760.671) [-760.088] (-757.443) * (-763.339) [-759.910] (-763.877) (-761.940) -- 0:00:44 322500 -- (-762.564) [-758.736] (-759.254) (-760.545) * (-765.850) [-760.766] (-760.449) (-763.126) -- 0:00:44 323000 -- (-760.280) (-760.803) [-757.452] (-761.118) * (-764.357) (-761.395) (-762.969) [-760.090] -- 0:00:44 323500 -- (-764.700) (-761.442) [-758.000] (-759.241) * (-760.637) (-759.434) (-760.173) [-758.644] -- 0:00:43 324000 -- [-763.809] (-758.973) (-758.638) (-764.196) * [-760.846] (-760.649) (-760.017) (-760.405) -- 0:00:45 324500 -- (-762.720) (-759.097) (-761.671) [-760.841] * [-762.021] (-764.404) (-764.298) (-759.807) -- 0:00:45 325000 -- (-759.970) [-758.663] (-763.993) (-766.480) * (-759.430) [-764.112] (-761.591) (-759.030) -- 0:00:45 Average standard deviation of split frequencies: 0.010207 325500 -- [-759.929] (-757.474) (-761.689) (-761.322) * (-758.346) (-761.832) (-760.673) [-760.605] -- 0:00:45 326000 -- (-760.207) (-762.094) [-762.315] (-761.577) * [-762.484] (-760.826) (-761.225) (-760.878) -- 0:00:45 326500 -- [-760.605] (-761.664) (-759.336) (-761.390) * (-761.325) (-761.070) (-761.645) [-760.984] -- 0:00:45 327000 -- (-762.660) (-763.500) (-761.915) [-759.148] * (-762.542) (-758.115) (-759.227) [-760.404] -- 0:00:45 327500 -- (-762.834) (-764.049) (-765.534) [-759.415] * (-764.314) (-761.813) (-759.809) [-759.602] -- 0:00:45 328000 -- (-761.968) (-760.917) [-762.922] (-760.570) * (-760.283) [-763.921] (-760.839) (-760.232) -- 0:00:45 328500 -- (-760.592) (-760.725) (-759.915) [-761.051] * [-762.345] (-765.535) (-761.319) (-762.354) -- 0:00:44 329000 -- [-762.812] (-761.331) (-759.080) (-760.952) * (-762.731) (-768.692) [-760.877] (-759.550) -- 0:00:44 329500 -- (-762.621) (-758.102) (-757.561) [-760.846] * [-761.374] (-762.650) (-760.870) (-759.243) -- 0:00:44 330000 -- [-761.476] (-764.531) (-758.088) (-760.192) * (-759.972) (-762.502) (-760.932) [-760.013] -- 0:00:44 Average standard deviation of split frequencies: 0.008134 330500 -- (-764.251) (-759.724) (-760.555) [-761.139] * [-762.377] (-766.373) (-761.904) (-758.648) -- 0:00:44 331000 -- (-760.523) (-761.567) (-757.832) [-759.704] * (-760.280) [-762.308] (-759.638) (-760.342) -- 0:00:44 331500 -- (-760.622) (-758.547) (-760.830) [-760.853] * (-761.886) [-759.484] (-760.851) (-765.632) -- 0:00:44 332000 -- (-761.553) [-760.003] (-762.258) (-761.203) * (-758.481) (-761.717) [-761.117] (-761.574) -- 0:00:44 332500 -- (-764.396) [-759.606] (-761.750) (-760.631) * (-760.508) (-762.047) (-759.174) [-761.533] -- 0:00:44 333000 -- (-760.479) [-758.318] (-759.237) (-760.077) * (-762.318) (-762.337) [-759.175] (-758.832) -- 0:00:44 333500 -- (-762.138) (-760.382) (-759.949) [-761.915] * [-760.098] (-761.059) (-758.144) (-761.384) -- 0:00:43 334000 -- (-760.558) (-761.304) [-761.322] (-762.360) * (-761.869) [-759.507] (-758.436) (-760.385) -- 0:00:43 334500 -- (-763.778) (-761.151) [-759.184] (-758.916) * [-759.420] (-763.657) (-761.472) (-758.495) -- 0:00:43 335000 -- [-759.885] (-760.707) (-759.901) (-761.142) * (-759.656) (-761.992) (-759.955) [-757.814] -- 0:00:43 Average standard deviation of split frequencies: 0.007804 335500 -- [-760.763] (-759.512) (-761.547) (-761.676) * (-762.800) (-762.443) [-759.947] (-757.670) -- 0:00:43 336000 -- (-760.113) [-760.262] (-760.708) (-760.276) * (-758.035) (-760.529) [-759.477] (-760.433) -- 0:00:43 336500 -- (-761.613) (-759.688) [-760.241] (-764.135) * (-761.654) (-760.845) (-758.544) [-758.507] -- 0:00:43 337000 -- (-763.904) [-760.091] (-760.465) (-761.489) * (-761.049) (-760.535) (-761.265) [-759.353] -- 0:00:43 337500 -- (-758.123) (-762.971) (-758.214) [-760.139] * (-761.951) (-759.947) [-758.025] (-760.445) -- 0:00:43 338000 -- (-759.594) (-760.417) [-758.768] (-764.313) * [-760.534] (-761.308) (-761.741) (-762.765) -- 0:00:43 338500 -- (-760.217) (-760.389) [-761.586] (-762.620) * (-761.784) (-760.461) [-767.154] (-758.115) -- 0:00:42 339000 -- (-758.602) [-760.490] (-762.167) (-763.264) * [-762.279] (-759.204) (-758.366) (-761.247) -- 0:00:44 339500 -- (-758.323) [-761.701] (-758.810) (-768.326) * (-763.096) [-759.442] (-764.678) (-759.245) -- 0:00:44 340000 -- (-759.160) [-760.605] (-762.702) (-762.004) * (-762.089) [-756.486] (-760.768) (-757.529) -- 0:00:44 Average standard deviation of split frequencies: 0.008130 340500 -- (-759.467) (-762.945) (-762.115) [-761.141] * (-759.980) [-759.179] (-761.914) (-761.518) -- 0:00:44 341000 -- (-758.336) (-759.844) [-759.896] (-766.008) * [-759.469] (-761.324) (-761.931) (-758.154) -- 0:00:44 341500 -- (-764.949) [-760.593] (-760.253) (-770.348) * (-758.743) (-760.212) (-763.281) [-757.939] -- 0:00:44 342000 -- (-759.289) [-759.729] (-761.365) (-760.031) * (-760.868) (-759.810) (-761.078) [-758.462] -- 0:00:44 342500 -- (-761.100) (-758.476) [-760.676] (-761.186) * (-760.050) [-759.289] (-762.095) (-759.590) -- 0:00:44 343000 -- (-762.778) [-761.284] (-760.418) (-762.792) * [-760.952] (-761.289) (-762.451) (-759.999) -- 0:00:44 343500 -- (-760.575) (-760.803) (-762.049) [-760.872] * (-760.239) [-761.944] (-760.128) (-760.644) -- 0:00:43 344000 -- (-763.470) (-761.371) [-761.273] (-759.645) * (-761.524) (-763.273) (-763.988) [-758.271] -- 0:00:43 344500 -- [-761.436] (-761.570) (-760.410) (-759.882) * (-762.059) [-761.489] (-761.854) (-757.982) -- 0:00:43 345000 -- (-763.547) (-759.195) (-760.779) [-759.958] * (-762.444) [-760.482] (-759.196) (-759.195) -- 0:00:43 Average standard deviation of split frequencies: 0.008686 345500 -- (-760.284) [-761.071] (-760.326) (-764.119) * (-759.866) (-761.971) (-759.766) [-760.067] -- 0:00:43 346000 -- [-760.310] (-760.387) (-760.779) (-761.438) * (-759.601) (-759.744) (-760.333) [-760.002] -- 0:00:43 346500 -- [-761.015] (-766.092) (-761.663) (-760.868) * (-759.164) [-760.411] (-758.583) (-758.564) -- 0:00:43 347000 -- [-759.289] (-761.503) (-762.673) (-762.043) * (-761.517) (-761.897) [-758.577] (-758.676) -- 0:00:43 347500 -- [-762.214] (-760.379) (-759.800) (-761.014) * (-761.028) (-763.735) [-758.552] (-759.394) -- 0:00:43 348000 -- (-761.004) (-762.303) [-760.250] (-757.798) * (-762.665) [-760.369] (-763.479) (-759.087) -- 0:00:43 348500 -- (-764.701) (-760.985) (-760.112) [-758.839] * (-761.436) (-759.500) (-761.665) [-758.609] -- 0:00:42 349000 -- [-764.627] (-760.123) (-761.155) (-760.224) * (-759.697) (-760.592) (-759.697) [-757.794] -- 0:00:42 349500 -- [-759.851] (-760.128) (-763.039) (-758.191) * [-758.953] (-765.397) (-761.629) (-759.509) -- 0:00:42 350000 -- [-758.746] (-759.682) (-761.327) (-762.020) * [-758.384] (-765.172) (-759.770) (-760.177) -- 0:00:42 Average standard deviation of split frequencies: 0.007982 350500 -- (-761.248) (-760.135) (-761.533) [-760.338] * [-759.839] (-765.713) (-762.695) (-763.396) -- 0:00:42 351000 -- (-758.078) (-760.709) (-764.534) [-759.587] * (-763.353) (-763.231) [-758.119] (-762.910) -- 0:00:42 351500 -- (-759.288) (-759.838) (-760.763) [-759.462] * (-759.310) (-760.327) (-759.143) [-759.548] -- 0:00:42 352000 -- (-760.733) (-761.797) [-760.824] (-758.471) * [-762.156] (-760.582) (-762.375) (-760.613) -- 0:00:42 352500 -- [-758.589] (-761.718) (-763.532) (-760.076) * [-758.120] (-761.089) (-765.600) (-759.110) -- 0:00:42 353000 -- (-760.288) (-759.740) [-762.691] (-757.655) * (-761.735) (-759.904) (-761.065) [-759.221] -- 0:00:42 353500 -- (-760.683) (-760.574) (-760.424) [-758.344] * [-759.306] (-762.860) (-759.389) (-758.237) -- 0:00:42 354000 -- (-759.571) (-760.837) (-759.973) [-760.971] * [-761.390] (-760.897) (-762.068) (-759.423) -- 0:00:43 354500 -- (-757.487) (-759.361) (-760.840) [-758.300] * [-759.481] (-758.805) (-761.733) (-759.503) -- 0:00:43 355000 -- (-760.866) [-761.672] (-762.730) (-758.526) * [-762.448] (-763.336) (-762.028) (-763.404) -- 0:00:43 Average standard deviation of split frequencies: 0.007697 355500 -- [-760.952] (-763.522) (-761.394) (-757.440) * (-758.864) (-761.389) [-757.840] (-763.162) -- 0:00:43 356000 -- [-758.562] (-761.884) (-760.925) (-761.465) * [-759.956] (-759.819) (-759.917) (-762.225) -- 0:00:43 356500 -- (-758.813) (-762.198) (-761.595) [-759.643] * (-763.430) [-762.001] (-760.297) (-762.916) -- 0:00:43 357000 -- (-759.357) [-760.484] (-761.876) (-760.851) * (-762.828) [-760.761] (-759.149) (-758.783) -- 0:00:43 357500 -- (-760.436) (-763.116) [-761.004] (-761.452) * [-761.323] (-761.124) (-757.951) (-764.491) -- 0:00:43 358000 -- (-760.358) [-760.431] (-761.245) (-759.074) * (-762.110) [-758.880] (-758.681) (-760.639) -- 0:00:43 358500 -- (-761.819) (-761.085) [-762.156] (-765.962) * (-758.886) [-758.790] (-759.992) (-759.796) -- 0:00:42 359000 -- (-759.174) (-759.303) [-760.996] (-762.387) * [-758.689] (-762.939) (-764.079) (-761.318) -- 0:00:42 359500 -- (-759.068) (-761.758) [-761.457] (-761.777) * (-759.445) (-763.531) [-758.694] (-759.956) -- 0:00:42 360000 -- [-758.305] (-760.804) (-760.050) (-761.756) * [-759.673] (-762.232) (-759.752) (-760.426) -- 0:00:42 Average standard deviation of split frequencies: 0.007352 360500 -- (-758.976) (-764.298) [-760.811] (-760.403) * (-759.354) (-759.231) (-760.236) [-759.398] -- 0:00:42 361000 -- (-760.360) (-761.938) (-763.807) [-762.607] * (-761.479) (-761.434) [-758.519] (-760.624) -- 0:00:42 361500 -- (-760.954) [-758.731] (-758.620) (-761.879) * (-758.670) (-760.850) [-759.069] (-761.877) -- 0:00:42 362000 -- (-762.052) [-759.239] (-761.739) (-765.411) * (-760.050) (-762.443) [-760.033] (-760.153) -- 0:00:42 362500 -- (-761.486) (-759.269) [-760.570] (-759.113) * [-760.587] (-763.306) (-759.384) (-758.641) -- 0:00:42 363000 -- (-759.333) (-759.814) (-760.107) [-760.045] * (-764.328) (-759.360) [-762.346] (-759.032) -- 0:00:42 363500 -- (-762.900) (-760.663) (-762.621) [-758.282] * [-763.578] (-758.904) (-764.147) (-761.368) -- 0:00:42 364000 -- (-761.837) (-762.411) (-760.128) [-759.382] * (-760.658) (-759.840) [-759.103] (-760.961) -- 0:00:41 364500 -- (-762.215) (-760.427) (-762.778) [-759.880] * [-760.039] (-759.312) (-759.800) (-763.587) -- 0:00:41 365000 -- [-761.140] (-762.385) (-761.408) (-759.217) * [-761.789] (-759.032) (-760.483) (-759.440) -- 0:00:41 Average standard deviation of split frequencies: 0.007576 365500 -- [-761.947] (-758.459) (-761.550) (-760.256) * (-761.179) (-761.208) [-757.873] (-761.374) -- 0:00:41 366000 -- [-759.695] (-762.459) (-764.926) (-759.376) * (-764.338) [-761.423] (-759.009) (-760.603) -- 0:00:41 366500 -- (-758.775) [-760.646] (-760.387) (-764.674) * (-760.469) (-760.628) (-759.415) [-758.651] -- 0:00:41 367000 -- [-757.624] (-760.382) (-767.881) (-765.651) * (-760.382) (-763.828) (-763.175) [-760.547] -- 0:00:41 367500 -- (-759.513) (-763.883) (-761.052) [-758.030] * [-760.348] (-762.331) (-760.487) (-759.011) -- 0:00:41 368000 -- (-759.202) [-759.872] (-762.609) (-760.416) * (-759.037) (-761.550) (-762.989) [-761.546] -- 0:00:41 368500 -- (-758.188) (-760.748) (-761.057) [-759.395] * (-759.296) [-760.340] (-760.318) (-759.415) -- 0:00:41 369000 -- (-761.236) (-761.471) (-760.380) [-760.686] * (-761.532) (-760.212) [-759.110] (-762.093) -- 0:00:42 369500 -- (-761.892) (-758.660) (-759.976) [-761.552] * (-758.661) [-759.109] (-758.130) (-760.192) -- 0:00:42 370000 -- (-764.842) (-759.639) [-760.080] (-758.039) * (-758.015) (-758.118) [-759.542] (-760.321) -- 0:00:42 Average standard deviation of split frequencies: 0.008080 370500 -- (-761.897) (-760.710) [-759.108] (-761.362) * (-762.147) (-766.044) [-760.864] (-761.385) -- 0:00:42 371000 -- (-759.092) (-760.725) [-762.466] (-758.922) * (-758.139) [-759.902] (-760.507) (-760.994) -- 0:00:42 371500 -- (-761.397) [-760.891] (-762.397) (-759.315) * (-759.461) (-756.835) (-758.510) [-760.227] -- 0:00:42 372000 -- (-758.377) [-760.487] (-762.402) (-758.258) * [-759.013] (-759.983) (-762.670) (-761.178) -- 0:00:42 372500 -- (-760.907) [-763.462] (-761.938) (-759.288) * [-758.440] (-764.140) (-760.346) (-761.195) -- 0:00:42 373000 -- (-762.483) [-762.514] (-760.534) (-768.023) * [-759.993] (-759.453) (-762.185) (-766.046) -- 0:00:42 373500 -- (-760.114) (-759.189) (-760.226) [-759.944] * (-759.551) (-762.028) (-760.240) [-762.957] -- 0:00:41 374000 -- (-757.943) (-759.471) [-761.417] (-757.945) * (-759.101) (-762.017) (-763.448) [-759.535] -- 0:00:41 374500 -- (-759.075) (-763.635) (-761.487) [-761.389] * (-759.349) [-759.526] (-760.238) (-760.045) -- 0:00:41 375000 -- [-761.298] (-759.626) (-763.376) (-761.820) * (-758.904) (-763.032) [-761.020] (-762.635) -- 0:00:41 Average standard deviation of split frequencies: 0.006974 375500 -- (-758.886) (-761.429) (-760.929) [-758.215] * (-761.720) (-759.287) [-761.000] (-760.789) -- 0:00:41 376000 -- (-759.644) [-761.828] (-760.572) (-763.216) * [-759.181] (-760.879) (-760.598) (-762.066) -- 0:00:41 376500 -- [-761.868] (-769.221) (-761.413) (-757.798) * (-760.515) (-761.433) [-759.065] (-765.114) -- 0:00:41 377000 -- (-759.181) [-760.903] (-760.400) (-758.257) * (-761.026) [-764.082] (-758.942) (-760.686) -- 0:00:41 377500 -- (-762.266) (-759.651) [-761.188] (-757.510) * (-760.629) (-758.811) [-760.125] (-761.034) -- 0:00:41 378000 -- (-762.285) (-760.142) (-760.396) [-760.279] * [-758.693] (-760.939) (-767.069) (-760.715) -- 0:00:41 378500 -- [-763.767] (-759.909) (-760.842) (-761.456) * (-761.747) [-761.726] (-761.464) (-760.517) -- 0:00:41 379000 -- [-762.629] (-759.744) (-761.313) (-761.396) * (-758.318) (-760.706) (-760.636) [-759.482] -- 0:00:40 379500 -- (-762.850) [-762.344] (-757.722) (-758.389) * (-761.042) (-759.639) (-759.669) [-761.436] -- 0:00:40 380000 -- (-761.928) (-761.458) [-760.119] (-758.566) * [-757.799] (-765.923) (-759.813) (-765.421) -- 0:00:40 Average standard deviation of split frequencies: 0.006888 380500 -- (-759.544) (-760.421) (-760.908) [-758.268] * (-759.870) (-760.110) [-760.901] (-763.986) -- 0:00:40 381000 -- (-760.852) (-759.507) [-758.542] (-759.158) * [-759.683] (-759.729) (-758.078) (-762.195) -- 0:00:40 381500 -- (-760.059) (-760.570) [-757.648] (-759.810) * (-763.800) [-763.534] (-759.478) (-760.348) -- 0:00:40 382000 -- (-759.175) [-760.632] (-759.284) (-760.476) * [-758.763] (-766.874) (-757.918) (-759.850) -- 0:00:40 382500 -- [-759.568] (-762.062) (-762.213) (-759.807) * (-758.307) (-760.554) [-761.338] (-761.058) -- 0:00:40 383000 -- [-759.508] (-759.209) (-763.510) (-760.230) * (-759.344) (-759.333) (-756.447) [-760.659] -- 0:00:40 383500 -- (-764.087) (-757.944) [-760.224] (-758.625) * (-759.416) [-759.571] (-760.955) (-757.886) -- 0:00:40 384000 -- (-761.556) (-759.488) [-758.334] (-761.600) * [-760.728] (-761.269) (-759.786) (-762.054) -- 0:00:41 384500 -- (-760.685) (-759.327) (-757.736) [-759.964] * (-763.214) [-759.426] (-760.432) (-759.032) -- 0:00:41 385000 -- (-760.329) (-761.026) (-757.799) [-758.929] * (-761.999) (-761.679) [-762.180] (-761.199) -- 0:00:41 Average standard deviation of split frequencies: 0.006335 385500 -- (-761.417) (-758.098) (-760.669) [-759.991] * (-760.820) [-759.506] (-758.924) (-759.883) -- 0:00:41 386000 -- (-759.288) [-760.022] (-765.742) (-762.129) * [-757.506] (-759.426) (-757.267) (-762.681) -- 0:00:41 386500 -- (-759.383) (-760.481) (-761.886) [-759.499] * (-760.851) (-759.455) [-758.140] (-764.916) -- 0:00:41 387000 -- (-759.146) [-758.294] (-759.124) (-760.212) * (-760.817) (-761.588) [-757.755] (-761.366) -- 0:00:41 387500 -- (-760.199) (-763.380) [-758.569] (-764.070) * (-756.252) [-760.677] (-757.688) (-760.562) -- 0:00:41 388000 -- [-762.777] (-767.735) (-764.353) (-763.247) * (-764.542) [-762.614] (-760.727) (-761.849) -- 0:00:41 388500 -- (-758.233) (-766.338) (-762.558) [-760.866] * [-759.905] (-760.518) (-760.489) (-761.635) -- 0:00:40 389000 -- (-760.291) (-760.395) [-757.316] (-762.164) * (-760.615) (-759.823) [-760.208] (-760.991) -- 0:00:40 389500 -- (-762.139) [-762.352] (-758.501) (-761.845) * (-762.996) [-761.787] (-758.016) (-762.102) -- 0:00:40 390000 -- (-759.172) [-760.740] (-761.374) (-760.247) * (-759.402) [-762.374] (-759.959) (-760.821) -- 0:00:40 Average standard deviation of split frequencies: 0.007595 390500 -- (-760.072) (-761.523) (-759.640) [-758.653] * (-759.715) (-771.936) (-760.759) [-760.816] -- 0:00:40 391000 -- (-758.889) (-761.413) [-758.876] (-759.816) * [-761.323] (-759.685) (-757.567) (-761.227) -- 0:00:40 391500 -- [-759.505] (-762.796) (-760.493) (-762.373) * (-764.777) (-760.407) [-759.112] (-765.033) -- 0:00:40 392000 -- (-759.796) (-760.137) [-759.864] (-759.620) * (-764.413) [-758.807] (-764.114) (-760.672) -- 0:00:40 392500 -- (-763.213) [-760.791] (-758.161) (-760.634) * [-758.928] (-758.297) (-760.301) (-761.145) -- 0:00:40 393000 -- (-760.789) [-759.125] (-762.102) (-762.153) * (-764.726) (-759.168) [-759.860] (-762.693) -- 0:00:40 393500 -- [-762.173] (-759.833) (-757.576) (-763.512) * (-760.897) [-760.744] (-763.351) (-763.833) -- 0:00:40 394000 -- (-760.291) (-760.825) [-758.671] (-761.863) * (-758.055) [-759.911] (-758.815) (-761.148) -- 0:00:39 394500 -- (-762.833) (-760.232) [-759.930] (-758.342) * (-763.289) (-760.470) [-761.956] (-759.631) -- 0:00:39 395000 -- (-760.377) [-761.539] (-760.236) (-760.081) * (-759.995) (-762.363) (-759.630) [-764.211] -- 0:00:39 Average standard deviation of split frequencies: 0.007983 395500 -- (-760.358) (-761.293) [-759.648] (-767.268) * (-762.073) (-761.985) [-759.869] (-759.663) -- 0:00:39 396000 -- (-760.888) [-760.413] (-764.745) (-760.862) * (-762.678) (-763.057) (-760.342) [-761.562] -- 0:00:39 396500 -- (-762.825) (-760.359) [-758.111] (-759.801) * [-761.507] (-760.609) (-760.000) (-760.030) -- 0:00:39 397000 -- [-758.876] (-761.673) (-759.982) (-759.459) * (-760.774) (-761.107) [-759.100] (-761.706) -- 0:00:39 397500 -- (-761.381) (-768.284) (-757.928) [-759.963] * (-757.964) [-765.667] (-759.741) (-761.739) -- 0:00:39 398000 -- (-759.767) (-761.518) (-765.650) [-760.753] * (-761.133) [-759.155] (-757.795) (-760.844) -- 0:00:39 398500 -- (-760.689) (-764.131) (-763.181) [-759.359] * (-762.307) [-759.840] (-765.028) (-760.669) -- 0:00:39 399000 -- (-760.050) (-760.112) (-758.154) [-758.532] * (-760.248) [-761.290] (-762.554) (-763.533) -- 0:00:40 399500 -- (-762.041) [-762.225] (-760.790) (-761.529) * (-764.598) [-760.864] (-762.119) (-762.073) -- 0:00:40 400000 -- [-761.672] (-762.363) (-761.037) (-760.780) * [-758.429] (-761.607) (-760.897) (-761.211) -- 0:00:40 Average standard deviation of split frequencies: 0.008028 400500 -- (-759.884) [-760.956] (-760.612) (-760.883) * (-758.734) [-761.127] (-762.902) (-759.380) -- 0:00:40 401000 -- (-760.556) (-762.368) (-763.799) [-760.996] * (-758.422) (-761.444) (-760.502) [-760.008] -- 0:00:40 401500 -- [-759.340] (-759.698) (-760.872) (-764.793) * (-757.496) (-759.997) (-762.493) [-763.055] -- 0:00:40 402000 -- [-762.536] (-760.846) (-762.839) (-760.353) * (-758.806) [-759.155] (-768.667) (-759.498) -- 0:00:40 402500 -- (-763.949) (-762.886) (-765.913) [-758.726] * [-764.222] (-760.798) (-761.586) (-760.954) -- 0:00:40 403000 -- (-763.184) [-762.028] (-759.600) (-762.142) * [-761.461] (-761.267) (-761.538) (-761.762) -- 0:00:39 403500 -- (-760.842) (-759.435) [-758.374] (-764.560) * (-759.067) [-760.225] (-765.095) (-760.528) -- 0:00:39 404000 -- (-762.026) [-760.296] (-758.960) (-762.875) * [-761.532] (-762.041) (-763.384) (-761.783) -- 0:00:39 404500 -- (-761.942) [-761.852] (-760.375) (-763.165) * (-761.471) (-759.081) (-764.949) [-761.362] -- 0:00:39 405000 -- (-760.370) (-761.093) [-759.919] (-763.933) * [-758.430] (-760.120) (-758.976) (-758.881) -- 0:00:39 Average standard deviation of split frequencies: 0.007923 405500 -- (-758.645) [-758.057] (-760.828) (-760.341) * (-758.574) (-760.809) [-761.276] (-759.706) -- 0:00:39 406000 -- (-759.723) [-759.846] (-759.264) (-760.736) * (-758.531) [-758.107] (-761.849) (-763.473) -- 0:00:39 406500 -- (-761.743) [-759.947] (-758.633) (-761.187) * (-760.524) (-758.063) [-759.087] (-760.227) -- 0:00:39 407000 -- (-759.792) (-760.984) [-760.785] (-761.051) * (-759.339) (-759.501) (-760.659) [-758.516] -- 0:00:39 407500 -- (-760.201) (-759.577) [-761.156] (-761.770) * (-759.078) (-758.812) [-761.971] (-761.008) -- 0:00:39 408000 -- (-760.880) (-760.146) [-759.138] (-760.228) * [-759.309] (-757.805) (-762.111) (-760.901) -- 0:00:39 408500 -- (-762.182) (-760.025) (-762.047) [-762.278] * [-761.827] (-759.257) (-762.328) (-758.286) -- 0:00:39 409000 -- (-764.127) (-764.462) [-759.278] (-761.829) * [-758.115] (-761.323) (-761.876) (-757.780) -- 0:00:39 409500 -- [-762.470] (-760.618) (-760.939) (-764.017) * (-758.914) (-763.448) [-760.495] (-760.000) -- 0:00:38 410000 -- (-761.690) [-760.176] (-760.963) (-762.946) * (-763.773) [-760.742] (-759.102) (-760.340) -- 0:00:38 Average standard deviation of split frequencies: 0.008170 410500 -- (-759.401) (-759.975) [-758.947] (-761.966) * [-759.733] (-764.714) (-761.640) (-761.488) -- 0:00:38 411000 -- [-764.310] (-762.192) (-761.017) (-761.551) * [-760.640] (-760.148) (-762.575) (-761.520) -- 0:00:38 411500 -- (-761.144) (-760.223) [-762.099] (-760.308) * [-759.428] (-761.867) (-760.374) (-758.442) -- 0:00:38 412000 -- [-763.219] (-761.720) (-759.088) (-758.771) * [-759.975] (-761.621) (-763.090) (-760.340) -- 0:00:39 412500 -- (-762.298) (-760.513) (-759.935) [-758.021] * (-760.313) (-761.384) (-760.466) [-759.877] -- 0:00:39 413000 -- (-760.590) (-760.771) (-763.259) [-759.955] * (-761.838) [-760.126] (-759.515) (-758.553) -- 0:00:39 413500 -- (-758.574) [-757.953] (-762.248) (-760.538) * (-762.486) [-759.656] (-758.242) (-759.487) -- 0:00:39 414000 -- [-760.659] (-758.323) (-762.889) (-760.878) * (-767.202) (-768.974) (-758.425) [-759.894] -- 0:00:39 414500 -- (-762.976) [-761.475] (-760.745) (-763.682) * (-762.584) (-760.829) (-759.786) [-759.560] -- 0:00:39 415000 -- (-762.033) [-759.181] (-763.494) (-760.000) * (-761.186) (-760.095) [-760.277] (-758.666) -- 0:00:39 Average standard deviation of split frequencies: 0.008532 415500 -- (-758.665) (-758.463) [-761.379] (-760.482) * (-760.723) (-762.287) [-759.445] (-766.241) -- 0:00:39 416000 -- (-763.228) (-759.039) [-762.512] (-758.431) * (-760.053) (-763.023) (-762.015) [-758.647] -- 0:00:39 416500 -- [-760.327] (-759.534) (-764.880) (-759.204) * (-763.744) (-760.701) (-760.528) [-760.829] -- 0:00:39 417000 -- [-759.011] (-760.688) (-762.258) (-760.510) * [-760.090] (-761.049) (-762.618) (-764.380) -- 0:00:39 417500 -- (-760.186) [-758.153] (-760.420) (-759.774) * (-764.405) [-760.371] (-760.980) (-760.003) -- 0:00:39 418000 -- (-760.707) [-759.665] (-762.883) (-761.018) * (-760.765) (-758.183) [-757.563] (-762.053) -- 0:00:38 418500 -- (-758.236) [-759.529] (-761.604) (-760.226) * (-761.156) [-762.973] (-759.515) (-759.589) -- 0:00:38 419000 -- (-759.515) [-761.140] (-761.674) (-760.012) * (-761.434) (-760.825) (-763.104) [-760.561] -- 0:00:38 419500 -- (-759.785) [-758.731] (-760.662) (-760.734) * (-759.918) (-763.915) [-761.385] (-760.849) -- 0:00:38 420000 -- [-760.893] (-760.200) (-760.542) (-760.901) * (-760.483) (-762.597) [-758.138] (-760.044) -- 0:00:38 Average standard deviation of split frequencies: 0.007984 420500 -- (-761.428) (-760.195) [-760.713] (-759.469) * [-761.309] (-758.604) (-762.078) (-761.412) -- 0:00:38 421000 -- (-761.161) [-760.326] (-761.979) (-758.181) * (-760.222) (-760.152) [-762.491] (-762.656) -- 0:00:38 421500 -- (-762.031) [-760.189] (-759.628) (-758.015) * (-762.005) (-761.067) (-759.505) [-762.653] -- 0:00:38 422000 -- [-759.142] (-760.089) (-758.207) (-760.346) * (-761.045) [-759.769] (-759.663) (-764.238) -- 0:00:38 422500 -- [-759.509] (-760.744) (-759.724) (-759.799) * (-762.210) (-762.973) [-760.588] (-762.710) -- 0:00:38 423000 -- (-761.421) (-762.194) (-761.426) [-761.322] * (-758.449) (-760.861) (-759.547) [-764.640] -- 0:00:38 423500 -- (-761.654) (-758.912) [-759.015] (-764.952) * (-760.033) (-761.820) [-762.958] (-760.119) -- 0:00:38 424000 -- (-760.967) (-759.397) [-758.726] (-758.590) * (-759.218) (-759.864) [-760.247] (-760.848) -- 0:00:38 424500 -- [-760.501] (-757.779) (-761.096) (-758.148) * (-760.959) (-758.361) (-760.046) [-761.181] -- 0:00:37 425000 -- (-760.717) (-763.647) [-764.630] (-760.798) * [-760.839] (-761.702) (-759.733) (-759.596) -- 0:00:37 Average standard deviation of split frequencies: 0.008645 425500 -- (-759.390) (-760.827) [-763.485] (-761.518) * (-759.800) [-761.483] (-761.274) (-760.579) -- 0:00:37 426000 -- (-760.427) [-759.665] (-760.845) (-760.808) * (-758.400) (-763.099) (-763.742) [-760.763] -- 0:00:37 426500 -- [-758.945] (-759.157) (-760.429) (-760.092) * [-757.415] (-761.372) (-761.965) (-758.168) -- 0:00:38 427000 -- (-759.226) (-758.860) (-760.155) [-758.989] * (-761.299) [-758.094] (-761.714) (-758.865) -- 0:00:38 427500 -- [-762.020] (-759.615) (-758.450) (-760.757) * (-760.195) (-758.864) (-760.418) [-759.702] -- 0:00:38 428000 -- (-761.609) [-759.829] (-761.807) (-759.920) * (-762.214) (-760.156) [-760.648] (-757.832) -- 0:00:38 428500 -- (-760.237) [-758.485] (-758.264) (-760.655) * (-760.643) [-759.246] (-759.643) (-761.041) -- 0:00:38 429000 -- [-759.993] (-761.959) (-759.931) (-758.943) * (-757.718) (-761.154) (-759.064) [-760.050] -- 0:00:38 429500 -- (-760.724) (-762.910) [-760.497] (-759.971) * (-759.801) [-759.289] (-759.575) (-759.556) -- 0:00:38 430000 -- (-764.362) (-758.801) (-760.554) [-765.455] * [-758.875] (-759.615) (-761.501) (-759.463) -- 0:00:38 Average standard deviation of split frequencies: 0.008173 430500 -- (-760.734) (-762.030) [-760.048] (-759.929) * (-759.998) (-759.573) (-758.506) [-760.412] -- 0:00:38 431000 -- (-759.138) (-758.320) [-758.376] (-763.343) * [-759.613] (-759.787) (-761.802) (-759.071) -- 0:00:38 431500 -- (-758.238) (-761.590) [-762.538] (-764.580) * (-760.605) (-761.388) (-758.718) [-757.903] -- 0:00:38 432000 -- (-762.383) [-761.113] (-762.315) (-764.846) * (-760.677) (-759.894) [-759.519] (-759.690) -- 0:00:38 432500 -- (-760.136) [-761.716] (-761.920) (-759.757) * [-761.789] (-758.420) (-759.769) (-763.601) -- 0:00:38 433000 -- (-760.826) (-762.695) (-761.560) [-758.416] * [-761.528] (-758.085) (-759.914) (-760.983) -- 0:00:37 433500 -- (-761.163) (-759.027) [-760.400] (-762.769) * (-761.237) (-761.654) [-761.328] (-762.182) -- 0:00:37 434000 -- (-761.464) [-760.614] (-760.849) (-759.505) * [-758.040] (-763.222) (-758.613) (-766.359) -- 0:00:37 434500 -- (-760.650) (-757.967) [-762.597] (-758.902) * [-759.798] (-761.501) (-760.262) (-759.908) -- 0:00:37 435000 -- [-758.946] (-759.853) (-763.467) (-761.164) * (-759.346) (-761.290) (-760.612) [-758.083] -- 0:00:37 Average standard deviation of split frequencies: 0.008217 435500 -- (-760.755) (-757.775) (-761.919) [-759.427] * (-758.867) (-761.378) (-759.599) [-759.270] -- 0:00:37 436000 -- (-761.116) (-759.113) [-761.885] (-767.480) * (-762.321) [-759.446] (-760.398) (-761.470) -- 0:00:37 436500 -- (-763.255) [-759.803] (-760.893) (-765.817) * (-757.962) [-760.333] (-761.725) (-761.112) -- 0:00:37 437000 -- (-767.171) [-760.835] (-762.330) (-759.935) * (-757.972) (-762.756) (-757.625) [-760.410] -- 0:00:37 437500 -- (-763.608) (-758.486) [-760.826] (-762.764) * (-759.724) (-763.014) (-759.341) [-760.753] -- 0:00:37 438000 -- (-759.265) (-763.405) [-758.858] (-761.177) * (-761.593) (-760.452) [-759.397] (-760.430) -- 0:00:37 438500 -- (-762.345) (-761.253) (-759.176) [-759.810] * (-763.620) (-758.032) [-760.598] (-763.667) -- 0:00:37 439000 -- (-764.905) (-764.974) (-759.941) [-759.082] * [-761.012] (-760.667) (-761.376) (-760.304) -- 0:00:37 439500 -- (-760.568) [-760.013] (-760.844) (-760.852) * (-760.325) (-761.108) [-759.335] (-762.451) -- 0:00:36 440000 -- [-760.681] (-761.221) (-761.723) (-759.965) * (-759.563) (-758.217) [-760.071] (-759.449) -- 0:00:36 Average standard deviation of split frequencies: 0.008344 440500 -- (-760.998) (-759.988) (-759.597) [-759.086] * [-760.342] (-761.949) (-759.699) (-767.204) -- 0:00:36 441000 -- (-761.411) [-758.399] (-758.839) (-760.641) * (-759.847) (-761.461) [-759.084] (-761.836) -- 0:00:36 441500 -- (-760.624) (-758.684) [-761.447] (-759.283) * [-760.140] (-760.650) (-758.224) (-765.633) -- 0:00:37 442000 -- (-760.424) (-757.007) [-759.873] (-761.636) * [-761.610] (-764.086) (-759.232) (-761.712) -- 0:00:37 442500 -- (-762.468) (-762.041) [-760.185] (-759.181) * [-761.333] (-759.590) (-759.670) (-762.952) -- 0:00:37 443000 -- (-762.944) (-758.817) (-765.263) [-759.478] * (-760.468) [-759.907] (-761.913) (-761.230) -- 0:00:37 443500 -- (-760.466) (-760.143) (-764.417) [-762.803] * (-759.306) (-760.037) [-761.405] (-760.775) -- 0:00:37 444000 -- (-759.707) (-760.411) (-759.102) [-763.368] * (-761.591) (-761.792) [-759.411] (-764.175) -- 0:00:37 444500 -- (-761.346) (-760.446) [-762.174] (-763.271) * (-757.685) [-758.814] (-759.258) (-762.102) -- 0:00:37 445000 -- (-762.108) [-757.789] (-761.955) (-757.175) * (-759.937) [-762.164] (-762.114) (-764.240) -- 0:00:37 Average standard deviation of split frequencies: 0.008526 445500 -- (-759.744) (-759.633) (-765.774) [-757.895] * (-760.235) [-761.501] (-758.351) (-761.636) -- 0:00:37 446000 -- [-760.329] (-757.624) (-763.597) (-759.234) * (-760.077) [-758.179] (-759.883) (-763.329) -- 0:00:37 446500 -- (-762.282) (-759.595) (-761.875) [-758.497] * (-758.860) (-764.428) (-762.181) [-761.028] -- 0:00:37 447000 -- (-759.755) (-759.277) [-762.438] (-764.198) * [-759.229] (-766.548) (-761.162) (-760.220) -- 0:00:37 447500 -- (-760.522) (-763.367) [-759.693] (-762.795) * (-760.361) [-761.010] (-765.575) (-760.904) -- 0:00:37 448000 -- (-760.003) (-759.354) [-762.315] (-764.097) * (-764.714) (-759.747) (-757.979) [-760.647] -- 0:00:36 448500 -- [-771.889] (-761.234) (-757.606) (-760.649) * (-763.297) [-759.958] (-765.354) (-762.294) -- 0:00:36 449000 -- (-761.873) (-758.699) [-758.666] (-762.049) * (-762.327) (-760.248) [-758.412] (-764.636) -- 0:00:36 449500 -- [-760.859] (-759.669) (-764.533) (-761.602) * [-761.590] (-759.633) (-756.816) (-762.502) -- 0:00:36 450000 -- [-762.067] (-760.590) (-760.926) (-761.370) * (-761.961) (-759.842) [-756.809] (-759.520) -- 0:00:36 Average standard deviation of split frequencies: 0.008159 450500 -- (-761.061) (-759.941) (-759.946) [-760.374] * (-762.846) (-766.901) (-759.756) [-762.643] -- 0:00:36 451000 -- (-762.401) [-757.778] (-758.468) (-763.546) * (-760.907) (-759.527) [-758.577] (-759.558) -- 0:00:36 451500 -- [-761.311] (-760.418) (-760.364) (-760.878) * [-760.795] (-759.842) (-760.835) (-759.330) -- 0:00:36 452000 -- (-760.489) (-759.922) [-760.664] (-761.235) * (-760.977) [-758.691] (-762.458) (-760.008) -- 0:00:36 452500 -- [-757.926] (-760.431) (-758.989) (-761.189) * (-764.263) (-760.633) [-758.771] (-761.911) -- 0:00:36 453000 -- (-765.018) (-759.938) [-760.436] (-761.022) * (-761.961) [-759.843] (-759.782) (-761.011) -- 0:00:36 453500 -- [-759.602] (-761.190) (-757.475) (-760.785) * (-759.357) [-760.967] (-761.535) (-762.141) -- 0:00:36 454000 -- (-759.668) (-758.254) (-759.119) [-761.696] * (-758.329) (-760.828) (-759.585) [-758.002] -- 0:00:36 454500 -- (-759.637) [-758.287] (-759.509) (-758.962) * [-760.328] (-761.828) (-762.377) (-761.690) -- 0:00:37 455000 -- [-758.817] (-761.761) (-760.908) (-759.965) * (-761.986) [-762.422] (-760.438) (-758.950) -- 0:00:37 Average standard deviation of split frequencies: 0.008723 455500 -- (-759.165) (-759.988) [-758.462] (-766.461) * (-764.492) (-761.418) (-761.005) [-759.449] -- 0:00:37 456000 -- (-761.111) (-757.796) [-759.910] (-766.077) * (-761.131) (-760.832) [-760.440] (-762.871) -- 0:00:36 456500 -- [-759.786] (-759.056) (-762.052) (-763.587) * (-764.874) (-759.992) [-760.683] (-760.110) -- 0:00:36 457000 -- (-759.824) [-756.945] (-761.783) (-761.556) * (-762.218) [-763.058] (-759.655) (-759.135) -- 0:00:36 457500 -- (-759.698) (-766.033) [-763.984] (-760.167) * [-760.866] (-760.119) (-760.072) (-759.660) -- 0:00:36 458000 -- [-758.932] (-766.239) (-761.664) (-761.493) * (-760.437) (-760.976) [-761.805] (-760.786) -- 0:00:36 458500 -- [-760.183] (-760.828) (-763.103) (-763.466) * (-759.859) (-761.339) (-760.632) [-760.577] -- 0:00:36 459000 -- [-759.318] (-761.788) (-760.613) (-760.961) * (-759.710) (-762.021) (-760.140) [-759.365] -- 0:00:36 459500 -- [-758.493] (-763.783) (-763.038) (-762.096) * [-760.943] (-760.950) (-761.392) (-761.022) -- 0:00:36 460000 -- [-759.694] (-759.478) (-759.358) (-761.289) * [-760.909] (-766.080) (-760.008) (-760.319) -- 0:00:36 Average standard deviation of split frequencies: 0.009278 460500 -- (-760.285) (-763.617) [-764.019] (-763.124) * (-760.566) (-760.877) (-761.744) [-762.605] -- 0:00:36 461000 -- (-768.097) (-758.378) [-760.327] (-762.011) * (-764.448) (-761.615) [-760.547] (-762.496) -- 0:00:36 461500 -- (-760.492) [-761.311] (-759.531) (-763.217) * (-759.005) [-761.318] (-759.528) (-762.376) -- 0:00:36 462000 -- (-762.438) (-761.268) (-759.122) [-761.399] * (-761.001) (-762.103) [-762.183] (-760.431) -- 0:00:36 462500 -- (-760.488) [-760.325] (-760.989) (-760.210) * (-758.945) (-760.424) (-763.218) [-761.584] -- 0:00:36 463000 -- (-761.279) [-757.936] (-761.451) (-761.793) * (-761.204) (-762.241) [-761.257] (-762.367) -- 0:00:35 463500 -- (-759.594) [-759.798] (-759.175) (-760.314) * (-762.061) (-760.231) [-761.039] (-762.454) -- 0:00:35 464000 -- (-759.839) [-761.781] (-758.785) (-761.507) * (-762.959) (-764.216) (-763.921) [-761.804] -- 0:00:35 464500 -- (-761.917) (-760.940) (-761.822) [-760.554] * (-762.519) (-762.926) (-761.677) [-760.233] -- 0:00:35 465000 -- (-760.319) (-760.080) (-759.057) [-759.087] * [-761.181] (-762.051) (-761.842) (-761.920) -- 0:00:35 Average standard deviation of split frequencies: 0.009307 465500 -- (-759.723) (-761.942) (-759.288) [-760.906] * [-765.689] (-762.412) (-760.386) (-762.044) -- 0:00:35 466000 -- (-762.160) (-760.645) [-759.589] (-759.067) * (-761.414) (-765.115) [-760.249] (-759.561) -- 0:00:35 466500 -- (-760.823) [-758.369] (-765.471) (-761.816) * (-760.765) (-764.274) (-760.149) [-760.746] -- 0:00:35 467000 -- [-761.382] (-758.273) (-761.543) (-759.284) * [-763.462] (-760.859) (-758.891) (-761.725) -- 0:00:35 467500 -- (-757.842) (-760.570) [-758.749] (-763.297) * (-759.957) (-762.176) [-761.628] (-763.798) -- 0:00:35 468000 -- [-761.133] (-758.877) (-764.077) (-762.346) * [-759.831] (-761.325) (-762.771) (-762.828) -- 0:00:35 468500 -- (-762.804) (-761.538) (-761.483) [-761.271] * (-762.672) (-763.476) [-761.642] (-757.421) -- 0:00:35 469000 -- (-762.981) [-762.318] (-762.675) (-760.867) * (-760.641) (-758.979) [-760.610] (-760.732) -- 0:00:35 469500 -- [-759.565] (-759.247) (-761.496) (-760.620) * [-759.295] (-758.260) (-764.012) (-760.531) -- 0:00:35 470000 -- (-758.176) (-767.293) [-758.981] (-757.931) * (-759.471) (-758.648) (-763.919) [-759.453] -- 0:00:34 Average standard deviation of split frequencies: 0.009281 470500 -- (-759.861) [-762.185] (-760.011) (-762.999) * (-758.371) [-759.599] (-759.883) (-762.336) -- 0:00:36 471000 -- (-760.394) (-761.027) [-759.917] (-760.790) * (-760.207) [-759.216] (-760.465) (-758.944) -- 0:00:35 471500 -- (-759.834) [-762.245] (-759.950) (-761.613) * [-760.344] (-759.169) (-763.347) (-758.122) -- 0:00:35 472000 -- [-758.868] (-761.897) (-760.503) (-760.492) * [-760.128] (-759.930) (-763.299) (-758.669) -- 0:00:35 472500 -- (-761.694) (-761.291) [-758.159] (-760.493) * [-761.255] (-759.268) (-764.245) (-759.888) -- 0:00:35 473000 -- (-762.653) (-762.425) [-762.519] (-760.884) * [-760.326] (-760.669) (-760.348) (-759.023) -- 0:00:35 473500 -- (-764.730) (-760.245) (-763.248) [-759.292] * (-765.006) (-758.180) [-758.152] (-761.097) -- 0:00:35 474000 -- [-759.637] (-762.598) (-764.728) (-759.444) * (-761.801) (-761.817) [-757.848] (-759.632) -- 0:00:35 474500 -- (-760.889) [-759.856] (-762.997) (-756.576) * (-758.303) (-764.534) [-758.545] (-758.797) -- 0:00:35 475000 -- (-764.953) (-760.311) [-761.466] (-758.948) * [-762.145] (-770.379) (-762.468) (-760.234) -- 0:00:35 Average standard deviation of split frequencies: 0.009705 475500 -- (-764.247) (-758.710) [-764.327] (-759.306) * (-761.027) (-762.772) [-760.189] (-760.746) -- 0:00:35 476000 -- (-764.795) (-762.215) [-760.340] (-761.258) * [-759.728] (-760.121) (-762.259) (-761.784) -- 0:00:35 476500 -- (-762.704) (-763.292) [-762.014] (-758.368) * [-758.911] (-760.649) (-760.777) (-759.233) -- 0:00:35 477000 -- (-762.315) [-761.357] (-762.758) (-758.957) * [-760.529] (-762.188) (-759.833) (-759.181) -- 0:00:35 477500 -- (-761.958) (-762.163) (-761.787) [-759.634] * (-767.393) (-761.302) [-762.769] (-759.964) -- 0:00:35 478000 -- (-761.651) [-763.325] (-759.468) (-759.250) * [-759.413] (-759.049) (-760.266) (-762.740) -- 0:00:34 478500 -- (-762.849) [-765.560] (-763.481) (-759.309) * (-759.861) [-757.803] (-760.953) (-761.493) -- 0:00:34 479000 -- (-762.201) (-758.720) (-761.577) [-758.431] * (-759.040) (-761.114) [-759.213] (-762.731) -- 0:00:34 479500 -- (-762.175) (-759.866) [-761.637] (-761.054) * (-759.744) (-761.775) (-759.074) [-759.393] -- 0:00:34 480000 -- (-761.617) (-760.820) [-760.350] (-766.923) * (-761.102) (-758.290) (-760.225) [-757.301] -- 0:00:34 Average standard deviation of split frequencies: 0.009284 480500 -- [-760.294] (-761.323) (-758.275) (-759.520) * [-757.047] (-761.292) (-760.858) (-760.290) -- 0:00:34 481000 -- [-760.277] (-761.546) (-758.928) (-762.531) * (-760.362) [-760.677] (-760.404) (-762.811) -- 0:00:34 481500 -- (-759.973) [-759.733] (-759.356) (-759.721) * [-758.698] (-760.229) (-761.055) (-759.819) -- 0:00:34 482000 -- [-761.336] (-758.308) (-759.575) (-760.397) * (-760.635) (-760.312) (-760.680) [-759.228] -- 0:00:34 482500 -- (-758.946) [-760.158] (-760.665) (-758.141) * [-760.743] (-760.244) (-760.858) (-761.913) -- 0:00:34 483000 -- (-758.776) (-760.558) (-760.880) [-760.088] * (-761.888) (-761.095) (-763.204) [-759.571] -- 0:00:34 483500 -- (-758.951) (-758.662) (-760.622) [-758.234] * [-762.070] (-761.090) (-761.919) (-758.390) -- 0:00:34 484000 -- (-761.630) [-758.275] (-761.113) (-758.766) * (-758.802) (-761.138) (-761.131) [-760.043] -- 0:00:34 484500 -- (-759.890) (-759.541) [-759.542] (-762.480) * [-759.743] (-759.729) (-760.162) (-760.702) -- 0:00:34 485000 -- (-761.003) [-762.685] (-761.715) (-763.373) * [-760.104] (-762.768) (-760.881) (-759.750) -- 0:00:33 Average standard deviation of split frequencies: 0.008471 485500 -- [-761.432] (-760.789) (-759.359) (-762.326) * (-760.653) (-760.831) (-759.811) [-758.737] -- 0:00:33 486000 -- (-760.117) [-762.021] (-760.537) (-759.264) * [-761.177] (-760.625) (-760.055) (-759.943) -- 0:00:34 486500 -- (-760.508) [-759.260] (-761.436) (-758.533) * (-759.865) [-760.289] (-760.932) (-759.934) -- 0:00:34 487000 -- (-759.756) (-765.549) [-759.152] (-757.946) * (-760.145) [-760.360] (-761.781) (-760.145) -- 0:00:34 487500 -- (-761.543) (-762.690) (-760.732) [-758.523] * (-759.705) [-759.176] (-761.044) (-764.152) -- 0:00:34 488000 -- (-759.556) (-761.069) (-759.705) [-761.582] * [-760.614] (-760.278) (-761.038) (-760.792) -- 0:00:34 488500 -- [-760.131] (-760.566) (-762.001) (-761.943) * (-761.146) (-758.117) (-761.032) [-761.008] -- 0:00:34 489000 -- (-762.394) (-760.390) [-760.837] (-760.365) * (-760.615) (-762.067) [-761.123] (-766.835) -- 0:00:34 489500 -- (-765.651) [-759.203] (-759.835) (-758.502) * (-761.540) [-759.795] (-760.809) (-764.001) -- 0:00:34 490000 -- (-761.550) (-759.435) (-761.036) [-757.429] * [-761.026] (-762.679) (-761.363) (-764.350) -- 0:00:34 Average standard deviation of split frequencies: 0.008455 490500 -- (-760.420) [-760.735] (-757.920) (-761.740) * [-759.410] (-761.688) (-762.525) (-762.906) -- 0:00:34 491000 -- (-759.199) (-761.168) (-760.736) [-760.010] * [-761.924] (-760.702) (-763.776) (-761.470) -- 0:00:34 491500 -- (-759.258) (-760.581) [-765.247] (-758.656) * (-760.689) (-761.349) (-761.117) [-762.983] -- 0:00:34 492000 -- (-758.970) (-762.097) (-761.173) [-759.285] * (-761.524) (-762.956) [-759.736] (-759.758) -- 0:00:34 492500 -- (-758.108) [-760.143] (-762.469) (-758.819) * (-761.888) [-762.534] (-759.981) (-763.392) -- 0:00:34 493000 -- (-758.626) (-759.635) [-761.409] (-760.799) * [-761.987] (-760.559) (-762.330) (-765.066) -- 0:00:33 493500 -- (-759.517) [-759.868] (-758.808) (-759.547) * (-761.337) [-759.639] (-760.128) (-761.986) -- 0:00:33 494000 -- (-760.836) (-765.311) (-761.107) [-760.283] * (-763.050) (-763.327) (-761.957) [-758.673] -- 0:00:33 494500 -- (-759.008) [-760.114] (-760.265) (-759.384) * [-762.410] (-763.455) (-759.405) (-760.099) -- 0:00:33 495000 -- (-758.491) (-763.228) [-759.007] (-760.112) * (-761.867) (-761.029) (-763.086) [-759.709] -- 0:00:33 Average standard deviation of split frequencies: 0.008744 495500 -- (-760.232) (-762.613) (-758.842) [-761.560] * (-761.140) (-758.496) (-759.690) [-759.599] -- 0:00:33 496000 -- (-765.231) (-759.630) (-760.498) [-762.635] * [-760.976] (-758.866) (-760.645) (-759.057) -- 0:00:33 496500 -- (-759.967) (-760.359) [-760.088] (-762.255) * (-759.516) [-758.513] (-762.282) (-759.934) -- 0:00:33 497000 -- (-760.060) [-767.769] (-758.697) (-761.306) * (-761.311) [-758.463] (-767.373) (-760.270) -- 0:00:33 497500 -- [-759.886] (-762.169) (-760.264) (-762.924) * [-760.144] (-761.168) (-763.765) (-761.387) -- 0:00:33 498000 -- (-759.522) [-763.115] (-760.648) (-758.208) * (-759.364) (-761.649) (-760.717) [-762.157] -- 0:00:33 498500 -- (-760.316) (-761.729) (-758.630) [-758.615] * (-760.590) (-759.289) (-761.904) [-761.864] -- 0:00:33 499000 -- (-759.181) [-760.179] (-758.234) (-758.401) * (-761.339) (-759.591) (-762.544) [-762.484] -- 0:00:33 499500 -- (-761.054) (-760.732) (-758.158) [-758.768] * [-762.656] (-759.897) (-762.033) (-766.084) -- 0:00:33 500000 -- (-759.960) [-759.659] (-763.561) (-761.098) * (-761.220) [-757.380] (-760.556) (-761.487) -- 0:00:33 Average standard deviation of split frequencies: 0.008286 500500 -- (-759.640) (-763.325) [-761.946] (-761.208) * (-760.835) [-758.222] (-759.789) (-761.441) -- 0:00:32 501000 -- (-761.858) [-757.624] (-759.530) (-763.687) * [-760.592] (-757.910) (-761.934) (-763.692) -- 0:00:32 501500 -- (-760.758) (-760.247) [-759.549] (-758.523) * [-760.235] (-758.598) (-759.517) (-760.517) -- 0:00:32 502000 -- (-765.295) (-759.765) [-759.560] (-759.083) * (-761.346) (-761.074) [-761.684] (-759.427) -- 0:00:33 502500 -- [-759.238] (-761.133) (-761.340) (-761.243) * [-759.616] (-762.431) (-760.130) (-762.730) -- 0:00:33 503000 -- (-761.016) (-761.247) [-760.860] (-761.325) * (-762.675) (-761.854) (-762.191) [-759.309] -- 0:00:33 503500 -- [-760.428] (-773.227) (-763.134) (-761.076) * (-759.387) [-764.043] (-763.048) (-758.600) -- 0:00:33 504000 -- [-760.595] (-764.144) (-761.823) (-759.113) * (-759.704) (-764.832) [-760.680] (-765.331) -- 0:00:33 504500 -- (-757.569) [-759.675] (-758.375) (-762.531) * (-761.766) (-760.700) [-762.871] (-766.048) -- 0:00:33 505000 -- (-760.341) (-758.823) (-759.534) [-757.732] * (-758.458) (-760.859) (-761.072) [-758.991] -- 0:00:33 Average standard deviation of split frequencies: 0.008385 505500 -- (-759.561) [-759.638] (-759.868) (-760.392) * (-763.922) (-760.666) [-758.421] (-760.274) -- 0:00:33 506000 -- (-761.392) [-758.993] (