--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:50:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0513/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -759.31 -764.70
2 -759.24 -762.25
--------------------------------------
TOTAL -759.28 -764.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871156 0.088380 0.328458 1.439747 0.837733 1501.00 1501.00 1.000
r(A<->C){all} 0.149309 0.016849 0.000022 0.402140 0.114843 242.53 290.18 1.000
r(A<->G){all} 0.167178 0.020430 0.000006 0.449695 0.124687 284.45 293.45 1.001
r(A<->T){all} 0.150999 0.015644 0.000205 0.396451 0.120602 130.63 149.25 1.000
r(C<->G){all} 0.130760 0.014715 0.000016 0.378455 0.092014 173.78 263.62 1.003
r(C<->T){all} 0.222545 0.025538 0.000024 0.535819 0.195817 218.83 244.78 1.000
r(G<->T){all} 0.179210 0.021796 0.000068 0.468571 0.141471 194.53 195.52 1.000
pi(A){all} 0.175291 0.000261 0.145043 0.207123 0.174994 1272.69 1319.63 1.001
pi(C){all} 0.287616 0.000359 0.252462 0.326704 0.287634 1034.17 1254.96 1.000
pi(G){all} 0.338994 0.000395 0.303089 0.379160 0.339247 1233.42 1277.36 1.000
pi(T){all} 0.198100 0.000280 0.166785 0.231848 0.197840 1203.00 1280.94 1.000
alpha{1,2} 0.315244 0.140951 0.000160 1.004412 0.201657 797.93 1091.76 1.000
alpha{3} 0.404918 0.225307 0.000200 1.373809 0.240165 1286.92 1294.69 1.000
pinvar{all} 0.993789 0.000024 0.984459 0.999861 0.994988 1337.26 1373.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -732.857398
Model 2: PositiveSelection -732.389473
Model 0: one-ratio -732.411807
Model 7: beta -732.857288
Model 8: beta&w>1 -732.389473
Model 0 vs 1 0.8911820000000716
Model 2 vs 1 0.9358500000000731
Model 8 vs 7 0.9356300000001738
>C1
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C2
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C3
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C4
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C5
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C6
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=184
C1 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C2 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C3 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C4 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C5 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C6 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
**************************************************
C1 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C2 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C3 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C4 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C5 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C6 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
**************************************************
C1 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C2 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C3 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C4 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C5 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C6 DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
******.*******************************************
C1 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C2 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C3 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C4 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C5 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C6 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
**********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5520]--->[5520]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.476 Mb, Max= 30.724 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C2 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C3 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C4 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C5 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
C6 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
**************************************************
C1 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C2 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C3 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C4 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C5 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
C6 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
**************************************************
C1 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C2 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C3 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C4 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C5 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
C6 DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
******.*******************************************
C1 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C2 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C3 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C4 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C5 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
C6 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
**********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.46 C1 C6 99.46
TOP 5 0 99.46 C6 C1 99.46
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.46 C2 C6 99.46
TOP 5 1 99.46 C6 C2 99.46
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.46 C3 C6 99.46
TOP 5 2 99.46 C6 C3 99.46
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.46 C4 C6 99.46
TOP 5 3 99.46 C6 C4 99.46
BOT 4 5 99.46 C5 C6 99.46
TOP 5 4 99.46 C6 C5 99.46
AVG 0 C1 * 99.89
AVG 1 C2 * 99.89
AVG 2 C3 * 99.89
AVG 3 C4 * 99.89
AVG 4 C5 * 99.89
AVG 5 C6 * 99.46
TOT TOT * 99.82
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
C2 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
C3 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
C4 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
C5 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
C6 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
**************************************************
C1 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
C2 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
C3 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
C4 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
C5 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
C6 GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
**************************************************
C1 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
C2 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
C3 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
C4 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
C5 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
C6 GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
**************************************************
C1 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
C2 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
C3 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
C4 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
C5 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
C6 ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
**************************************************
C1 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
C2 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
C3 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
C4 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
C5 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
C6 ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
**************************************************
C1 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
C2 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
C3 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
C4 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
C5 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
C6 TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
**************************************************
C1 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
C2 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
C3 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
C4 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
C5 GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
C6 GACACCGCCGAGGCACTAGTACGGCGGGTTGCTCCGGTACCGGTTCGACT
******************* ******************************
C1 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
C2 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
C3 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
C4 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
C5 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
C6 CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
**************************************************
C1 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
C2 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
C3 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
C4 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
C5 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
C6 CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
**************************************************
C1 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
C2 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
C3 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
C4 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
C5 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
C6 GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
**************************************************
C1 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
C2 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
C3 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
C4 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
C5 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
C6 GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
**************************************************
C1 GG
C2 GG
C3 GG
C4 GG
C5 GG
C6 GG
**
>C1
GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
GG
>C2
GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
GG
>C3
GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
GG
>C4
GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
GG
>C5
GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT
CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
GG
>C6
GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT
GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG
GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT
ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG
ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT
TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC
GACACCGCCGAGGCACTAGTACGGCGGGTTGCTCCGGTACCGGTTCGACT
CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG
CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG
GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC
GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG
GG
>C1
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C2
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C3
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C4
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C5
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
>C6
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 552 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579801704
Setting output file names to "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1792720655
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1859468447
Seed = 460686294
Swapseed = 1579801704
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1238.805252 -- -24.965149
Chain 2 -- -1238.805070 -- -24.965149
Chain 3 -- -1238.805252 -- -24.965149
Chain 4 -- -1238.803702 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1238.805252 -- -24.965149
Chain 2 -- -1238.805252 -- -24.965149
Chain 3 -- -1238.805323 -- -24.965149
Chain 4 -- -1238.805323 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1238.805] (-1238.805) (-1238.805) (-1238.804) * [-1238.805] (-1238.805) (-1238.805) (-1238.805)
500 -- (-768.468) (-774.488) [-771.314] (-778.643) * [-768.633] (-774.008) (-762.815) (-768.527) -- 0:00:00
1000 -- (-766.151) (-770.064) [-772.336] (-769.366) * [-760.766] (-764.710) (-764.420) (-766.033) -- 0:00:00
1500 -- [-765.519] (-775.655) (-764.120) (-768.542) * (-762.272) (-765.923) [-763.334] (-768.246) -- 0:00:00
2000 -- [-763.203] (-767.016) (-764.665) (-764.078) * (-760.563) (-764.871) [-761.770] (-764.843) -- 0:00:00
2500 -- [-762.152] (-768.507) (-764.865) (-767.207) * (-775.815) [-764.504] (-771.803) (-765.281) -- 0:00:00
3000 -- (-765.611) (-762.961) [-760.832] (-767.405) * (-765.166) [-764.125] (-774.842) (-763.913) -- 0:00:00
3500 -- (-767.256) (-768.603) (-764.476) [-768.426] * [-766.279] (-764.638) (-762.399) (-771.099) -- 0:00:00
4000 -- (-770.536) (-763.198) [-767.387] (-760.587) * [-759.537] (-774.861) (-764.307) (-763.334) -- 0:00:00
4500 -- (-773.763) (-764.556) [-760.894] (-763.989) * (-765.775) [-763.544] (-762.527) (-772.561) -- 0:00:00
5000 -- [-770.297] (-766.327) (-766.712) (-760.981) * (-768.594) [-767.926] (-766.108) (-769.143) -- 0:00:00
Average standard deviation of split frequencies: 0.111304
5500 -- [-762.763] (-769.571) (-768.313) (-765.801) * (-765.226) (-767.851) (-774.299) [-761.785] -- 0:00:00
6000 -- [-765.416] (-766.548) (-767.776) (-769.578) * (-763.665) [-763.425] (-769.602) (-764.088) -- 0:00:00
6500 -- (-767.779) (-766.560) (-771.693) [-765.933] * (-766.718) (-771.429) [-762.534] (-762.870) -- 0:00:00
7000 -- (-764.186) (-767.955) (-764.577) [-759.766] * [-767.705] (-766.559) (-764.556) (-767.434) -- 0:00:00
7500 -- (-771.068) [-761.719] (-769.999) (-761.153) * (-764.909) (-771.556) (-760.449) [-763.517] -- 0:00:00
8000 -- [-762.689] (-762.689) (-763.107) (-761.941) * [-763.012] (-769.775) (-759.206) (-763.904) -- 0:02:04
8500 -- (-758.229) (-776.951) (-762.931) [-759.832] * [-759.796] (-762.447) (-763.594) (-771.788) -- 0:01:56
9000 -- (-762.376) (-768.475) [-762.364] (-763.205) * [-762.607] (-769.569) (-769.195) (-768.822) -- 0:01:50
9500 -- [-762.627] (-763.875) (-766.185) (-762.336) * (-761.901) (-769.591) [-760.413] (-760.505) -- 0:01:44
10000 -- (-763.315) [-762.221] (-762.122) (-759.871) * (-766.793) (-762.418) (-765.224) [-763.301] -- 0:01:39
Average standard deviation of split frequencies: 0.081759
10500 -- (-766.317) (-769.424) [-760.705] (-761.216) * [-762.048] (-770.116) (-767.248) (-770.699) -- 0:01:34
11000 -- (-766.127) (-777.646) [-763.187] (-760.111) * (-763.416) (-773.660) [-760.422] (-765.876) -- 0:01:29
11500 -- [-765.042] (-778.594) (-766.522) (-759.864) * [-760.431] (-764.840) (-759.752) (-763.689) -- 0:01:25
12000 -- [-772.472] (-758.220) (-770.700) (-761.379) * [-761.474] (-771.440) (-767.126) (-767.288) -- 0:01:22
12500 -- (-773.465) [-760.422] (-765.773) (-759.211) * (-768.713) (-768.541) [-763.463] (-768.235) -- 0:01:19
13000 -- (-767.250) [-758.070] (-762.786) (-765.327) * [-761.504] (-759.944) (-762.685) (-769.128) -- 0:01:15
13500 -- (-766.716) (-757.904) (-770.676) [-760.276] * (-768.980) (-759.149) (-770.495) [-775.216] -- 0:01:13
14000 -- (-761.633) [-757.829] (-772.543) (-760.936) * (-766.959) (-760.879) [-764.642] (-770.380) -- 0:01:10
14500 -- (-765.896) [-759.040] (-771.064) (-760.721) * (-761.617) (-759.011) (-766.854) [-762.934] -- 0:01:07
15000 -- (-761.004) [-757.468] (-770.955) (-761.570) * [-764.113] (-758.690) (-763.880) (-764.372) -- 0:01:05
Average standard deviation of split frequencies: 0.057375
15500 -- (-763.263) (-758.064) (-760.237) [-761.439] * (-771.960) (-759.315) (-760.571) [-761.769] -- 0:01:03
16000 -- (-761.909) [-759.318] (-763.146) (-761.973) * (-761.939) [-756.973] (-767.112) (-763.750) -- 0:01:01
16500 -- (-762.293) [-760.107] (-760.321) (-763.279) * (-767.897) (-758.460) (-764.638) [-765.985] -- 0:00:59
17000 -- (-760.942) [-759.129] (-761.474) (-761.034) * (-767.917) (-759.058) [-764.176] (-764.654) -- 0:00:57
17500 -- [-765.571] (-763.023) (-762.989) (-762.085) * (-764.078) (-757.567) [-763.250] (-767.389) -- 0:00:56
18000 -- (-761.847) (-761.227) (-770.543) [-762.795] * [-762.569] (-763.630) (-770.379) (-766.803) -- 0:00:54
18500 -- (-758.716) [-761.167] (-762.123) (-765.197) * [-768.718] (-757.629) (-763.091) (-764.338) -- 0:00:53
19000 -- (-765.205) (-760.342) [-761.563] (-759.707) * [-763.815] (-759.842) (-772.097) (-767.322) -- 0:00:51
19500 -- (-759.466) (-760.313) [-759.203] (-762.345) * (-768.225) (-758.786) [-764.710] (-768.979) -- 0:00:50
20000 -- (-758.355) (-758.726) [-760.689] (-761.468) * (-760.917) (-758.177) (-768.458) [-762.204] -- 0:00:49
Average standard deviation of split frequencies: 0.057785
20500 -- [-762.123] (-758.761) (-761.974) (-761.192) * (-766.773) (-757.169) (-763.939) [-767.126] -- 0:00:47
21000 -- (-763.341) (-764.776) [-760.495] (-759.162) * (-772.193) (-757.295) (-764.550) [-760.262] -- 0:00:46
21500 -- [-758.571] (-766.857) (-761.126) (-759.888) * (-770.183) (-757.310) (-765.442) [-761.115] -- 0:00:45
22000 -- (-759.222) (-762.106) (-759.770) [-762.384] * (-765.140) (-761.512) (-764.443) [-767.131] -- 0:00:44
22500 -- (-759.791) [-761.338] (-761.031) (-762.730) * (-769.134) (-758.259) [-766.006] (-764.636) -- 0:00:43
23000 -- [-759.861] (-764.003) (-763.956) (-762.992) * (-763.881) [-757.976] (-767.575) (-771.508) -- 0:00:42
23500 -- (-759.253) (-760.042) (-762.213) [-761.500] * (-766.583) (-759.551) [-765.736] (-767.497) -- 0:01:23
24000 -- [-758.212] (-761.036) (-761.685) (-760.594) * (-769.311) [-757.559] (-763.024) (-762.530) -- 0:01:21
24500 -- [-758.648] (-759.067) (-761.336) (-759.796) * (-768.346) (-760.764) [-766.289] (-761.885) -- 0:01:19
25000 -- [-760.940] (-761.859) (-760.791) (-761.233) * [-762.152] (-758.358) (-766.824) (-768.608) -- 0:01:18
Average standard deviation of split frequencies: 0.039558
25500 -- (-759.556) (-757.858) [-760.506] (-758.036) * [-762.593] (-756.981) (-768.080) (-761.312) -- 0:01:16
26000 -- [-765.643] (-758.905) (-761.664) (-759.431) * (-769.736) [-760.519] (-762.712) (-767.497) -- 0:01:14
26500 -- (-759.180) (-767.912) [-757.820] (-761.496) * [-766.159] (-763.302) (-768.134) (-770.692) -- 0:01:13
27000 -- (-760.970) (-760.967) (-760.814) [-760.946] * [-757.020] (-762.885) (-766.728) (-770.852) -- 0:01:12
27500 -- (-758.791) (-759.929) (-760.742) [-760.075] * [-766.843] (-758.786) (-762.577) (-764.507) -- 0:01:10
28000 -- [-762.544] (-760.112) (-762.173) (-759.085) * (-780.203) (-759.157) [-762.669] (-769.004) -- 0:01:09
28500 -- (-762.550) [-759.619] (-762.321) (-762.127) * [-765.939] (-762.529) (-763.519) (-765.500) -- 0:01:08
29000 -- (-758.350) [-760.545] (-761.743) (-758.007) * [-762.575] (-761.812) (-763.168) (-761.817) -- 0:01:06
29500 -- (-759.058) (-761.705) (-762.130) [-760.791] * [-766.397] (-762.700) (-760.993) (-763.473) -- 0:01:05
30000 -- (-758.366) (-758.300) [-760.463] (-760.796) * (-759.526) (-758.228) [-761.199] (-762.528) -- 0:01:04
Average standard deviation of split frequencies: 0.038430
30500 -- (-762.536) [-758.747] (-762.590) (-762.069) * (-771.061) (-761.105) [-759.735] (-764.480) -- 0:01:03
31000 -- (-763.774) (-762.755) (-764.347) [-758.517] * (-775.700) (-760.344) (-757.558) [-766.355] -- 0:01:02
31500 -- (-759.870) [-760.542] (-768.821) (-760.881) * (-769.040) (-759.938) [-767.466] (-784.232) -- 0:01:01
32000 -- (-759.240) (-757.625) (-763.518) [-757.618] * (-776.906) (-762.667) [-760.559] (-767.050) -- 0:01:00
32500 -- (-758.389) [-758.048] (-758.200) (-758.871) * (-773.418) (-762.882) [-759.947] (-761.889) -- 0:00:59
33000 -- (-758.665) (-757.195) (-759.425) [-761.785] * (-764.050) (-757.305) [-766.400] (-761.669) -- 0:00:58
33500 -- [-760.743] (-759.216) (-759.752) (-761.436) * [-766.041] (-758.258) (-765.478) (-758.901) -- 0:00:57
34000 -- [-759.748] (-759.828) (-760.250) (-762.800) * (-762.318) (-758.517) [-763.825] (-761.414) -- 0:00:56
34500 -- (-766.260) (-758.705) [-762.665] (-762.386) * [-760.541] (-760.278) (-766.894) (-760.801) -- 0:00:55
35000 -- (-766.565) [-761.442] (-761.109) (-761.531) * (-767.439) [-762.341] (-766.317) (-758.796) -- 0:00:55
Average standard deviation of split frequencies: 0.035712
35500 -- [-762.933] (-761.771) (-762.020) (-762.449) * (-764.224) (-762.420) [-762.954] (-759.558) -- 0:00:54
36000 -- (-761.319) (-762.520) [-759.012] (-762.828) * (-770.850) (-764.938) [-764.531] (-760.216) -- 0:00:53
36500 -- [-760.004] (-761.865) (-760.654) (-761.745) * [-760.148] (-766.851) (-771.825) (-760.206) -- 0:00:52
37000 -- (-758.113) (-760.369) [-759.332] (-760.991) * (-772.692) [-762.844] (-767.395) (-761.719) -- 0:00:52
37500 -- [-757.382] (-761.241) (-762.570) (-758.247) * (-767.494) (-759.865) [-773.192] (-761.856) -- 0:00:51
38000 -- [-758.948] (-759.577) (-758.937) (-760.110) * [-763.263] (-763.168) (-764.390) (-761.116) -- 0:00:50
38500 -- (-760.296) (-757.331) (-763.468) [-756.982] * (-764.645) (-765.978) [-767.080] (-764.327) -- 0:00:49
39000 -- (-758.425) [-761.772] (-761.257) (-757.992) * [-762.820] (-761.817) (-765.702) (-762.057) -- 0:01:13
39500 -- [-762.226] (-759.060) (-760.011) (-763.871) * (-761.162) (-758.313) [-763.456] (-766.373) -- 0:01:12
40000 -- (-759.382) (-760.142) [-760.385] (-757.496) * (-760.142) (-759.983) (-759.357) [-759.364] -- 0:01:12
Average standard deviation of split frequencies: 0.035328
40500 -- (-760.685) (-760.915) (-760.747) [-758.522] * [-758.775] (-759.806) (-776.653) (-768.121) -- 0:01:11
41000 -- (-757.909) [-759.743] (-759.114) (-760.350) * (-761.529) (-760.262) [-760.083] (-760.550) -- 0:01:10
41500 -- (-759.685) [-758.469] (-759.206) (-761.693) * (-759.382) [-758.593] (-757.538) (-761.071) -- 0:01:09
42000 -- (-759.217) [-757.885] (-761.788) (-760.118) * (-759.277) (-759.902) (-760.946) [-760.136] -- 0:01:08
42500 -- (-757.764) [-762.085] (-765.496) (-759.264) * (-762.275) (-759.509) (-761.260) [-763.142] -- 0:01:07
43000 -- [-759.003] (-761.717) (-760.278) (-758.737) * (-759.541) [-758.488] (-758.753) (-759.482) -- 0:01:06
43500 -- (-761.320) [-758.881] (-758.588) (-758.587) * [-757.857] (-758.313) (-761.570) (-760.364) -- 0:01:05
44000 -- (-762.487) [-759.633] (-762.864) (-756.880) * (-758.545) (-759.692) (-763.070) [-760.671] -- 0:01:05
44500 -- (-758.767) [-757.688] (-758.219) (-762.017) * (-762.384) (-758.809) [-763.017] (-762.373) -- 0:01:04
45000 -- (-757.701) (-761.539) [-757.337] (-761.821) * (-762.314) (-759.602) [-761.111] (-759.365) -- 0:01:03
Average standard deviation of split frequencies: 0.030744
45500 -- (-760.651) (-757.684) [-759.962] (-761.475) * (-760.729) (-762.646) [-763.516] (-760.770) -- 0:01:02
46000 -- [-761.571] (-761.827) (-758.021) (-759.057) * (-760.184) (-761.793) (-761.701) [-759.966] -- 0:01:02
46500 -- (-761.748) [-760.201] (-761.781) (-761.489) * (-760.237) [-760.579] (-766.282) (-759.883) -- 0:01:01
47000 -- (-760.462) (-762.011) [-762.116] (-764.059) * (-760.667) (-758.720) (-761.260) [-759.055] -- 0:01:00
47500 -- (-759.388) (-759.112) (-762.633) [-762.122] * (-759.177) (-759.493) (-761.484) [-760.862] -- 0:01:00
48000 -- (-758.643) [-761.277] (-759.939) (-759.721) * (-760.435) (-757.658) (-760.443) [-759.841] -- 0:00:59
48500 -- [-757.444] (-759.344) (-759.929) (-763.699) * [-763.656] (-762.262) (-759.656) (-758.452) -- 0:00:58
49000 -- (-758.999) [-759.596] (-760.946) (-759.337) * (-765.826) [-760.478] (-762.406) (-759.282) -- 0:00:58
49500 -- [-759.827] (-759.935) (-760.525) (-760.880) * (-760.025) (-759.718) [-761.805] (-758.897) -- 0:00:57
50000 -- (-757.137) (-758.762) (-763.544) [-760.249] * (-765.383) (-759.002) (-763.136) [-759.466] -- 0:00:57
Average standard deviation of split frequencies: 0.027912
50500 -- (-758.170) (-760.857) (-764.029) [-760.009] * [-763.444] (-763.364) (-760.701) (-758.641) -- 0:00:56
51000 -- (-758.428) [-761.716] (-762.219) (-761.152) * [-761.696] (-761.321) (-761.771) (-761.360) -- 0:00:55
51500 -- (-756.827) (-760.721) (-757.940) [-762.508] * (-760.182) (-759.248) (-760.217) [-761.062] -- 0:00:55
52000 -- (-758.368) [-757.933] (-758.947) (-760.637) * (-766.222) [-760.333] (-758.602) (-760.367) -- 0:00:54
52500 -- [-758.579] (-760.618) (-760.476) (-759.991) * (-762.621) (-760.913) [-759.310] (-761.002) -- 0:00:54
53000 -- [-760.487] (-758.618) (-757.437) (-762.613) * (-762.857) [-759.483] (-762.627) (-765.117) -- 0:00:53
53500 -- [-760.562] (-760.098) (-758.210) (-761.638) * [-760.719] (-759.881) (-764.753) (-762.600) -- 0:00:53
54000 -- [-758.973] (-761.228) (-763.024) (-761.839) * (-759.901) (-760.483) [-763.630] (-765.045) -- 0:00:52
54500 -- (-760.303) (-760.649) (-758.204) [-761.648] * (-762.379) (-763.516) (-762.885) [-760.039] -- 0:01:09
55000 -- (-761.140) [-760.129] (-760.457) (-762.756) * [-760.030] (-763.438) (-760.986) (-763.677) -- 0:01:08
Average standard deviation of split frequencies: 0.039143
55500 -- (-760.304) (-762.501) (-758.525) [-758.961] * [-761.758] (-759.534) (-762.423) (-762.409) -- 0:01:08
56000 -- (-759.600) (-761.717) [-759.305] (-758.786) * (-761.883) [-757.978] (-760.225) (-761.004) -- 0:01:07
56500 -- (-761.285) (-761.711) (-763.684) [-759.592] * (-759.590) (-760.049) [-759.421] (-761.840) -- 0:01:06
57000 -- (-762.009) (-758.841) [-758.444] (-761.349) * [-759.832] (-759.929) (-761.569) (-760.722) -- 0:01:06
57500 -- (-761.739) (-759.955) [-760.614] (-760.616) * (-759.735) (-759.865) [-757.474] (-761.128) -- 0:01:05
58000 -- (-762.394) (-761.598) (-763.068) [-761.355] * (-760.347) [-760.831] (-758.309) (-760.679) -- 0:01:04
58500 -- [-760.156] (-761.156) (-765.186) (-761.465) * (-759.429) (-760.948) [-760.881] (-764.264) -- 0:01:04
59000 -- [-758.595] (-761.399) (-760.501) (-760.735) * [-764.556] (-759.333) (-758.206) (-762.164) -- 0:01:03
59500 -- (-758.443) (-763.510) [-762.730] (-761.359) * (-764.180) [-761.919] (-759.447) (-761.567) -- 0:01:03
60000 -- (-760.288) [-759.702] (-760.578) (-759.801) * (-761.152) (-760.401) [-758.672] (-761.205) -- 0:01:02
Average standard deviation of split frequencies: 0.041442
60500 -- (-760.006) (-759.572) [-758.910] (-762.489) * (-762.051) [-761.556] (-758.042) (-762.284) -- 0:01:02
61000 -- (-757.068) (-761.047) [-759.117] (-762.277) * [-760.343] (-762.565) (-762.101) (-760.366) -- 0:01:01
61500 -- (-758.215) [-760.595] (-758.226) (-761.204) * [-760.291] (-759.531) (-762.091) (-759.695) -- 0:01:01
62000 -- (-758.281) (-765.329) [-760.715] (-760.876) * (-759.097) (-763.941) [-762.153] (-760.678) -- 0:01:00
62500 -- (-757.671) (-764.101) [-761.924] (-761.084) * (-758.154) (-760.180) [-760.152] (-769.163) -- 0:01:00
63000 -- [-761.751] (-760.216) (-763.481) (-759.948) * (-759.116) (-760.487) [-759.965] (-761.398) -- 0:00:59
63500 -- (-758.410) [-760.059] (-762.257) (-759.767) * [-758.465] (-759.995) (-761.740) (-760.060) -- 0:00:58
64000 -- (-760.118) (-759.385) (-759.639) [-761.558] * [-762.865] (-758.481) (-764.938) (-760.618) -- 0:00:58
64500 -- (-763.099) (-761.479) [-762.200] (-760.006) * [-759.375] (-758.333) (-760.712) (-763.595) -- 0:00:58
65000 -- (-761.134) (-763.779) [-758.714] (-759.441) * [-758.542] (-760.904) (-761.770) (-760.311) -- 0:00:57
Average standard deviation of split frequencies: 0.038212
65500 -- [-758.236] (-760.761) (-759.236) (-761.518) * [-760.839] (-758.608) (-761.959) (-761.257) -- 0:00:57
66000 -- (-762.428) (-760.241) [-759.284] (-761.959) * (-762.260) [-759.914] (-763.153) (-760.733) -- 0:00:56
66500 -- [-759.851] (-761.371) (-760.990) (-761.425) * (-764.071) [-764.863] (-765.478) (-762.954) -- 0:00:56
67000 -- [-759.863] (-760.477) (-760.342) (-763.346) * (-762.891) (-759.238) (-760.340) [-764.716] -- 0:00:55
67500 -- (-757.384) (-759.832) [-759.006] (-761.907) * (-760.795) [-759.298] (-760.548) (-761.729) -- 0:00:55
68000 -- (-758.721) (-761.035) [-758.136] (-761.602) * (-762.085) (-760.640) (-759.785) [-767.095] -- 0:00:54
68500 -- (-759.338) [-760.966] (-760.842) (-761.395) * (-760.951) (-760.554) [-760.481] (-766.424) -- 0:00:54
69000 -- (-760.013) (-762.843) [-757.734] (-762.050) * [-759.759] (-763.739) (-759.001) (-762.837) -- 0:00:53
69500 -- (-761.271) [-759.154] (-756.857) (-760.790) * (-759.155) (-760.037) [-758.862] (-763.027) -- 0:00:53
70000 -- (-758.640) (-760.516) [-759.190] (-760.293) * (-758.626) (-762.248) [-759.754] (-763.867) -- 0:01:06
Average standard deviation of split frequencies: 0.037801
70500 -- [-760.685] (-760.504) (-763.909) (-760.600) * (-762.759) (-758.872) (-761.511) [-760.900] -- 0:01:05
71000 -- (-758.409) [-758.594] (-763.030) (-761.754) * (-757.797) [-759.419] (-761.755) (-761.238) -- 0:01:05
71500 -- (-758.789) (-760.885) (-762.967) [-760.595] * (-759.796) (-759.385) [-760.192] (-763.936) -- 0:01:04
72000 -- (-759.748) (-759.553) [-762.023] (-762.974) * (-759.776) [-760.086] (-764.778) (-760.258) -- 0:01:04
72500 -- [-758.392] (-761.051) (-758.365) (-761.283) * (-760.617) [-760.169] (-762.165) (-762.408) -- 0:01:03
73000 -- (-758.661) (-760.317) [-757.734] (-763.691) * (-760.360) [-762.791] (-763.781) (-764.336) -- 0:01:03
73500 -- [-762.972] (-771.941) (-760.181) (-760.170) * (-758.061) (-760.815) (-764.744) [-761.154] -- 0:01:03
74000 -- [-760.280] (-761.944) (-761.380) (-761.595) * (-762.047) [-760.032] (-761.735) (-764.063) -- 0:01:02
74500 -- [-760.179] (-765.668) (-760.864) (-761.626) * (-759.469) [-758.569] (-762.885) (-763.768) -- 0:01:02
75000 -- (-759.987) (-765.526) [-759.253] (-760.217) * [-758.018] (-760.840) (-760.550) (-764.817) -- 0:01:01
Average standard deviation of split frequencies: 0.037836
75500 -- [-759.370] (-762.350) (-757.925) (-760.539) * (-757.938) (-759.091) (-760.985) [-762.418] -- 0:01:01
76000 -- (-760.794) [-759.707] (-762.504) (-762.184) * [-759.235] (-762.151) (-761.015) (-759.990) -- 0:01:00
76500 -- [-760.861] (-760.124) (-761.406) (-760.227) * [-760.243] (-762.303) (-759.899) (-763.509) -- 0:01:00
77000 -- (-760.818) [-760.148] (-764.458) (-762.191) * (-759.126) (-761.254) [-760.769] (-761.688) -- 0:00:59
77500 -- (-760.528) [-759.799] (-759.824) (-761.364) * [-760.917] (-763.745) (-759.880) (-759.478) -- 0:00:59
78000 -- (-759.555) [-757.784] (-760.120) (-765.426) * (-760.049) [-762.824] (-761.418) (-760.522) -- 0:00:59
78500 -- (-763.749) [-759.804] (-758.258) (-770.066) * (-758.875) (-763.216) [-760.642] (-762.143) -- 0:00:58
79000 -- (-759.472) (-762.293) (-761.786) [-764.874] * (-759.155) (-761.470) (-760.852) [-758.550] -- 0:00:58
79500 -- (-759.602) (-758.710) (-762.054) [-761.133] * (-759.682) (-761.912) [-758.588] (-762.884) -- 0:00:57
80000 -- (-760.472) [-761.432] (-760.822) (-762.445) * (-758.380) [-759.435] (-759.068) (-759.029) -- 0:00:57
Average standard deviation of split frequencies: 0.034448
80500 -- (-760.962) (-760.879) [-760.948] (-763.036) * (-765.217) [-760.369] (-761.887) (-764.270) -- 0:00:57
81000 -- (-760.176) (-760.660) [-760.382] (-761.300) * (-764.775) (-762.258) [-761.316] (-759.502) -- 0:00:56
81500 -- (-759.684) (-760.675) [-759.260] (-758.227) * (-758.696) (-764.286) [-760.517] (-760.693) -- 0:00:56
82000 -- (-760.171) (-761.280) (-760.977) [-762.124] * (-763.367) (-760.876) [-761.046] (-762.566) -- 0:00:55
82500 -- (-760.751) (-760.000) [-758.043] (-760.589) * (-762.171) (-760.503) (-759.266) [-758.434] -- 0:00:55
83000 -- (-759.368) (-760.327) [-757.683] (-763.755) * (-761.730) (-761.628) [-760.662] (-762.261) -- 0:00:55
83500 -- [-757.558] (-760.986) (-758.920) (-764.557) * [-760.076] (-760.052) (-760.800) (-762.947) -- 0:00:54
84000 -- (-759.967) (-760.870) [-760.802] (-760.172) * (-763.207) [-758.652] (-764.149) (-759.810) -- 0:00:54
84500 -- [-760.404] (-765.580) (-762.191) (-763.766) * (-759.852) [-760.758] (-760.457) (-762.689) -- 0:00:54
85000 -- [-758.285] (-760.284) (-762.202) (-760.796) * (-759.210) [-763.434] (-760.891) (-760.446) -- 0:00:53
Average standard deviation of split frequencies: 0.034043
85500 -- (-767.453) [-761.807] (-760.249) (-758.481) * (-759.260) (-759.847) [-760.594] (-758.979) -- 0:01:04
86000 -- (-761.754) [-762.095] (-760.112) (-761.381) * (-759.346) (-759.606) [-762.664] (-761.089) -- 0:01:03
86500 -- [-760.475] (-760.188) (-760.668) (-760.934) * (-760.058) (-759.911) (-762.169) [-759.663] -- 0:01:03
87000 -- [-758.577] (-760.903) (-760.084) (-762.238) * (-760.720) [-759.368] (-759.250) (-760.829) -- 0:01:02
87500 -- (-758.756) [-758.638] (-760.156) (-763.791) * (-760.057) (-761.318) [-761.988] (-760.605) -- 0:01:02
88000 -- (-760.045) (-758.759) [-760.179] (-762.113) * (-759.639) [-760.846] (-762.343) (-762.280) -- 0:01:02
88500 -- [-758.821] (-758.611) (-759.602) (-760.213) * [-761.772] (-762.290) (-759.247) (-760.264) -- 0:01:01
89000 -- (-759.359) (-759.044) [-760.883] (-760.747) * (-758.916) (-762.349) (-761.697) [-763.232] -- 0:01:01
89500 -- (-765.932) [-759.557] (-763.174) (-761.237) * (-762.859) (-760.608) [-758.835] (-765.355) -- 0:01:01
90000 -- (-760.831) (-766.132) (-760.762) [-759.378] * [-760.259] (-762.312) (-761.054) (-764.160) -- 0:01:00
Average standard deviation of split frequencies: 0.031470
90500 -- (-765.619) (-764.021) [-761.721] (-759.833) * (-761.209) (-759.751) [-760.458] (-760.224) -- 0:01:00
91000 -- (-759.746) (-760.361) [-761.336] (-762.143) * (-761.572) [-760.323] (-761.493) (-761.028) -- 0:00:59
91500 -- [-762.174] (-760.314) (-761.330) (-768.588) * (-761.198) [-760.196] (-762.373) (-760.673) -- 0:00:59
92000 -- (-759.849) (-761.360) [-763.360] (-764.339) * [-761.128] (-760.083) (-761.480) (-765.205) -- 0:00:59
92500 -- (-760.150) (-761.118) [-759.991] (-761.499) * (-763.978) (-761.189) [-762.647] (-760.352) -- 0:00:58
93000 -- (-760.169) (-765.034) (-758.825) [-766.301] * (-763.913) (-760.350) (-760.612) [-760.647] -- 0:00:58
93500 -- [-759.840] (-760.380) (-762.162) (-761.049) * (-763.425) (-762.002) (-761.040) [-759.171] -- 0:00:58
94000 -- [-759.051] (-761.656) (-765.289) (-762.671) * (-761.311) (-759.980) [-759.830] (-760.547) -- 0:00:57
94500 -- (-759.119) (-761.887) [-760.820] (-761.353) * (-758.473) (-762.479) [-760.174] (-761.401) -- 0:00:57
95000 -- (-760.458) [-760.934] (-762.330) (-761.642) * (-761.945) (-759.754) (-760.403) [-761.504] -- 0:00:57
Average standard deviation of split frequencies: 0.024307
95500 -- [-761.765] (-761.032) (-761.262) (-761.832) * (-757.032) (-765.706) [-761.849] (-763.106) -- 0:00:56
96000 -- [-763.595] (-762.038) (-762.245) (-761.992) * (-760.055) (-758.996) (-760.206) [-760.980] -- 0:00:56
96500 -- (-760.023) [-759.678] (-762.462) (-759.322) * (-762.393) [-761.285] (-760.827) (-759.466) -- 0:00:56
97000 -- (-760.973) (-761.750) [-758.314] (-764.398) * (-759.972) (-760.134) (-759.320) [-759.960] -- 0:00:55
97500 -- [-763.096] (-761.051) (-759.719) (-765.308) * [-760.211] (-760.350) (-760.241) (-762.347) -- 0:00:55
98000 -- (-760.585) (-771.491) (-759.715) [-761.477] * [-759.523] (-768.014) (-762.590) (-761.616) -- 0:00:55
98500 -- (-759.942) [-762.030] (-760.493) (-759.360) * [-759.976] (-768.302) (-761.399) (-762.070) -- 0:00:54
99000 -- (-759.844) (-763.565) (-758.359) [-761.670] * (-759.743) (-761.794) (-763.552) [-759.871] -- 0:00:54
99500 -- [-758.572] (-763.381) (-760.487) (-760.237) * (-760.989) (-760.500) (-761.581) [-760.566] -- 0:00:54
100000 -- (-762.504) (-759.533) (-761.224) [-763.569] * [-759.876] (-763.166) (-761.150) (-759.200) -- 0:00:54
Average standard deviation of split frequencies: 0.024715
100500 -- [-759.068] (-760.017) (-762.885) (-761.752) * (-761.717) (-765.890) [-759.917] (-760.142) -- 0:00:53
101000 -- (-763.207) [-759.224] (-760.863) (-762.713) * (-761.854) (-766.538) (-761.734) [-759.805] -- 0:01:02
101500 -- (-760.711) (-759.018) (-763.000) [-761.165] * (-762.021) (-761.994) [-759.209] (-759.698) -- 0:01:01
102000 -- (-760.728) (-760.520) [-761.228] (-761.436) * (-762.549) (-760.151) [-758.818] (-759.531) -- 0:01:01
102500 -- (-758.066) (-760.537) (-760.938) [-758.537] * (-761.152) (-759.190) (-760.625) [-759.492] -- 0:01:01
103000 -- (-758.210) (-759.246) (-758.810) [-759.527] * (-761.774) (-762.030) (-761.818) [-759.908] -- 0:01:00
103500 -- (-763.843) (-759.023) (-759.741) [-759.199] * (-761.188) (-767.113) (-760.713) [-759.294] -- 0:01:00
104000 -- (-762.180) (-759.854) [-758.577] (-759.630) * (-763.406) (-759.861) (-766.812) [-759.283] -- 0:01:00
104500 -- (-761.792) (-759.958) [-760.308] (-760.210) * (-761.552) (-760.223) [-761.465] (-760.569) -- 0:00:59
105000 -- (-760.379) (-761.198) (-759.097) [-760.828] * (-759.941) (-761.280) [-759.909] (-758.782) -- 0:00:59
Average standard deviation of split frequencies: 0.024707
105500 -- (-758.982) (-761.238) (-759.000) [-762.003] * (-764.292) (-760.599) [-760.275] (-761.279) -- 0:00:59
106000 -- [-759.490] (-761.867) (-759.264) (-760.694) * [-757.550] (-764.506) (-760.758) (-759.563) -- 0:00:59
106500 -- (-760.138) (-762.938) [-757.744] (-759.634) * [-760.013] (-762.656) (-761.099) (-762.195) -- 0:00:58
107000 -- [-762.760] (-761.210) (-758.721) (-761.873) * (-760.102) (-762.978) (-760.927) [-761.000] -- 0:00:58
107500 -- [-758.700] (-759.833) (-758.855) (-758.951) * (-765.307) (-760.410) (-760.217) [-762.878] -- 0:00:58
108000 -- (-758.414) [-758.294] (-760.101) (-759.798) * [-764.112] (-760.755) (-761.980) (-762.739) -- 0:00:57
108500 -- [-757.888] (-761.260) (-757.835) (-764.884) * [-760.503] (-761.845) (-761.324) (-762.742) -- 0:00:57
109000 -- (-758.595) (-767.591) [-758.503] (-759.901) * [-762.957] (-761.666) (-761.797) (-760.760) -- 0:00:57
109500 -- (-759.746) (-760.256) (-761.334) [-759.668] * (-765.555) [-759.710] (-762.005) (-761.655) -- 0:00:56
110000 -- [-761.444] (-761.287) (-760.038) (-760.184) * (-762.053) [-761.361] (-762.302) (-759.468) -- 0:00:56
Average standard deviation of split frequencies: 0.023316
110500 -- (-759.728) (-760.378) (-765.757) [-759.067] * (-760.446) (-761.025) (-766.919) [-760.414] -- 0:00:56
111000 -- (-759.571) (-761.851) (-760.061) [-761.160] * (-764.391) (-762.381) (-760.251) [-763.023] -- 0:00:56
111500 -- (-760.881) (-761.113) [-763.237] (-761.134) * (-764.513) (-761.328) [-760.997] (-764.897) -- 0:00:55
112000 -- (-759.456) (-761.833) [-757.696] (-762.383) * (-761.200) (-762.629) [-760.719] (-762.082) -- 0:00:55
112500 -- (-765.658) [-762.574] (-761.181) (-761.239) * (-762.457) (-760.056) (-763.652) [-761.732] -- 0:00:55
113000 -- [-761.459] (-762.122) (-759.839) (-760.755) * (-762.205) (-761.407) [-757.986] (-760.037) -- 0:00:54
113500 -- (-758.759) (-759.889) [-761.623] (-763.468) * (-760.434) [-762.486] (-759.471) (-760.565) -- 0:00:54
114000 -- [-761.336] (-760.057) (-759.702) (-761.027) * [-760.048] (-760.431) (-762.661) (-762.112) -- 0:00:54
114500 -- [-761.353] (-759.357) (-759.052) (-766.746) * (-762.608) [-760.315] (-764.380) (-760.981) -- 0:00:54
115000 -- [-760.824] (-758.214) (-761.626) (-763.067) * (-759.278) (-760.579) [-763.505] (-761.928) -- 0:00:53
Average standard deviation of split frequencies: 0.022030
115500 -- (-759.537) (-759.702) [-761.738] (-761.441) * (-759.079) [-760.471] (-764.170) (-761.784) -- 0:00:53
116000 -- (-760.039) (-761.387) (-759.958) [-760.307] * (-759.627) (-762.895) [-762.585] (-759.922) -- 0:00:53
116500 -- (-759.711) (-762.527) [-759.806] (-763.890) * [-758.580] (-761.861) (-759.169) (-763.184) -- 0:01:00
117000 -- [-758.830] (-758.560) (-760.127) (-761.969) * (-757.121) [-761.604] (-759.235) (-763.231) -- 0:01:00
117500 -- (-761.502) (-760.221) [-759.108] (-763.247) * (-758.720) (-761.170) [-761.514] (-761.989) -- 0:01:00
118000 -- (-760.413) (-759.073) (-760.288) [-760.879] * [-758.063] (-759.685) (-760.012) (-760.283) -- 0:00:59
118500 -- (-759.812) (-760.605) [-759.658] (-762.944) * (-758.006) (-763.886) [-759.065] (-764.310) -- 0:00:59
119000 -- [-757.889] (-759.074) (-759.078) (-759.419) * (-760.059) (-760.004) (-758.153) [-759.509] -- 0:00:59
119500 -- (-760.552) (-757.185) [-760.473] (-759.506) * (-761.285) (-759.932) (-760.351) [-759.653] -- 0:00:58
120000 -- (-759.736) [-760.711] (-761.361) (-760.655) * (-763.497) [-760.056] (-759.375) (-761.336) -- 0:00:58
Average standard deviation of split frequencies: 0.021270
120500 -- [-759.679] (-760.828) (-761.263) (-760.060) * [-759.017] (-760.193) (-759.101) (-765.881) -- 0:00:58
121000 -- (-763.392) [-761.307] (-759.475) (-760.621) * (-759.135) (-762.558) (-762.301) [-759.657] -- 0:00:58
121500 -- (-761.480) (-761.565) (-759.945) [-760.306] * (-761.394) (-760.436) [-758.567] (-760.731) -- 0:00:57
122000 -- (-760.093) [-763.929] (-763.910) (-761.246) * [-762.231] (-760.636) (-766.656) (-760.930) -- 0:00:57
122500 -- (-760.037) [-761.336] (-762.078) (-759.685) * [-759.841] (-760.637) (-765.860) (-763.268) -- 0:00:57
123000 -- (-760.619) (-758.694) (-759.355) [-765.076] * (-760.292) (-764.370) (-760.097) [-760.872] -- 0:00:57
123500 -- (-762.054) (-761.728) (-760.257) [-760.619] * (-760.901) (-761.190) (-761.908) [-760.684] -- 0:00:56
124000 -- (-760.677) [-760.436] (-761.599) (-760.671) * [-763.609] (-765.101) (-764.408) (-762.767) -- 0:00:56
124500 -- (-761.552) (-763.306) (-758.759) [-761.801] * (-760.810) [-759.622] (-764.962) (-760.887) -- 0:00:56
125000 -- (-762.321) (-763.351) [-757.960] (-767.680) * [-757.892] (-759.390) (-765.271) (-758.932) -- 0:00:56
Average standard deviation of split frequencies: 0.020785
125500 -- (-760.368) (-759.928) (-760.236) [-762.149] * [-758.929] (-763.361) (-758.957) (-761.714) -- 0:00:55
126000 -- (-760.662) [-761.134] (-760.487) (-761.700) * (-759.025) (-761.349) (-763.109) [-768.321] -- 0:00:55
126500 -- (-760.911) (-767.671) (-758.680) [-757.723] * [-760.304] (-764.184) (-759.816) (-761.724) -- 0:00:55
127000 -- (-760.804) [-760.540] (-758.473) (-757.971) * (-758.319) (-761.841) [-764.463] (-760.729) -- 0:00:54
127500 -- (-762.188) (-762.129) [-760.709] (-761.790) * (-761.827) (-761.541) (-765.679) [-759.941] -- 0:00:54
128000 -- (-769.173) (-761.446) (-759.431) [-758.063] * (-762.053) (-760.470) [-760.225] (-758.549) -- 0:00:54
128500 -- (-764.366) (-761.166) [-758.312] (-759.312) * (-760.258) (-761.881) (-764.428) [-760.746] -- 0:00:54
129000 -- (-761.161) (-762.078) [-758.721] (-765.046) * [-759.221] (-765.764) (-766.816) (-760.194) -- 0:00:54
129500 -- (-760.567) (-760.903) [-760.611] (-762.004) * [-759.427] (-759.347) (-762.866) (-762.135) -- 0:00:53
130000 -- (-761.004) (-761.754) (-758.403) [-758.013] * (-763.546) (-760.034) (-760.464) [-760.367] -- 0:00:53
Average standard deviation of split frequencies: 0.019482
130500 -- (-764.379) (-760.685) (-760.548) [-759.308] * [-760.560] (-762.533) (-759.340) (-762.107) -- 0:00:53
131000 -- [-762.211] (-760.431) (-762.785) (-760.179) * (-761.062) [-760.833] (-760.483) (-761.106) -- 0:00:53
131500 -- (-761.880) [-761.981] (-764.092) (-760.235) * (-761.579) [-764.706] (-761.331) (-761.550) -- 0:00:52
132000 -- (-761.071) (-759.992) [-761.752] (-760.400) * (-760.827) (-762.499) (-763.457) [-761.545] -- 0:00:59
132500 -- (-762.349) (-762.323) (-761.087) [-764.049] * [-757.449] (-761.423) (-763.201) (-761.182) -- 0:00:58
133000 -- (-760.616) [-762.305] (-760.648) (-762.386) * [-758.924] (-758.753) (-758.960) (-762.930) -- 0:00:58
133500 -- (-761.277) (-760.833) [-757.423] (-758.153) * (-758.811) (-759.146) (-762.032) [-761.917] -- 0:00:58
134000 -- (-760.905) (-764.549) (-758.126) [-758.337] * (-761.243) [-757.675] (-759.126) (-760.709) -- 0:00:58
134500 -- (-762.001) (-760.574) [-762.960] (-760.593) * (-758.720) (-759.986) (-758.614) [-763.779] -- 0:00:57
135000 -- (-760.770) [-760.807] (-762.369) (-759.162) * [-759.821] (-760.043) (-760.440) (-762.464) -- 0:00:57
Average standard deviation of split frequencies: 0.021491
135500 -- [-764.297] (-760.942) (-758.452) (-761.343) * (-760.937) (-761.397) [-759.762] (-762.941) -- 0:00:57
136000 -- (-760.522) (-762.714) [-760.329] (-763.300) * [-762.527] (-762.595) (-760.918) (-762.071) -- 0:00:57
136500 -- (-759.882) [-761.172] (-758.599) (-761.414) * (-758.213) (-761.135) (-761.110) [-760.757] -- 0:00:56
137000 -- (-763.695) (-763.068) [-762.464] (-758.829) * [-758.934] (-764.752) (-759.338) (-760.528) -- 0:00:56
137500 -- (-762.250) (-761.245) (-761.979) [-757.359] * (-759.576) [-761.201] (-758.021) (-760.840) -- 0:00:56
138000 -- [-763.276] (-761.612) (-765.661) (-758.442) * (-759.673) (-762.224) [-758.377] (-760.307) -- 0:00:56
138500 -- (-761.676) (-763.776) [-759.317] (-759.903) * (-759.801) [-764.515] (-757.683) (-762.250) -- 0:00:55
139000 -- [-760.970] (-761.481) (-759.915) (-762.264) * (-760.615) (-765.350) [-758.434] (-764.408) -- 0:00:55
139500 -- (-761.440) (-761.966) [-762.836] (-759.390) * (-759.597) (-761.288) (-759.975) [-761.537] -- 0:00:55
140000 -- (-761.579) (-761.197) (-761.167) [-765.264] * (-758.283) (-760.409) (-759.627) [-762.903] -- 0:00:55
Average standard deviation of split frequencies: 0.022453
140500 -- (-762.596) [-761.230] (-761.700) (-760.056) * (-760.426) (-760.390) (-758.659) [-759.715] -- 0:00:55
141000 -- [-760.835] (-765.849) (-765.196) (-759.248) * (-759.839) [-759.422] (-762.064) (-761.384) -- 0:00:54
141500 -- [-759.770] (-762.596) (-767.411) (-763.450) * [-757.820] (-761.320) (-763.940) (-760.406) -- 0:00:54
142000 -- (-759.750) [-761.831] (-761.404) (-759.016) * (-760.654) (-762.519) (-765.488) [-762.466] -- 0:00:54
142500 -- (-760.144) (-760.459) [-764.501] (-759.204) * (-762.217) (-765.722) (-757.892) [-763.337] -- 0:00:54
143000 -- (-759.978) (-760.817) (-765.359) [-762.294] * [-758.132] (-762.254) (-759.160) (-761.281) -- 0:00:53
143500 -- [-760.652] (-760.892) (-766.213) (-759.810) * (-763.594) (-763.923) [-758.941] (-761.100) -- 0:00:53
144000 -- (-760.246) (-759.872) [-762.845] (-761.174) * (-759.213) [-760.943] (-758.421) (-763.264) -- 0:00:53
144500 -- (-761.954) [-757.750] (-761.612) (-759.144) * (-764.049) [-759.403] (-760.815) (-766.845) -- 0:00:53
145000 -- (-766.404) [-761.128] (-760.325) (-760.478) * (-760.924) (-762.416) [-759.879] (-761.894) -- 0:00:53
Average standard deviation of split frequencies: 0.022924
145500 -- [-758.640] (-762.909) (-759.545) (-761.712) * (-760.751) (-764.443) (-759.698) [-760.108] -- 0:00:52
146000 -- (-760.329) (-764.154) (-759.195) [-760.531] * [-757.871] (-761.287) (-761.746) (-760.686) -- 0:00:52
146500 -- (-760.299) (-759.401) [-759.440] (-762.455) * (-759.156) [-764.812] (-757.566) (-762.747) -- 0:00:52
147000 -- [-761.284] (-764.082) (-760.140) (-758.183) * (-760.524) [-762.517] (-759.992) (-760.440) -- 0:00:52
147500 -- (-760.596) (-762.268) (-760.163) [-759.999] * [-759.754] (-759.875) (-761.398) (-761.626) -- 0:00:52
148000 -- [-764.081] (-762.933) (-759.351) (-759.768) * [-757.952] (-760.986) (-762.133) (-764.791) -- 0:00:57
148500 -- (-762.303) [-761.362] (-760.134) (-759.195) * (-761.577) [-760.199] (-761.303) (-763.268) -- 0:00:57
149000 -- [-763.096] (-760.498) (-759.587) (-762.211) * (-761.112) (-760.701) [-759.484] (-762.595) -- 0:00:57
149500 -- (-760.281) (-761.417) (-769.316) [-760.297] * [-763.500] (-766.104) (-761.674) (-763.851) -- 0:00:56
150000 -- (-765.094) (-760.635) [-760.081] (-762.790) * (-759.581) (-763.392) (-761.970) [-759.984] -- 0:00:56
Average standard deviation of split frequencies: 0.018616
150500 -- (-760.224) (-759.582) [-762.246] (-759.756) * (-759.118) (-762.530) [-761.576] (-759.577) -- 0:00:56
151000 -- (-762.673) (-765.172) (-760.155) [-758.680] * (-765.148) [-760.322] (-760.923) (-763.398) -- 0:00:56
151500 -- (-761.823) (-760.509) (-760.334) [-758.255] * (-760.112) (-760.152) (-760.090) [-760.722] -- 0:00:56
152000 -- (-762.643) [-759.581] (-761.387) (-760.480) * (-763.288) (-761.427) (-759.921) [-761.575] -- 0:00:55
152500 -- (-760.505) [-761.853] (-761.466) (-767.725) * (-763.027) (-760.228) [-759.248] (-760.568) -- 0:00:55
153000 -- (-760.333) (-760.989) (-760.251) [-761.920] * [-760.425] (-761.073) (-760.215) (-759.493) -- 0:00:55
153500 -- (-764.253) (-760.422) [-761.125] (-760.208) * (-761.220) (-763.567) (-762.416) [-758.662] -- 0:00:55
154000 -- (-761.893) (-760.766) [-759.916] (-761.650) * (-760.614) (-759.492) [-759.710] (-759.760) -- 0:00:54
154500 -- (-760.490) [-760.879] (-761.204) (-757.137) * (-760.654) [-762.727] (-763.079) (-760.287) -- 0:00:54
155000 -- (-762.616) (-760.512) [-762.312] (-761.447) * (-760.782) [-758.494] (-759.049) (-760.605) -- 0:00:54
Average standard deviation of split frequencies: 0.017829
155500 -- [-760.218] (-764.933) (-758.018) (-758.419) * (-763.278) [-760.015] (-763.609) (-761.313) -- 0:00:54
156000 -- (-759.643) [-763.170] (-763.608) (-759.405) * (-762.026) (-762.475) (-770.090) [-760.284] -- 0:00:54
156500 -- (-764.136) (-761.363) (-760.993) [-760.445] * (-761.863) [-759.022] (-761.078) (-760.560) -- 0:00:53
157000 -- (-762.434) [-756.776] (-759.675) (-759.371) * (-764.339) (-759.052) (-758.426) [-759.201] -- 0:00:53
157500 -- (-761.456) (-759.839) (-760.004) [-759.478] * (-764.910) [-759.638] (-759.542) (-759.307) -- 0:00:53
158000 -- (-757.989) [-759.978] (-759.106) (-761.783) * (-763.207) (-759.106) [-758.842] (-761.472) -- 0:00:53
158500 -- (-761.006) [-757.660] (-762.935) (-757.921) * [-761.279] (-762.411) (-760.174) (-762.997) -- 0:00:53
159000 -- (-760.814) (-758.270) [-760.252] (-757.695) * [-760.018] (-759.858) (-759.767) (-767.990) -- 0:00:52
159500 -- (-761.618) (-761.071) [-760.174] (-760.983) * (-760.003) [-761.721] (-761.289) (-757.811) -- 0:00:52
160000 -- (-764.273) (-761.235) (-759.155) [-759.656] * [-757.517] (-760.133) (-760.475) (-759.300) -- 0:00:52
Average standard deviation of split frequencies: 0.017604
160500 -- (-763.324) (-761.970) (-759.973) [-760.420] * (-759.279) [-761.804] (-762.847) (-759.535) -- 0:00:52
161000 -- [-759.397] (-760.412) (-759.169) (-761.897) * (-764.239) (-760.742) (-762.199) [-759.299] -- 0:00:52
161500 -- (-759.103) (-763.394) (-760.986) [-761.907] * (-760.125) (-761.399) [-760.613] (-762.949) -- 0:00:51
162000 -- (-760.704) (-761.374) [-757.887] (-760.021) * [-760.690] (-760.486) (-758.659) (-762.136) -- 0:00:51
162500 -- (-760.416) [-760.509] (-761.271) (-759.980) * (-766.227) (-766.469) [-765.511] (-760.166) -- 0:00:51
163000 -- (-760.853) (-765.074) [-761.111] (-762.752) * (-762.574) (-765.334) [-760.483] (-758.990) -- 0:00:51
163500 -- (-759.588) [-762.901] (-761.883) (-760.478) * (-758.973) [-760.405] (-758.278) (-759.247) -- 0:00:56
164000 -- (-760.032) (-762.694) [-759.738] (-760.669) * [-763.412] (-762.762) (-760.197) (-759.208) -- 0:00:56
164500 -- (-763.601) (-763.305) [-762.672] (-759.637) * (-760.042) (-761.000) [-760.286] (-759.236) -- 0:00:55
165000 -- (-759.143) [-761.291] (-762.084) (-760.769) * (-758.997) (-760.834) [-761.322] (-758.286) -- 0:00:55
Average standard deviation of split frequencies: 0.016881
165500 -- (-759.655) (-760.970) [-757.671] (-760.851) * (-762.800) (-760.820) [-761.516] (-759.624) -- 0:00:55
166000 -- (-764.764) (-759.859) [-759.588] (-761.702) * [-762.670] (-766.279) (-760.071) (-762.286) -- 0:00:55
166500 -- [-758.009] (-759.934) (-764.836) (-758.878) * (-759.238) [-763.403] (-758.515) (-760.589) -- 0:00:55
167000 -- (-763.940) (-763.310) (-760.787) [-758.847] * (-760.391) (-760.762) (-760.824) [-759.221] -- 0:00:54
167500 -- (-759.507) (-763.173) (-760.789) [-759.319] * (-760.866) (-760.669) (-759.528) [-759.570] -- 0:00:54
168000 -- [-758.162] (-764.789) (-760.863) (-760.913) * (-761.086) (-760.913) (-761.215) [-763.874] -- 0:00:54
168500 -- (-759.311) (-760.866) [-763.740] (-758.923) * (-764.599) (-760.361) (-764.298) [-758.267] -- 0:00:54
169000 -- (-761.128) (-764.034) [-760.416] (-759.187) * (-761.126) [-761.759] (-761.204) (-761.309) -- 0:00:54
169500 -- (-762.573) (-761.839) (-762.241) [-758.225] * (-759.645) (-761.857) (-762.012) [-760.585] -- 0:00:53
170000 -- (-761.392) [-763.018] (-760.554) (-760.879) * (-759.547) (-760.886) (-762.413) [-763.600] -- 0:00:53
Average standard deviation of split frequencies: 0.016266
170500 -- (-759.725) [-763.177] (-763.361) (-760.572) * (-761.860) [-760.045] (-763.190) (-758.812) -- 0:00:53
171000 -- (-760.966) (-763.154) (-762.563) [-759.032] * (-761.405) (-760.911) (-762.920) [-758.421] -- 0:00:53
171500 -- [-760.998] (-761.112) (-759.229) (-759.813) * (-761.680) (-767.820) (-761.618) [-759.929] -- 0:00:53
172000 -- (-762.069) (-760.268) [-760.152] (-768.347) * (-759.649) (-761.917) (-758.680) [-760.507] -- 0:00:52
172500 -- [-759.433] (-760.168) (-760.791) (-761.643) * (-760.476) (-761.542) [-758.217] (-761.116) -- 0:00:52
173000 -- (-758.029) [-760.344] (-761.086) (-760.254) * (-761.311) (-764.687) (-759.963) [-762.105] -- 0:00:52
173500 -- (-757.976) [-761.965] (-759.012) (-758.402) * [-763.908] (-760.540) (-763.416) (-762.534) -- 0:00:52
174000 -- (-758.005) [-763.128] (-763.794) (-760.469) * (-766.342) (-761.249) (-758.338) [-759.093] -- 0:00:52
174500 -- (-760.797) (-759.363) (-763.186) [-762.100] * (-761.967) (-760.353) [-759.874] (-761.078) -- 0:00:52
175000 -- [-760.359] (-760.494) (-761.481) (-762.155) * (-759.781) (-761.514) (-765.544) [-758.605] -- 0:00:51
Average standard deviation of split frequencies: 0.016071
175500 -- (-760.164) (-762.793) [-758.904] (-760.351) * [-764.304] (-759.316) (-763.913) (-762.316) -- 0:00:51
176000 -- (-762.342) (-763.336) [-762.726] (-760.181) * (-761.726) (-759.933) (-763.747) [-759.974] -- 0:00:51
176500 -- (-761.971) (-760.951) (-759.484) [-759.057] * [-760.830] (-761.684) (-760.098) (-757.958) -- 0:00:51
177000 -- (-763.900) (-759.550) (-763.403) [-757.764] * (-760.171) (-761.910) (-759.891) [-757.725] -- 0:00:51
177500 -- (-763.754) (-762.565) (-763.330) [-759.394] * (-760.185) (-758.895) (-760.942) [-762.932] -- 0:00:50
178000 -- (-760.968) [-761.000] (-762.379) (-759.035) * (-762.004) (-760.566) [-760.024] (-763.004) -- 0:00:50
178500 -- [-761.621] (-758.245) (-765.339) (-759.254) * (-759.003) [-761.324] (-761.454) (-761.582) -- 0:00:50
179000 -- (-759.641) [-761.400] (-762.992) (-759.688) * (-760.584) (-759.121) [-759.528] (-761.130) -- 0:00:55
179500 -- (-758.287) (-760.153) [-759.673] (-765.167) * (-758.027) (-759.146) [-760.514] (-759.177) -- 0:00:54
180000 -- (-761.223) (-761.819) [-758.327] (-759.123) * (-764.795) (-761.633) (-763.687) [-761.568] -- 0:00:54
Average standard deviation of split frequencies: 0.015076
180500 -- (-762.878) (-759.750) [-761.066] (-758.378) * (-761.757) [-759.904] (-763.995) (-760.681) -- 0:00:54
181000 -- (-765.058) (-762.636) [-761.768] (-762.335) * (-760.643) (-761.749) (-760.725) [-759.954] -- 0:00:54
181500 -- (-761.836) [-761.042] (-760.822) (-758.275) * [-762.135] (-761.989) (-760.579) (-759.731) -- 0:00:54
182000 -- (-760.627) (-763.980) (-760.323) [-760.644] * (-761.332) (-762.551) (-762.245) [-758.304] -- 0:00:53
182500 -- (-761.263) (-762.461) (-761.445) [-760.079] * (-760.603) [-761.325] (-760.549) (-759.352) -- 0:00:53
183000 -- (-760.597) (-762.934) [-762.582] (-757.081) * (-762.417) (-765.356) [-760.913] (-760.943) -- 0:00:53
183500 -- [-760.448] (-763.255) (-763.078) (-759.429) * (-761.668) (-763.452) [-763.543] (-759.502) -- 0:00:53
184000 -- (-763.549) (-762.341) [-759.044] (-759.749) * (-764.237) [-760.930] (-762.661) (-761.748) -- 0:00:53
184500 -- (-760.965) [-762.047] (-758.436) (-758.006) * (-761.702) (-759.845) (-759.386) [-761.560] -- 0:00:53
185000 -- (-762.569) (-763.672) [-760.887] (-760.819) * [-757.907] (-760.029) (-762.907) (-763.796) -- 0:00:52
Average standard deviation of split frequencies: 0.014273
185500 -- (-760.358) [-760.746] (-761.626) (-760.419) * (-759.712) (-762.515) [-761.987] (-762.547) -- 0:00:52
186000 -- (-761.956) [-762.198] (-760.173) (-759.780) * (-764.041) (-762.662) [-761.624] (-764.797) -- 0:00:52
186500 -- [-760.561] (-761.437) (-759.004) (-758.609) * (-760.869) (-759.221) (-759.056) [-758.389] -- 0:00:52
187000 -- (-760.642) (-761.168) [-759.123] (-761.379) * [-758.937] (-761.646) (-763.779) (-761.080) -- 0:00:52
187500 -- (-764.091) (-763.084) [-758.889] (-759.303) * (-758.352) (-760.738) (-758.139) [-759.783] -- 0:00:52
188000 -- (-761.569) (-767.916) [-762.877] (-759.971) * (-758.617) (-760.565) [-761.845] (-762.314) -- 0:00:51
188500 -- (-764.743) (-759.178) (-760.254) [-757.701] * [-758.782] (-759.164) (-758.545) (-763.139) -- 0:00:51
189000 -- [-758.978] (-763.242) (-762.070) (-758.028) * [-758.260] (-761.549) (-759.729) (-760.486) -- 0:00:51
189500 -- [-759.217] (-765.026) (-763.374) (-760.890) * [-763.533] (-760.273) (-761.630) (-763.678) -- 0:00:51
190000 -- [-761.077] (-763.846) (-759.278) (-757.853) * [-761.181] (-759.389) (-760.830) (-762.931) -- 0:00:51
Average standard deviation of split frequencies: 0.012798
190500 -- (-758.755) [-762.291] (-762.898) (-759.010) * [-759.360] (-758.613) (-760.570) (-761.850) -- 0:00:50
191000 -- [-761.146] (-761.085) (-763.010) (-761.147) * (-760.583) (-758.532) [-759.763] (-759.672) -- 0:00:50
191500 -- (-759.214) (-760.254) (-760.030) [-758.604] * (-759.917) (-759.893) (-760.348) [-763.340] -- 0:00:50
192000 -- (-761.123) [-760.709] (-759.608) (-758.885) * (-759.288) (-763.099) [-760.780] (-758.914) -- 0:00:50
192500 -- [-761.463] (-760.610) (-759.243) (-757.965) * (-758.097) (-759.010) [-761.146] (-758.733) -- 0:00:50
193000 -- (-757.839) (-762.430) (-758.548) [-759.975] * [-760.564] (-759.498) (-760.025) (-759.659) -- 0:00:50
193500 -- (-761.134) [-759.849] (-758.366) (-762.025) * (-761.623) (-759.201) (-761.616) [-761.247] -- 0:00:50
194000 -- (-762.556) (-762.270) [-758.991] (-759.927) * (-758.554) [-758.839] (-763.707) (-758.698) -- 0:00:49
194500 -- (-761.966) (-761.446) (-758.300) [-760.131] * (-762.715) (-758.086) [-758.477] (-761.899) -- 0:00:49
195000 -- [-760.270] (-761.067) (-760.374) (-759.414) * (-759.921) (-761.424) (-758.193) [-760.811] -- 0:00:53
Average standard deviation of split frequencies: 0.013469
195500 -- (-760.048) (-761.321) [-760.476] (-760.880) * [-759.320] (-762.139) (-761.896) (-764.533) -- 0:00:53
196000 -- (-761.330) [-760.906] (-761.100) (-761.387) * (-761.543) (-758.578) [-760.968] (-758.471) -- 0:00:53
196500 -- [-761.775] (-763.475) (-759.267) (-761.459) * (-761.178) (-762.119) [-757.128] (-759.364) -- 0:00:53
197000 -- [-762.617] (-762.887) (-763.113) (-762.198) * (-757.276) (-764.014) (-758.379) [-760.269] -- 0:00:52
197500 -- (-762.049) (-761.143) (-761.970) [-759.548] * [-761.146] (-760.607) (-759.155) (-762.975) -- 0:00:52
198000 -- (-762.041) (-762.541) (-759.900) [-761.918] * [-762.243] (-760.936) (-759.347) (-757.787) -- 0:00:52
198500 -- [-760.893] (-764.164) (-759.461) (-764.324) * (-759.635) (-762.287) (-759.664) [-763.455] -- 0:00:52
199000 -- (-760.644) (-760.423) [-759.215] (-760.124) * (-761.934) (-764.722) (-758.519) [-760.145] -- 0:00:52
199500 -- [-761.972] (-759.050) (-766.350) (-762.515) * [-761.083] (-762.059) (-759.767) (-760.981) -- 0:00:52
200000 -- (-764.752) (-762.290) (-762.716) [-760.805] * [-759.441] (-760.586) (-760.274) (-762.260) -- 0:00:51
Average standard deviation of split frequencies: 0.012982
200500 -- (-766.328) (-761.126) (-761.828) [-762.174] * [-759.977] (-763.317) (-762.468) (-760.050) -- 0:00:51
201000 -- (-763.505) [-760.329] (-762.262) (-760.101) * (-761.074) [-761.321] (-764.457) (-760.080) -- 0:00:51
201500 -- (-761.146) [-761.563] (-761.673) (-758.597) * (-761.777) (-759.571) [-760.246] (-765.135) -- 0:00:51
202000 -- (-760.516) [-759.212] (-761.610) (-761.819) * (-762.076) (-760.609) [-761.858] (-760.777) -- 0:00:51
202500 -- [-760.208] (-760.593) (-760.981) (-760.530) * (-767.020) [-764.226] (-760.682) (-760.477) -- 0:00:51
203000 -- (-758.517) (-761.343) (-760.697) [-761.169] * (-763.288) [-758.505] (-760.423) (-763.420) -- 0:00:51
203500 -- (-762.534) (-762.944) [-758.731] (-764.558) * [-760.907] (-760.495) (-760.476) (-762.061) -- 0:00:50
204000 -- (-763.474) (-759.825) (-761.267) [-762.971] * (-759.494) (-759.668) (-758.648) [-759.169] -- 0:00:50
204500 -- [-763.686] (-762.749) (-763.290) (-764.745) * (-760.293) [-761.092] (-758.946) (-760.674) -- 0:00:50
205000 -- (-760.837) (-764.915) [-762.029] (-760.672) * (-759.375) [-759.485] (-757.937) (-763.113) -- 0:00:50
Average standard deviation of split frequencies: 0.012967
205500 -- (-760.098) [-759.007] (-762.630) (-762.251) * (-762.439) [-761.495] (-766.524) (-761.025) -- 0:00:50
206000 -- [-759.077] (-760.643) (-761.492) (-760.538) * [-757.337] (-760.796) (-761.647) (-760.031) -- 0:00:50
206500 -- [-760.716] (-759.237) (-759.112) (-760.473) * (-759.238) (-766.907) [-760.145] (-761.808) -- 0:00:49
207000 -- (-761.290) [-762.856] (-760.516) (-760.289) * (-760.467) (-760.744) [-759.667] (-761.558) -- 0:00:49
207500 -- (-759.950) (-762.899) [-758.999] (-760.883) * (-758.467) [-760.484] (-758.742) (-762.444) -- 0:00:49
208000 -- [-758.713] (-761.048) (-762.507) (-757.496) * [-759.320] (-759.468) (-761.491) (-763.902) -- 0:00:49
208500 -- (-760.511) [-761.849] (-761.111) (-765.410) * (-764.672) (-760.575) (-765.014) [-765.398] -- 0:00:49
209000 -- (-761.034) (-760.282) (-760.845) [-760.479] * (-761.535) (-766.135) (-762.040) [-759.555] -- 0:00:49
209500 -- (-759.262) (-761.609) [-756.398] (-760.657) * (-759.763) [-758.852] (-761.369) (-760.410) -- 0:00:49
210000 -- (-762.966) (-760.582) [-757.731] (-759.254) * (-759.849) (-758.756) (-759.555) [-760.553] -- 0:00:48
Average standard deviation of split frequencies: 0.012366
210500 -- (-764.646) [-759.337] (-758.714) (-760.208) * [-759.217] (-762.836) (-759.535) (-762.247) -- 0:00:52
211000 -- [-758.409] (-759.359) (-758.751) (-766.618) * (-765.400) [-759.841] (-760.096) (-760.559) -- 0:00:52
211500 -- [-761.595] (-758.211) (-760.388) (-762.254) * (-763.746) [-760.164] (-759.708) (-759.975) -- 0:00:52
212000 -- (-758.145) (-759.657) [-760.547] (-760.436) * (-761.587) [-761.437] (-759.602) (-760.448) -- 0:00:52
212500 -- (-761.054) [-758.250] (-759.901) (-759.037) * (-764.053) [-757.508] (-759.256) (-759.828) -- 0:00:51
213000 -- (-758.910) [-761.543] (-761.816) (-759.519) * (-759.066) (-757.538) [-761.385] (-762.092) -- 0:00:51
213500 -- (-761.516) (-760.928) [-759.402] (-759.545) * (-759.979) [-758.071] (-760.842) (-761.270) -- 0:00:51
214000 -- (-760.964) (-761.744) (-760.023) [-759.458] * (-761.407) (-765.474) (-763.777) [-759.877] -- 0:00:51
214500 -- [-761.456] (-761.253) (-758.717) (-762.508) * (-762.725) [-761.197] (-761.628) (-760.818) -- 0:00:51
215000 -- [-761.548] (-760.916) (-759.371) (-759.649) * (-763.861) (-760.459) [-760.838] (-758.559) -- 0:00:51
Average standard deviation of split frequencies: 0.010655
215500 -- (-761.448) [-760.196] (-758.753) (-763.136) * (-764.926) [-759.449] (-764.346) (-762.795) -- 0:00:50
216000 -- (-761.127) (-761.441) (-761.448) [-761.845] * (-762.229) (-759.279) [-761.214] (-761.474) -- 0:00:50
216500 -- (-758.627) (-760.668) (-760.911) [-758.084] * (-760.506) (-759.678) (-765.360) [-759.065] -- 0:00:50
217000 -- [-761.651] (-760.505) (-762.336) (-760.117) * (-762.892) [-760.503] (-764.358) (-759.434) -- 0:00:50
217500 -- (-758.649) (-762.089) [-760.245] (-758.653) * (-761.625) [-760.509] (-759.631) (-760.905) -- 0:00:50
218000 -- (-760.382) (-758.432) [-760.406] (-759.496) * (-761.604) (-761.720) (-761.577) [-760.917] -- 0:00:50
218500 -- (-759.038) (-764.562) (-759.003) [-759.704] * [-763.907] (-760.434) (-763.869) (-759.153) -- 0:00:50
219000 -- (-762.819) (-761.060) (-759.340) [-759.702] * (-760.404) [-759.676] (-765.822) (-762.172) -- 0:00:49
219500 -- (-759.518) (-760.845) [-759.681] (-760.929) * (-761.885) (-759.804) [-759.521] (-762.012) -- 0:00:49
220000 -- (-768.349) [-758.608] (-759.412) (-760.805) * (-760.583) (-759.923) (-762.016) [-760.296] -- 0:00:49
Average standard deviation of split frequencies: 0.010304
220500 -- (-761.705) [-762.126] (-760.386) (-763.080) * [-760.131] (-758.595) (-762.392) (-761.629) -- 0:00:49
221000 -- (-764.936) [-762.312] (-761.649) (-761.995) * (-762.828) (-763.758) [-760.588] (-763.332) -- 0:00:49
221500 -- (-767.509) (-761.575) (-762.059) [-759.663] * (-760.082) (-760.819) (-759.762) [-759.183] -- 0:00:49
222000 -- [-760.226] (-760.418) (-761.690) (-760.608) * (-763.245) [-760.610] (-757.880) (-760.960) -- 0:00:49
222500 -- [-761.527] (-759.334) (-759.053) (-758.924) * (-760.711) (-761.256) [-760.889] (-761.027) -- 0:00:48
223000 -- [-761.011] (-762.030) (-760.715) (-758.036) * (-763.108) (-759.219) (-761.405) [-758.978] -- 0:00:48
223500 -- (-763.726) (-761.123) (-762.778) [-757.747] * (-760.225) (-758.994) (-761.564) [-760.165] -- 0:00:48
224000 -- [-758.761] (-760.279) (-761.058) (-761.210) * [-760.128] (-761.749) (-763.307) (-762.208) -- 0:00:48
224500 -- (-761.930) [-759.395] (-762.589) (-761.378) * (-761.570) (-761.841) [-759.005] (-761.101) -- 0:00:48
225000 -- (-765.412) (-759.601) (-762.676) [-759.866] * [-760.136] (-761.514) (-759.983) (-760.840) -- 0:00:48
Average standard deviation of split frequencies: 0.012863
225500 -- (-759.099) [-758.481] (-760.522) (-758.826) * (-760.683) (-759.964) (-763.344) [-759.830] -- 0:00:51
226000 -- (-759.814) [-757.432] (-769.147) (-759.295) * (-763.657) [-765.538] (-760.878) (-766.723) -- 0:00:51
226500 -- (-767.423) [-758.001] (-759.352) (-757.094) * (-761.634) (-762.884) (-760.723) [-759.689] -- 0:00:51
227000 -- (-760.361) [-758.225] (-759.689) (-758.243) * (-762.300) (-762.526) [-760.688] (-763.527) -- 0:00:51
227500 -- (-760.974) (-760.609) (-759.946) [-760.466] * (-758.743) (-761.130) (-761.002) [-760.233] -- 0:00:50
228000 -- [-760.597] (-760.617) (-760.973) (-758.138) * (-761.873) (-763.944) [-760.273] (-763.183) -- 0:00:50
228500 -- [-764.238] (-759.318) (-760.109) (-760.479) * (-767.005) (-760.213) [-763.276] (-759.570) -- 0:00:50
229000 -- [-759.387] (-760.863) (-760.690) (-768.865) * (-762.270) (-758.296) [-760.280] (-760.299) -- 0:00:50
229500 -- (-760.262) (-760.686) (-759.788) [-761.352] * (-761.515) [-759.684] (-759.668) (-760.436) -- 0:00:50
230000 -- (-761.227) [-759.610] (-760.971) (-765.444) * (-765.595) [-758.154] (-761.344) (-760.833) -- 0:00:50
Average standard deviation of split frequencies: 0.011541
230500 -- [-758.920] (-759.600) (-760.478) (-758.924) * (-760.057) (-759.717) [-759.333] (-761.395) -- 0:00:50
231000 -- (-759.514) (-759.544) (-761.481) [-760.934] * (-762.309) (-759.520) (-759.904) [-759.823] -- 0:00:49
231500 -- [-760.055] (-760.439) (-759.843) (-761.277) * (-761.916) (-760.929) (-763.354) [-759.227] -- 0:00:49
232000 -- (-760.253) [-757.078] (-760.661) (-763.880) * (-759.936) (-761.991) (-763.593) [-760.371] -- 0:00:49
232500 -- (-760.322) [-760.326] (-762.282) (-759.451) * (-759.237) [-760.871] (-761.714) (-765.548) -- 0:00:49
233000 -- (-759.697) (-759.308) (-761.981) [-759.020] * (-760.058) (-760.958) [-758.402] (-759.993) -- 0:00:49
233500 -- [-760.115] (-760.690) (-762.648) (-760.487) * [-760.459] (-761.247) (-759.978) (-760.085) -- 0:00:49
234000 -- (-770.113) (-760.435) (-762.344) [-763.267] * (-762.658) [-762.111] (-761.734) (-759.335) -- 0:00:49
234500 -- (-769.187) (-760.502) (-763.351) [-760.503] * (-766.317) [-760.434] (-765.007) (-758.281) -- 0:00:48
235000 -- (-761.880) (-761.813) (-764.228) [-761.993] * (-763.826) [-763.580] (-764.933) (-759.668) -- 0:00:48
Average standard deviation of split frequencies: 0.012455
235500 -- (-759.505) (-760.903) [-763.784] (-759.449) * (-758.785) (-758.239) (-765.817) [-759.459] -- 0:00:48
236000 -- (-761.073) (-761.621) [-760.826] (-761.478) * [-759.522] (-760.858) (-760.174) (-759.333) -- 0:00:48
236500 -- (-766.780) (-765.031) (-759.166) [-759.539] * (-761.439) (-761.502) (-760.442) [-756.897] -- 0:00:48
237000 -- (-760.619) (-763.167) (-759.416) [-762.153] * (-762.441) [-760.601] (-759.761) (-756.989) -- 0:00:48
237500 -- (-758.403) (-764.557) [-760.280] (-760.184) * [-759.581] (-759.964) (-757.713) (-761.576) -- 0:00:48
238000 -- (-760.282) (-762.114) (-762.206) [-761.987] * (-760.421) (-760.063) (-760.813) [-759.676] -- 0:00:48
238500 -- (-761.145) [-760.544] (-761.369) (-759.395) * (-764.527) (-762.679) [-758.063] (-758.655) -- 0:00:47
239000 -- (-761.206) (-761.105) (-758.341) [-761.483] * [-758.958] (-761.736) (-763.677) (-761.388) -- 0:00:47
239500 -- (-761.303) (-763.703) (-758.854) [-760.237] * (-762.740) (-765.604) (-760.710) [-764.102] -- 0:00:47
240000 -- (-760.775) (-761.757) [-761.886] (-757.641) * [-759.277] (-760.836) (-761.200) (-759.337) -- 0:00:47
Average standard deviation of split frequencies: 0.013366
240500 -- [-761.237] (-762.738) (-759.139) (-760.738) * [-759.197] (-759.512) (-759.508) (-760.738) -- 0:00:47
241000 -- [-760.786] (-764.437) (-759.946) (-759.552) * (-757.995) (-763.470) (-759.686) [-757.493] -- 0:00:47
241500 -- (-760.586) (-760.526) (-764.766) [-758.159] * [-760.362] (-759.691) (-760.768) (-757.951) -- 0:00:50
242000 -- (-759.852) [-759.752] (-767.330) (-761.113) * (-762.565) [-759.154] (-761.202) (-760.707) -- 0:00:50
242500 -- (-760.586) (-760.380) (-764.169) [-760.402] * (-761.034) (-760.501) (-760.196) [-757.456] -- 0:00:49
243000 -- (-762.552) [-759.224] (-761.879) (-758.333) * [-757.643] (-759.401) (-761.869) (-758.687) -- 0:00:49
243500 -- (-761.345) [-760.224] (-761.024) (-761.891) * [-759.195] (-757.722) (-762.520) (-763.191) -- 0:00:49
244000 -- [-761.304] (-759.176) (-759.710) (-762.281) * [-757.832] (-761.194) (-762.049) (-757.844) -- 0:00:49
244500 -- (-760.805) (-760.626) [-758.623] (-759.168) * (-761.572) (-761.355) [-759.742] (-758.672) -- 0:00:49
245000 -- [-763.793] (-761.081) (-760.102) (-760.882) * (-759.538) [-760.137] (-762.521) (-758.937) -- 0:00:49
Average standard deviation of split frequencies: 0.014053
245500 -- (-765.426) (-762.547) (-763.323) [-761.101] * [-760.213] (-757.755) (-761.978) (-759.190) -- 0:00:49
246000 -- (-763.225) (-762.924) (-763.516) [-760.683] * (-763.929) [-759.295] (-761.064) (-760.293) -- 0:00:49
246500 -- (-762.539) (-760.532) (-761.270) [-760.865] * [-764.013] (-762.730) (-759.726) (-759.998) -- 0:00:48
247000 -- (-761.127) (-761.968) [-759.630] (-760.603) * [-757.785] (-763.421) (-761.177) (-764.002) -- 0:00:48
247500 -- [-761.406] (-764.685) (-759.623) (-764.354) * [-763.375] (-761.667) (-761.177) (-766.588) -- 0:00:48
248000 -- [-765.461] (-766.081) (-760.014) (-761.764) * (-759.150) [-762.770] (-760.980) (-764.465) -- 0:00:48
248500 -- (-762.410) [-762.240] (-760.529) (-761.823) * (-759.349) (-763.138) (-759.891) [-761.177] -- 0:00:48
249000 -- (-760.894) (-762.562) (-759.463) [-764.300] * (-759.975) (-759.230) [-760.700] (-761.573) -- 0:00:48
249500 -- (-760.577) [-761.704] (-759.199) (-762.257) * [-759.399] (-759.912) (-764.084) (-759.921) -- 0:00:48
250000 -- [-758.130] (-763.735) (-758.359) (-762.699) * (-759.748) (-762.025) [-759.316] (-760.740) -- 0:00:48
Average standard deviation of split frequencies: 0.014550
250500 -- (-759.964) [-760.391] (-761.499) (-762.830) * (-758.873) [-757.157] (-759.409) (-759.179) -- 0:00:47
251000 -- [-761.121] (-761.513) (-762.056) (-762.855) * (-758.570) [-760.235] (-759.630) (-765.828) -- 0:00:47
251500 -- (-761.158) (-762.404) [-760.201] (-763.996) * [-758.743] (-760.137) (-759.883) (-763.500) -- 0:00:47
252000 -- (-759.133) (-761.173) (-761.936) [-763.071] * [-761.048] (-761.932) (-764.425) (-763.200) -- 0:00:47
252500 -- (-759.998) (-759.974) [-757.322] (-760.698) * [-760.083] (-760.714) (-763.249) (-761.660) -- 0:00:47
253000 -- [-761.624] (-758.553) (-758.872) (-759.179) * [-758.506] (-760.087) (-762.915) (-760.690) -- 0:00:47
253500 -- [-763.120] (-761.506) (-763.486) (-761.839) * (-759.900) [-758.405] (-759.418) (-761.256) -- 0:00:50
254000 -- (-761.483) (-760.145) (-759.584) [-759.980] * (-760.735) [-759.259] (-761.683) (-760.237) -- 0:00:49
254500 -- [-760.583] (-762.149) (-759.932) (-760.782) * (-766.160) [-758.182] (-764.822) (-765.318) -- 0:00:49
255000 -- [-758.899] (-762.483) (-761.185) (-759.223) * (-761.438) (-760.106) [-762.287] (-764.101) -- 0:00:49
Average standard deviation of split frequencies: 0.014629
255500 -- (-761.688) (-764.091) (-759.889) [-760.092] * (-758.883) (-760.479) (-760.603) [-762.629] -- 0:00:49
256000 -- [-758.768] (-761.142) (-764.363) (-763.256) * (-763.353) [-759.241] (-762.243) (-761.196) -- 0:00:49
256500 -- (-759.252) (-760.423) [-762.139] (-758.964) * (-761.353) (-760.058) (-763.760) [-760.172] -- 0:00:49
257000 -- (-759.915) [-761.169] (-760.568) (-762.508) * (-760.169) (-760.165) (-762.886) [-758.816] -- 0:00:49
257500 -- (-761.158) (-760.513) (-761.735) [-762.140] * (-760.149) [-761.041] (-760.865) (-765.862) -- 0:00:49
258000 -- [-758.676] (-760.675) (-761.450) (-760.230) * (-759.710) [-758.909] (-762.171) (-761.484) -- 0:00:48
258500 -- (-761.442) (-760.734) (-761.513) [-758.550] * [-758.631] (-758.908) (-759.572) (-762.756) -- 0:00:48
259000 -- (-762.755) [-762.550] (-762.108) (-760.997) * [-761.299] (-760.038) (-760.297) (-765.952) -- 0:00:48
259500 -- (-763.224) (-760.898) [-759.201] (-760.898) * (-761.001) [-758.275] (-759.786) (-758.356) -- 0:00:48
260000 -- (-763.162) [-762.194] (-759.749) (-762.671) * (-765.708) (-758.991) [-760.920] (-760.580) -- 0:00:48
Average standard deviation of split frequencies: 0.011808
260500 -- (-765.908) (-761.559) (-759.172) [-761.406] * [-761.513] (-758.555) (-761.301) (-764.872) -- 0:00:48
261000 -- (-760.429) [-759.760] (-758.164) (-764.274) * (-762.900) [-759.870] (-761.263) (-763.989) -- 0:00:48
261500 -- (-763.302) (-759.983) (-760.342) [-761.299] * (-760.275) [-760.779] (-764.079) (-761.213) -- 0:00:48
262000 -- (-762.632) (-763.372) [-759.729] (-764.638) * (-761.119) (-760.977) [-761.231] (-762.955) -- 0:00:47
262500 -- (-762.553) [-762.517] (-760.639) (-763.332) * (-759.987) [-760.170] (-761.666) (-762.002) -- 0:00:47
263000 -- (-763.544) (-763.918) (-763.447) [-761.260] * (-760.567) [-761.393] (-762.636) (-761.348) -- 0:00:47
263500 -- (-760.883) (-760.990) [-765.191] (-759.566) * [-760.146] (-763.375) (-761.533) (-761.339) -- 0:00:47
264000 -- (-760.131) (-764.201) [-761.456] (-760.291) * (-760.282) (-761.203) (-762.662) [-759.617] -- 0:00:47
264500 -- [-759.500] (-761.806) (-763.494) (-762.124) * (-758.937) [-762.277] (-766.753) (-760.239) -- 0:00:47
265000 -- [-759.252] (-763.059) (-762.757) (-760.026) * (-759.461) (-758.455) (-762.220) [-759.329] -- 0:00:47
Average standard deviation of split frequencies: 0.013431
265500 -- (-760.441) (-761.684) [-759.636] (-760.137) * (-759.372) [-758.332] (-763.125) (-760.101) -- 0:00:49
266000 -- [-761.517] (-762.422) (-765.807) (-762.321) * [-762.790] (-760.236) (-763.527) (-759.454) -- 0:00:49
266500 -- (-759.411) (-761.468) (-762.447) [-760.931] * (-762.057) (-761.092) [-764.863] (-761.063) -- 0:00:49
267000 -- (-759.127) (-759.161) [-762.279] (-760.684) * (-759.949) (-758.551) (-762.248) [-758.775] -- 0:00:49
267500 -- (-762.501) (-760.269) (-759.031) [-758.028] * [-761.261] (-764.518) (-762.836) (-762.069) -- 0:00:49
268000 -- (-761.081) [-760.085] (-760.834) (-760.905) * [-758.220] (-760.484) (-760.512) (-759.736) -- 0:00:49
268500 -- (-759.538) (-761.130) (-760.884) [-761.836] * [-757.558] (-762.876) (-761.636) (-758.802) -- 0:00:49
269000 -- (-759.795) (-760.235) (-763.402) [-760.792] * (-759.123) (-758.712) (-761.269) [-761.050] -- 0:00:48
269500 -- [-761.282] (-763.337) (-759.467) (-759.225) * (-767.349) [-758.732] (-759.666) (-761.425) -- 0:00:48
270000 -- (-759.991) (-763.177) (-760.890) [-759.609] * (-762.592) [-758.646] (-765.208) (-761.194) -- 0:00:48
Average standard deviation of split frequencies: 0.013108
270500 -- (-759.446) [-760.659] (-758.795) (-762.635) * (-759.273) [-760.546] (-759.224) (-763.117) -- 0:00:48
271000 -- (-759.063) (-759.116) [-759.162] (-759.999) * (-760.253) [-760.358] (-760.616) (-760.548) -- 0:00:48
271500 -- (-758.663) [-759.554] (-759.697) (-761.645) * (-763.332) (-759.307) [-760.389] (-762.358) -- 0:00:48
272000 -- (-760.778) [-760.271] (-763.325) (-758.375) * (-760.623) (-761.085) (-760.372) [-758.967] -- 0:00:48
272500 -- [-761.186] (-758.752) (-762.755) (-759.261) * (-758.573) (-763.309) [-759.635] (-761.567) -- 0:00:48
273000 -- (-759.820) [-761.160] (-760.581) (-762.760) * (-759.703) [-758.177] (-763.323) (-764.019) -- 0:00:47
273500 -- (-759.745) [-765.499] (-760.123) (-760.982) * (-761.636) (-763.659) [-759.577] (-759.090) -- 0:00:47
274000 -- (-760.610) (-759.907) (-758.989) [-763.590] * (-761.468) (-760.840) (-758.994) [-761.541] -- 0:00:47
274500 -- (-761.229) [-762.159] (-761.952) (-765.577) * (-758.224) (-758.702) [-760.230] (-759.200) -- 0:00:47
275000 -- (-763.136) (-762.830) (-762.301) [-759.417] * (-761.550) (-758.016) (-760.024) [-763.292] -- 0:00:47
Average standard deviation of split frequencies: 0.012525
275500 -- [-761.829] (-762.403) (-759.934) (-761.731) * (-760.922) [-763.465] (-758.978) (-761.804) -- 0:00:47
276000 -- (-763.881) (-760.710) [-760.494] (-760.824) * (-760.701) [-762.046] (-759.789) (-758.515) -- 0:00:47
276500 -- [-758.503] (-759.901) (-758.425) (-759.732) * (-760.580) (-761.200) (-756.819) [-759.829] -- 0:00:47
277000 -- (-760.868) (-760.400) [-759.565] (-762.688) * (-762.598) [-758.744] (-756.767) (-762.116) -- 0:00:46
277500 -- (-759.466) (-763.852) [-763.021] (-758.305) * [-759.674] (-759.360) (-761.895) (-760.648) -- 0:00:46
278000 -- [-757.712] (-760.152) (-760.061) (-764.136) * (-758.827) [-760.073] (-760.307) (-761.318) -- 0:00:46
278500 -- [-761.346] (-760.442) (-760.670) (-761.581) * (-758.948) (-763.770) [-757.475] (-761.004) -- 0:00:46
279000 -- [-759.944] (-761.105) (-761.487) (-760.459) * [-759.081] (-761.580) (-759.768) (-757.901) -- 0:00:46
279500 -- (-764.003) (-760.765) [-765.316] (-761.082) * (-760.017) (-759.861) (-758.443) [-759.682] -- 0:00:48
280000 -- (-760.078) (-761.166) (-761.230) [-760.178] * (-757.789) [-761.373] (-760.805) (-760.108) -- 0:00:48
Average standard deviation of split frequencies: 0.012784
280500 -- (-760.980) (-759.316) [-759.403] (-759.280) * (-757.758) [-759.980] (-760.043) (-761.520) -- 0:00:48
281000 -- (-762.394) (-762.294) [-759.851] (-759.085) * (-761.001) (-758.723) [-760.140] (-763.838) -- 0:00:48
281500 -- (-761.508) (-759.523) (-760.725) [-759.972] * (-765.322) (-761.854) (-761.758) [-760.206] -- 0:00:48
282000 -- (-762.823) [-760.191] (-765.091) (-758.934) * (-759.318) [-760.466] (-761.602) (-759.101) -- 0:00:48
282500 -- (-768.973) (-758.004) [-758.357] (-762.880) * [-759.424] (-761.796) (-761.045) (-763.383) -- 0:00:48
283000 -- (-767.643) (-761.986) (-757.333) [-761.984] * (-760.689) [-757.802] (-757.233) (-758.976) -- 0:00:48
283500 -- [-761.425] (-760.452) (-759.090) (-760.337) * (-761.206) [-759.417] (-761.795) (-758.567) -- 0:00:48
284000 -- (-760.190) (-760.490) [-758.749] (-760.142) * (-760.572) [-760.688] (-763.233) (-760.166) -- 0:00:47
284500 -- (-762.220) (-763.777) (-758.746) [-759.914] * (-761.377) (-761.074) (-761.169) [-758.845] -- 0:00:47
285000 -- (-762.683) (-761.555) (-760.168) [-758.084] * (-760.249) [-759.752] (-759.317) (-761.961) -- 0:00:47
Average standard deviation of split frequencies: 0.012666
285500 -- [-760.010] (-760.765) (-758.904) (-761.451) * (-759.176) (-759.755) (-759.027) [-760.824] -- 0:00:47
286000 -- (-759.343) [-760.866] (-760.567) (-763.275) * (-759.335) (-759.806) (-759.932) [-759.478] -- 0:00:47
286500 -- [-759.728] (-763.256) (-758.828) (-763.110) * (-759.847) (-759.521) [-759.632] (-758.827) -- 0:00:47
287000 -- (-759.947) (-765.041) (-758.501) [-763.634] * [-759.637] (-761.373) (-762.206) (-759.029) -- 0:00:47
287500 -- (-761.644) (-760.800) [-759.167] (-758.903) * (-761.189) (-761.276) (-760.220) [-756.501] -- 0:00:47
288000 -- [-760.845] (-761.897) (-764.381) (-758.583) * (-762.101) (-761.091) (-759.325) [-758.167] -- 0:00:46
288500 -- (-760.048) (-761.472) [-758.670] (-759.949) * (-760.238) [-759.493] (-760.794) (-762.475) -- 0:00:46
289000 -- (-760.921) (-760.810) (-761.950) [-757.235] * (-760.602) [-762.408] (-763.129) (-758.592) -- 0:00:46
289500 -- (-759.114) [-761.688] (-759.532) (-762.434) * [-760.157] (-759.728) (-760.481) (-759.845) -- 0:00:46
290000 -- (-759.736) (-761.268) [-759.225] (-764.257) * (-761.207) (-758.469) [-760.679] (-763.775) -- 0:00:46
Average standard deviation of split frequencies: 0.013948
290500 -- (-757.874) (-762.216) (-762.088) [-764.697] * (-760.100) (-760.020) [-764.042] (-759.633) -- 0:00:46
291000 -- (-759.273) [-762.360] (-758.679) (-764.190) * (-763.399) (-761.996) [-761.686] (-759.574) -- 0:00:46
291500 -- (-760.778) [-761.461] (-760.671) (-762.854) * (-758.833) [-760.636] (-764.422) (-758.395) -- 0:00:46
292000 -- (-760.186) (-764.614) [-758.472] (-760.608) * [-762.673] (-761.213) (-760.715) (-758.999) -- 0:00:46
292500 -- (-759.746) [-764.064] (-760.818) (-762.351) * (-760.598) (-761.840) (-761.937) [-758.696] -- 0:00:45
293000 -- [-759.998] (-758.866) (-763.300) (-759.839) * [-760.171] (-760.879) (-761.091) (-759.298) -- 0:00:45
293500 -- (-761.266) [-759.328] (-758.674) (-759.463) * (-761.303) (-760.855) (-758.139) [-759.646] -- 0:00:45
294000 -- [-760.119] (-760.187) (-764.715) (-758.630) * [-761.894] (-764.188) (-762.533) (-762.689) -- 0:00:48
294500 -- [-758.975] (-761.545) (-760.032) (-762.610) * (-760.126) (-761.508) [-760.163] (-762.039) -- 0:00:47
295000 -- [-758.836] (-759.937) (-758.681) (-764.937) * [-760.666] (-760.193) (-761.217) (-765.904) -- 0:00:47
Average standard deviation of split frequencies: 0.011325
295500 -- (-758.641) (-766.147) (-759.082) [-762.226] * (-761.804) (-760.070) [-760.983] (-764.345) -- 0:00:47
296000 -- (-758.648) (-759.668) (-759.329) [-758.427] * [-760.207] (-757.785) (-760.713) (-760.027) -- 0:00:47
296500 -- [-757.965] (-760.719) (-760.419) (-760.690) * (-760.801) (-757.520) [-761.005] (-760.034) -- 0:00:47
297000 -- [-760.428] (-761.148) (-758.294) (-759.035) * (-760.255) (-760.956) [-760.866] (-762.454) -- 0:00:47
297500 -- (-758.845) [-759.138] (-759.214) (-759.549) * (-761.403) (-760.259) [-759.505] (-765.848) -- 0:00:47
298000 -- (-761.794) (-761.639) [-759.845] (-758.267) * (-758.805) (-758.935) [-762.271] (-761.694) -- 0:00:47
298500 -- (-763.409) (-762.363) [-760.205] (-761.554) * (-761.438) [-760.113] (-760.683) (-760.069) -- 0:00:47
299000 -- (-761.786) (-758.721) (-763.552) [-763.757] * [-760.768] (-759.170) (-762.232) (-758.765) -- 0:00:46
299500 -- (-760.874) (-760.086) (-760.468) [-761.846] * (-760.559) (-759.016) [-760.030] (-760.412) -- 0:00:46
300000 -- [-763.053] (-759.975) (-767.301) (-762.289) * (-762.043) (-758.680) [-761.471] (-759.314) -- 0:00:46
Average standard deviation of split frequencies: 0.011323
300500 -- [-759.137] (-758.720) (-758.387) (-759.231) * [-758.088] (-759.236) (-759.330) (-760.475) -- 0:00:46
301000 -- (-760.156) [-759.472] (-759.901) (-760.833) * (-760.231) (-759.320) (-761.944) [-758.729] -- 0:00:46
301500 -- (-765.044) (-758.200) (-762.043) [-760.172] * [-758.861] (-759.718) (-761.431) (-759.617) -- 0:00:46
302000 -- (-762.288) (-762.269) [-760.210] (-761.640) * (-758.818) (-758.486) [-760.259] (-761.543) -- 0:00:46
302500 -- (-758.754) [-761.663] (-764.834) (-764.901) * (-760.803) (-760.019) [-760.618] (-758.892) -- 0:00:46
303000 -- (-762.657) (-760.704) [-763.301] (-768.360) * (-762.170) [-758.859] (-760.099) (-761.851) -- 0:00:46
303500 -- (-762.688) [-760.898] (-763.571) (-759.884) * (-759.577) (-762.713) (-759.659) [-759.809] -- 0:00:45
304000 -- (-762.125) [-760.404] (-762.426) (-762.871) * (-761.252) (-760.895) [-761.712] (-758.111) -- 0:00:45
304500 -- (-760.332) (-762.760) (-761.704) [-761.392] * (-760.109) [-760.888] (-761.728) (-762.730) -- 0:00:45
305000 -- [-758.540] (-760.959) (-760.264) (-761.288) * (-760.366) [-760.710] (-760.851) (-763.775) -- 0:00:45
Average standard deviation of split frequencies: 0.010955
305500 -- [-761.698] (-761.190) (-759.304) (-763.041) * (-760.874) [-763.735] (-759.640) (-765.356) -- 0:00:45
306000 -- (-760.589) (-761.043) [-762.260] (-759.538) * (-760.367) (-760.363) (-762.401) [-762.344] -- 0:00:45
306500 -- (-761.294) [-758.166] (-761.812) (-764.530) * (-765.665) (-763.723) (-760.647) [-758.495] -- 0:00:45
307000 -- [-762.333] (-760.475) (-760.412) (-765.295) * [-763.521] (-761.146) (-760.090) (-758.516) -- 0:00:45
307500 -- (-760.400) (-761.227) [-760.602] (-759.905) * (-761.305) (-759.394) [-761.131] (-759.124) -- 0:00:45
308000 -- (-760.295) [-759.807] (-759.696) (-759.912) * (-759.861) (-765.843) (-761.072) [-757.167] -- 0:00:44
308500 -- (-760.066) (-764.411) [-765.817] (-760.523) * [-760.576] (-760.737) (-761.115) (-762.238) -- 0:00:44
309000 -- (-763.292) [-760.762] (-761.890) (-761.071) * [-759.475] (-761.069) (-760.781) (-759.901) -- 0:00:46
309500 -- (-765.081) (-760.278) (-761.969) [-758.850] * (-760.000) [-759.884] (-761.474) (-759.693) -- 0:00:46
310000 -- (-765.014) (-759.838) [-762.032] (-759.157) * [-757.302] (-762.361) (-761.705) (-761.542) -- 0:00:46
Average standard deviation of split frequencies: 0.011820
310500 -- (-764.990) [-763.217] (-761.592) (-758.630) * (-757.656) (-762.775) (-760.100) [-759.002] -- 0:00:46
311000 -- (-761.627) (-761.537) (-760.359) [-758.598] * [-760.089] (-760.719) (-761.630) (-759.084) -- 0:00:46
311500 -- (-761.045) (-760.599) (-760.409) [-758.375] * (-757.739) (-761.432) (-760.640) [-757.836] -- 0:00:46
312000 -- [-760.130] (-760.046) (-762.170) (-760.494) * (-757.439) [-760.680] (-761.609) (-760.277) -- 0:00:46
312500 -- (-758.795) (-761.879) [-758.563] (-764.784) * [-758.178] (-760.393) (-762.978) (-763.806) -- 0:00:46
313000 -- [-759.072] (-764.652) (-762.999) (-758.654) * (-760.075) (-761.339) [-761.756] (-761.920) -- 0:00:46
313500 -- (-759.343) [-760.223] (-758.606) (-758.962) * [-759.584] (-760.872) (-758.499) (-758.549) -- 0:00:45
314000 -- (-761.540) (-759.137) (-758.421) [-759.022] * [-757.527] (-760.316) (-759.815) (-760.595) -- 0:00:45
314500 -- (-759.163) (-761.106) [-758.448] (-769.153) * (-761.301) (-762.676) [-759.626] (-760.853) -- 0:00:45
315000 -- (-758.569) (-766.765) (-759.841) [-763.239] * (-760.419) (-762.917) (-758.056) [-759.514] -- 0:00:45
Average standard deviation of split frequencies: 0.010618
315500 -- (-761.533) [-761.372] (-759.078) (-759.927) * (-759.840) (-761.416) [-761.149] (-758.964) -- 0:00:45
316000 -- (-764.667) (-758.989) [-760.928] (-768.264) * [-759.245] (-761.665) (-760.726) (-758.362) -- 0:00:45
316500 -- (-762.847) (-760.517) (-761.092) [-758.128] * (-759.169) [-760.023] (-759.497) (-760.985) -- 0:00:45
317000 -- (-761.204) [-759.691] (-759.404) (-759.660) * (-759.953) [-759.865] (-758.589) (-762.185) -- 0:00:45
317500 -- (-760.871) (-763.413) (-761.274) [-758.090] * (-759.643) (-767.855) (-761.020) [-761.719] -- 0:00:45
318000 -- [-760.762] (-760.884) (-762.071) (-758.555) * [-761.074] (-761.147) (-760.352) (-763.844) -- 0:00:45
318500 -- (-759.596) [-760.935] (-758.183) (-762.584) * (-762.940) [-762.005] (-766.034) (-759.455) -- 0:00:44
319000 -- (-760.363) (-760.356) (-761.165) [-758.566] * (-757.977) [-763.044] (-760.038) (-758.375) -- 0:00:44
319500 -- (-761.811) (-761.136) (-763.440) [-757.555] * (-758.983) (-763.886) (-759.305) [-758.438] -- 0:00:44
320000 -- [-758.786] (-757.134) (-759.764) (-760.550) * [-760.351] (-759.710) (-758.399) (-760.341) -- 0:00:44
Average standard deviation of split frequencies: 0.010550
320500 -- (-757.559) (-759.959) [-761.004] (-758.841) * [-761.093] (-759.237) (-763.392) (-757.720) -- 0:00:44
321000 -- (-758.889) (-764.758) [-760.992] (-760.859) * (-761.288) (-760.405) [-762.461] (-757.546) -- 0:00:44
321500 -- (-759.206) [-760.064] (-763.059) (-762.994) * (-760.631) (-760.360) [-760.352] (-758.221) -- 0:00:44
322000 -- (-760.024) (-760.671) [-760.088] (-757.443) * (-763.339) [-759.910] (-763.877) (-761.940) -- 0:00:44
322500 -- (-762.564) [-758.736] (-759.254) (-760.545) * (-765.850) [-760.766] (-760.449) (-763.126) -- 0:00:44
323000 -- (-760.280) (-760.803) [-757.452] (-761.118) * (-764.357) (-761.395) (-762.969) [-760.090] -- 0:00:44
323500 -- (-764.700) (-761.442) [-758.000] (-759.241) * (-760.637) (-759.434) (-760.173) [-758.644] -- 0:00:43
324000 -- [-763.809] (-758.973) (-758.638) (-764.196) * [-760.846] (-760.649) (-760.017) (-760.405) -- 0:00:45
324500 -- (-762.720) (-759.097) (-761.671) [-760.841] * [-762.021] (-764.404) (-764.298) (-759.807) -- 0:00:45
325000 -- (-759.970) [-758.663] (-763.993) (-766.480) * (-759.430) [-764.112] (-761.591) (-759.030) -- 0:00:45
Average standard deviation of split frequencies: 0.010207
325500 -- [-759.929] (-757.474) (-761.689) (-761.322) * (-758.346) (-761.832) (-760.673) [-760.605] -- 0:00:45
326000 -- (-760.207) (-762.094) [-762.315] (-761.577) * [-762.484] (-760.826) (-761.225) (-760.878) -- 0:00:45
326500 -- [-760.605] (-761.664) (-759.336) (-761.390) * (-761.325) (-761.070) (-761.645) [-760.984] -- 0:00:45
327000 -- (-762.660) (-763.500) (-761.915) [-759.148] * (-762.542) (-758.115) (-759.227) [-760.404] -- 0:00:45
327500 -- (-762.834) (-764.049) (-765.534) [-759.415] * (-764.314) (-761.813) (-759.809) [-759.602] -- 0:00:45
328000 -- (-761.968) (-760.917) [-762.922] (-760.570) * (-760.283) [-763.921] (-760.839) (-760.232) -- 0:00:45
328500 -- (-760.592) (-760.725) (-759.915) [-761.051] * [-762.345] (-765.535) (-761.319) (-762.354) -- 0:00:44
329000 -- [-762.812] (-761.331) (-759.080) (-760.952) * (-762.731) (-768.692) [-760.877] (-759.550) -- 0:00:44
329500 -- (-762.621) (-758.102) (-757.561) [-760.846] * [-761.374] (-762.650) (-760.870) (-759.243) -- 0:00:44
330000 -- [-761.476] (-764.531) (-758.088) (-760.192) * (-759.972) (-762.502) (-760.932) [-760.013] -- 0:00:44
Average standard deviation of split frequencies: 0.008134
330500 -- (-764.251) (-759.724) (-760.555) [-761.139] * [-762.377] (-766.373) (-761.904) (-758.648) -- 0:00:44
331000 -- (-760.523) (-761.567) (-757.832) [-759.704] * (-760.280) [-762.308] (-759.638) (-760.342) -- 0:00:44
331500 -- (-760.622) (-758.547) (-760.830) [-760.853] * (-761.886) [-759.484] (-760.851) (-765.632) -- 0:00:44
332000 -- (-761.553) [-760.003] (-762.258) (-761.203) * (-758.481) (-761.717) [-761.117] (-761.574) -- 0:00:44
332500 -- (-764.396) [-759.606] (-761.750) (-760.631) * (-760.508) (-762.047) (-759.174) [-761.533] -- 0:00:44
333000 -- (-760.479) [-758.318] (-759.237) (-760.077) * (-762.318) (-762.337) [-759.175] (-758.832) -- 0:00:44
333500 -- (-762.138) (-760.382) (-759.949) [-761.915] * [-760.098] (-761.059) (-758.144) (-761.384) -- 0:00:43
334000 -- (-760.558) (-761.304) [-761.322] (-762.360) * (-761.869) [-759.507] (-758.436) (-760.385) -- 0:00:43
334500 -- (-763.778) (-761.151) [-759.184] (-758.916) * [-759.420] (-763.657) (-761.472) (-758.495) -- 0:00:43
335000 -- [-759.885] (-760.707) (-759.901) (-761.142) * (-759.656) (-761.992) (-759.955) [-757.814] -- 0:00:43
Average standard deviation of split frequencies: 0.007804
335500 -- [-760.763] (-759.512) (-761.547) (-761.676) * (-762.800) (-762.443) [-759.947] (-757.670) -- 0:00:43
336000 -- (-760.113) [-760.262] (-760.708) (-760.276) * (-758.035) (-760.529) [-759.477] (-760.433) -- 0:00:43
336500 -- (-761.613) (-759.688) [-760.241] (-764.135) * (-761.654) (-760.845) (-758.544) [-758.507] -- 0:00:43
337000 -- (-763.904) [-760.091] (-760.465) (-761.489) * (-761.049) (-760.535) (-761.265) [-759.353] -- 0:00:43
337500 -- (-758.123) (-762.971) (-758.214) [-760.139] * (-761.951) (-759.947) [-758.025] (-760.445) -- 0:00:43
338000 -- (-759.594) (-760.417) [-758.768] (-764.313) * [-760.534] (-761.308) (-761.741) (-762.765) -- 0:00:43
338500 -- (-760.217) (-760.389) [-761.586] (-762.620) * (-761.784) (-760.461) [-767.154] (-758.115) -- 0:00:42
339000 -- (-758.602) [-760.490] (-762.167) (-763.264) * [-762.279] (-759.204) (-758.366) (-761.247) -- 0:00:44
339500 -- (-758.323) [-761.701] (-758.810) (-768.326) * (-763.096) [-759.442] (-764.678) (-759.245) -- 0:00:44
340000 -- (-759.160) [-760.605] (-762.702) (-762.004) * (-762.089) [-756.486] (-760.768) (-757.529) -- 0:00:44
Average standard deviation of split frequencies: 0.008130
340500 -- (-759.467) (-762.945) (-762.115) [-761.141] * (-759.980) [-759.179] (-761.914) (-761.518) -- 0:00:44
341000 -- (-758.336) (-759.844) [-759.896] (-766.008) * [-759.469] (-761.324) (-761.931) (-758.154) -- 0:00:44
341500 -- (-764.949) [-760.593] (-760.253) (-770.348) * (-758.743) (-760.212) (-763.281) [-757.939] -- 0:00:44
342000 -- (-759.289) [-759.729] (-761.365) (-760.031) * (-760.868) (-759.810) (-761.078) [-758.462] -- 0:00:44
342500 -- (-761.100) (-758.476) [-760.676] (-761.186) * (-760.050) [-759.289] (-762.095) (-759.590) -- 0:00:44
343000 -- (-762.778) [-761.284] (-760.418) (-762.792) * [-760.952] (-761.289) (-762.451) (-759.999) -- 0:00:44
343500 -- (-760.575) (-760.803) (-762.049) [-760.872] * (-760.239) [-761.944] (-760.128) (-760.644) -- 0:00:43
344000 -- (-763.470) (-761.371) [-761.273] (-759.645) * (-761.524) (-763.273) (-763.988) [-758.271] -- 0:00:43
344500 -- [-761.436] (-761.570) (-760.410) (-759.882) * (-762.059) [-761.489] (-761.854) (-757.982) -- 0:00:43
345000 -- (-763.547) (-759.195) (-760.779) [-759.958] * (-762.444) [-760.482] (-759.196) (-759.195) -- 0:00:43
Average standard deviation of split frequencies: 0.008686
345500 -- (-760.284) [-761.071] (-760.326) (-764.119) * (-759.866) (-761.971) (-759.766) [-760.067] -- 0:00:43
346000 -- [-760.310] (-760.387) (-760.779) (-761.438) * (-759.601) (-759.744) (-760.333) [-760.002] -- 0:00:43
346500 -- [-761.015] (-766.092) (-761.663) (-760.868) * (-759.164) [-760.411] (-758.583) (-758.564) -- 0:00:43
347000 -- [-759.289] (-761.503) (-762.673) (-762.043) * (-761.517) (-761.897) [-758.577] (-758.676) -- 0:00:43
347500 -- [-762.214] (-760.379) (-759.800) (-761.014) * (-761.028) (-763.735) [-758.552] (-759.394) -- 0:00:43
348000 -- (-761.004) (-762.303) [-760.250] (-757.798) * (-762.665) [-760.369] (-763.479) (-759.087) -- 0:00:43
348500 -- (-764.701) (-760.985) (-760.112) [-758.839] * (-761.436) (-759.500) (-761.665) [-758.609] -- 0:00:42
349000 -- [-764.627] (-760.123) (-761.155) (-760.224) * (-759.697) (-760.592) (-759.697) [-757.794] -- 0:00:42
349500 -- [-759.851] (-760.128) (-763.039) (-758.191) * [-758.953] (-765.397) (-761.629) (-759.509) -- 0:00:42
350000 -- [-758.746] (-759.682) (-761.327) (-762.020) * [-758.384] (-765.172) (-759.770) (-760.177) -- 0:00:42
Average standard deviation of split frequencies: 0.007982
350500 -- (-761.248) (-760.135) (-761.533) [-760.338] * [-759.839] (-765.713) (-762.695) (-763.396) -- 0:00:42
351000 -- (-758.078) (-760.709) (-764.534) [-759.587] * (-763.353) (-763.231) [-758.119] (-762.910) -- 0:00:42
351500 -- (-759.288) (-759.838) (-760.763) [-759.462] * (-759.310) (-760.327) (-759.143) [-759.548] -- 0:00:42
352000 -- (-760.733) (-761.797) [-760.824] (-758.471) * [-762.156] (-760.582) (-762.375) (-760.613) -- 0:00:42
352500 -- [-758.589] (-761.718) (-763.532) (-760.076) * [-758.120] (-761.089) (-765.600) (-759.110) -- 0:00:42
353000 -- (-760.288) (-759.740) [-762.691] (-757.655) * (-761.735) (-759.904) (-761.065) [-759.221] -- 0:00:42
353500 -- (-760.683) (-760.574) (-760.424) [-758.344] * [-759.306] (-762.860) (-759.389) (-758.237) -- 0:00:42
354000 -- (-759.571) (-760.837) (-759.973) [-760.971] * [-761.390] (-760.897) (-762.068) (-759.423) -- 0:00:43
354500 -- (-757.487) (-759.361) (-760.840) [-758.300] * [-759.481] (-758.805) (-761.733) (-759.503) -- 0:00:43
355000 -- (-760.866) [-761.672] (-762.730) (-758.526) * [-762.448] (-763.336) (-762.028) (-763.404) -- 0:00:43
Average standard deviation of split frequencies: 0.007697
355500 -- [-760.952] (-763.522) (-761.394) (-757.440) * (-758.864) (-761.389) [-757.840] (-763.162) -- 0:00:43
356000 -- [-758.562] (-761.884) (-760.925) (-761.465) * [-759.956] (-759.819) (-759.917) (-762.225) -- 0:00:43
356500 -- (-758.813) (-762.198) (-761.595) [-759.643] * (-763.430) [-762.001] (-760.297) (-762.916) -- 0:00:43
357000 -- (-759.357) [-760.484] (-761.876) (-760.851) * (-762.828) [-760.761] (-759.149) (-758.783) -- 0:00:43
357500 -- (-760.436) (-763.116) [-761.004] (-761.452) * [-761.323] (-761.124) (-757.951) (-764.491) -- 0:00:43
358000 -- (-760.358) [-760.431] (-761.245) (-759.074) * (-762.110) [-758.880] (-758.681) (-760.639) -- 0:00:43
358500 -- (-761.819) (-761.085) [-762.156] (-765.962) * (-758.886) [-758.790] (-759.992) (-759.796) -- 0:00:42
359000 -- (-759.174) (-759.303) [-760.996] (-762.387) * [-758.689] (-762.939) (-764.079) (-761.318) -- 0:00:42
359500 -- (-759.068) (-761.758) [-761.457] (-761.777) * (-759.445) (-763.531) [-758.694] (-759.956) -- 0:00:42
360000 -- [-758.305] (-760.804) (-760.050) (-761.756) * [-759.673] (-762.232) (-759.752) (-760.426) -- 0:00:42
Average standard deviation of split frequencies: 0.007352
360500 -- (-758.976) (-764.298) [-760.811] (-760.403) * (-759.354) (-759.231) (-760.236) [-759.398] -- 0:00:42
361000 -- (-760.360) (-761.938) (-763.807) [-762.607] * (-761.479) (-761.434) [-758.519] (-760.624) -- 0:00:42
361500 -- (-760.954) [-758.731] (-758.620) (-761.879) * (-758.670) (-760.850) [-759.069] (-761.877) -- 0:00:42
362000 -- (-762.052) [-759.239] (-761.739) (-765.411) * (-760.050) (-762.443) [-760.033] (-760.153) -- 0:00:42
362500 -- (-761.486) (-759.269) [-760.570] (-759.113) * [-760.587] (-763.306) (-759.384) (-758.641) -- 0:00:42
363000 -- (-759.333) (-759.814) (-760.107) [-760.045] * (-764.328) (-759.360) [-762.346] (-759.032) -- 0:00:42
363500 -- (-762.900) (-760.663) (-762.621) [-758.282] * [-763.578] (-758.904) (-764.147) (-761.368) -- 0:00:42
364000 -- (-761.837) (-762.411) (-760.128) [-759.382] * (-760.658) (-759.840) [-759.103] (-760.961) -- 0:00:41
364500 -- (-762.215) (-760.427) (-762.778) [-759.880] * [-760.039] (-759.312) (-759.800) (-763.587) -- 0:00:41
365000 -- [-761.140] (-762.385) (-761.408) (-759.217) * [-761.789] (-759.032) (-760.483) (-759.440) -- 0:00:41
Average standard deviation of split frequencies: 0.007576
365500 -- [-761.947] (-758.459) (-761.550) (-760.256) * (-761.179) (-761.208) [-757.873] (-761.374) -- 0:00:41
366000 -- [-759.695] (-762.459) (-764.926) (-759.376) * (-764.338) [-761.423] (-759.009) (-760.603) -- 0:00:41
366500 -- (-758.775) [-760.646] (-760.387) (-764.674) * (-760.469) (-760.628) (-759.415) [-758.651] -- 0:00:41
367000 -- [-757.624] (-760.382) (-767.881) (-765.651) * (-760.382) (-763.828) (-763.175) [-760.547] -- 0:00:41
367500 -- (-759.513) (-763.883) (-761.052) [-758.030] * [-760.348] (-762.331) (-760.487) (-759.011) -- 0:00:41
368000 -- (-759.202) [-759.872] (-762.609) (-760.416) * (-759.037) (-761.550) (-762.989) [-761.546] -- 0:00:41
368500 -- (-758.188) (-760.748) (-761.057) [-759.395] * (-759.296) [-760.340] (-760.318) (-759.415) -- 0:00:41
369000 -- (-761.236) (-761.471) (-760.380) [-760.686] * (-761.532) (-760.212) [-759.110] (-762.093) -- 0:00:42
369500 -- (-761.892) (-758.660) (-759.976) [-761.552] * (-758.661) [-759.109] (-758.130) (-760.192) -- 0:00:42
370000 -- (-764.842) (-759.639) [-760.080] (-758.039) * (-758.015) (-758.118) [-759.542] (-760.321) -- 0:00:42
Average standard deviation of split frequencies: 0.008080
370500 -- (-761.897) (-760.710) [-759.108] (-761.362) * (-762.147) (-766.044) [-760.864] (-761.385) -- 0:00:42
371000 -- (-759.092) (-760.725) [-762.466] (-758.922) * (-758.139) [-759.902] (-760.507) (-760.994) -- 0:00:42
371500 -- (-761.397) [-760.891] (-762.397) (-759.315) * (-759.461) (-756.835) (-758.510) [-760.227] -- 0:00:42
372000 -- (-758.377) [-760.487] (-762.402) (-758.258) * [-759.013] (-759.983) (-762.670) (-761.178) -- 0:00:42
372500 -- (-760.907) [-763.462] (-761.938) (-759.288) * [-758.440] (-764.140) (-760.346) (-761.195) -- 0:00:42
373000 -- (-762.483) [-762.514] (-760.534) (-768.023) * [-759.993] (-759.453) (-762.185) (-766.046) -- 0:00:42
373500 -- (-760.114) (-759.189) (-760.226) [-759.944] * (-759.551) (-762.028) (-760.240) [-762.957] -- 0:00:41
374000 -- (-757.943) (-759.471) [-761.417] (-757.945) * (-759.101) (-762.017) (-763.448) [-759.535] -- 0:00:41
374500 -- (-759.075) (-763.635) (-761.487) [-761.389] * (-759.349) [-759.526] (-760.238) (-760.045) -- 0:00:41
375000 -- [-761.298] (-759.626) (-763.376) (-761.820) * (-758.904) (-763.032) [-761.020] (-762.635) -- 0:00:41
Average standard deviation of split frequencies: 0.006974
375500 -- (-758.886) (-761.429) (-760.929) [-758.215] * (-761.720) (-759.287) [-761.000] (-760.789) -- 0:00:41
376000 -- (-759.644) [-761.828] (-760.572) (-763.216) * [-759.181] (-760.879) (-760.598) (-762.066) -- 0:00:41
376500 -- [-761.868] (-769.221) (-761.413) (-757.798) * (-760.515) (-761.433) [-759.065] (-765.114) -- 0:00:41
377000 -- (-759.181) [-760.903] (-760.400) (-758.257) * (-761.026) [-764.082] (-758.942) (-760.686) -- 0:00:41
377500 -- (-762.266) (-759.651) [-761.188] (-757.510) * (-760.629) (-758.811) [-760.125] (-761.034) -- 0:00:41
378000 -- (-762.285) (-760.142) (-760.396) [-760.279] * [-758.693] (-760.939) (-767.069) (-760.715) -- 0:00:41
378500 -- [-763.767] (-759.909) (-760.842) (-761.456) * (-761.747) [-761.726] (-761.464) (-760.517) -- 0:00:41
379000 -- [-762.629] (-759.744) (-761.313) (-761.396) * (-758.318) (-760.706) (-760.636) [-759.482] -- 0:00:40
379500 -- (-762.850) [-762.344] (-757.722) (-758.389) * (-761.042) (-759.639) (-759.669) [-761.436] -- 0:00:40
380000 -- (-761.928) (-761.458) [-760.119] (-758.566) * [-757.799] (-765.923) (-759.813) (-765.421) -- 0:00:40
Average standard deviation of split frequencies: 0.006888
380500 -- (-759.544) (-760.421) (-760.908) [-758.268] * (-759.870) (-760.110) [-760.901] (-763.986) -- 0:00:40
381000 -- (-760.852) (-759.507) [-758.542] (-759.158) * [-759.683] (-759.729) (-758.078) (-762.195) -- 0:00:40
381500 -- (-760.059) (-760.570) [-757.648] (-759.810) * (-763.800) [-763.534] (-759.478) (-760.348) -- 0:00:40
382000 -- (-759.175) [-760.632] (-759.284) (-760.476) * [-758.763] (-766.874) (-757.918) (-759.850) -- 0:00:40
382500 -- [-759.568] (-762.062) (-762.213) (-759.807) * (-758.307) (-760.554) [-761.338] (-761.058) -- 0:00:40
383000 -- [-759.508] (-759.209) (-763.510) (-760.230) * (-759.344) (-759.333) (-756.447) [-760.659] -- 0:00:40
383500 -- (-764.087) (-757.944) [-760.224] (-758.625) * (-759.416) [-759.571] (-760.955) (-757.886) -- 0:00:40
384000 -- (-761.556) (-759.488) [-758.334] (-761.600) * [-760.728] (-761.269) (-759.786) (-762.054) -- 0:00:41
384500 -- (-760.685) (-759.327) (-757.736) [-759.964] * (-763.214) [-759.426] (-760.432) (-759.032) -- 0:00:41
385000 -- (-760.329) (-761.026) (-757.799) [-758.929] * (-761.999) (-761.679) [-762.180] (-761.199) -- 0:00:41
Average standard deviation of split frequencies: 0.006335
385500 -- (-761.417) (-758.098) (-760.669) [-759.991] * (-760.820) [-759.506] (-758.924) (-759.883) -- 0:00:41
386000 -- (-759.288) [-760.022] (-765.742) (-762.129) * [-757.506] (-759.426) (-757.267) (-762.681) -- 0:00:41
386500 -- (-759.383) (-760.481) (-761.886) [-759.499] * (-760.851) (-759.455) [-758.140] (-764.916) -- 0:00:41
387000 -- (-759.146) [-758.294] (-759.124) (-760.212) * (-760.817) (-761.588) [-757.755] (-761.366) -- 0:00:41
387500 -- (-760.199) (-763.380) [-758.569] (-764.070) * (-756.252) [-760.677] (-757.688) (-760.562) -- 0:00:41
388000 -- [-762.777] (-767.735) (-764.353) (-763.247) * (-764.542) [-762.614] (-760.727) (-761.849) -- 0:00:41
388500 -- (-758.233) (-766.338) (-762.558) [-760.866] * [-759.905] (-760.518) (-760.489) (-761.635) -- 0:00:40
389000 -- (-760.291) (-760.395) [-757.316] (-762.164) * (-760.615) (-759.823) [-760.208] (-760.991) -- 0:00:40
389500 -- (-762.139) [-762.352] (-758.501) (-761.845) * (-762.996) [-761.787] (-758.016) (-762.102) -- 0:00:40
390000 -- (-759.172) [-760.740] (-761.374) (-760.247) * (-759.402) [-762.374] (-759.959) (-760.821) -- 0:00:40
Average standard deviation of split frequencies: 0.007595
390500 -- (-760.072) (-761.523) (-759.640) [-758.653] * (-759.715) (-771.936) (-760.759) [-760.816] -- 0:00:40
391000 -- (-758.889) (-761.413) [-758.876] (-759.816) * [-761.323] (-759.685) (-757.567) (-761.227) -- 0:00:40
391500 -- [-759.505] (-762.796) (-760.493) (-762.373) * (-764.777) (-760.407) [-759.112] (-765.033) -- 0:00:40
392000 -- (-759.796) (-760.137) [-759.864] (-759.620) * (-764.413) [-758.807] (-764.114) (-760.672) -- 0:00:40
392500 -- (-763.213) [-760.791] (-758.161) (-760.634) * [-758.928] (-758.297) (-760.301) (-761.145) -- 0:00:40
393000 -- (-760.789) [-759.125] (-762.102) (-762.153) * (-764.726) (-759.168) [-759.860] (-762.693) -- 0:00:40
393500 -- [-762.173] (-759.833) (-757.576) (-763.512) * (-760.897) [-760.744] (-763.351) (-763.833) -- 0:00:40
394000 -- (-760.291) (-760.825) [-758.671] (-761.863) * (-758.055) [-759.911] (-758.815) (-761.148) -- 0:00:39
394500 -- (-762.833) (-760.232) [-759.930] (-758.342) * (-763.289) (-760.470) [-761.956] (-759.631) -- 0:00:39
395000 -- (-760.377) [-761.539] (-760.236) (-760.081) * (-759.995) (-762.363) (-759.630) [-764.211] -- 0:00:39
Average standard deviation of split frequencies: 0.007983
395500 -- (-760.358) (-761.293) [-759.648] (-767.268) * (-762.073) (-761.985) [-759.869] (-759.663) -- 0:00:39
396000 -- (-760.888) [-760.413] (-764.745) (-760.862) * (-762.678) (-763.057) (-760.342) [-761.562] -- 0:00:39
396500 -- (-762.825) (-760.359) [-758.111] (-759.801) * [-761.507] (-760.609) (-760.000) (-760.030) -- 0:00:39
397000 -- [-758.876] (-761.673) (-759.982) (-759.459) * (-760.774) (-761.107) [-759.100] (-761.706) -- 0:00:39
397500 -- (-761.381) (-768.284) (-757.928) [-759.963] * (-757.964) [-765.667] (-759.741) (-761.739) -- 0:00:39
398000 -- (-759.767) (-761.518) (-765.650) [-760.753] * (-761.133) [-759.155] (-757.795) (-760.844) -- 0:00:39
398500 -- (-760.689) (-764.131) (-763.181) [-759.359] * (-762.307) [-759.840] (-765.028) (-760.669) -- 0:00:39
399000 -- (-760.050) (-760.112) (-758.154) [-758.532] * (-760.248) [-761.290] (-762.554) (-763.533) -- 0:00:40
399500 -- (-762.041) [-762.225] (-760.790) (-761.529) * (-764.598) [-760.864] (-762.119) (-762.073) -- 0:00:40
400000 -- [-761.672] (-762.363) (-761.037) (-760.780) * [-758.429] (-761.607) (-760.897) (-761.211) -- 0:00:40
Average standard deviation of split frequencies: 0.008028
400500 -- (-759.884) [-760.956] (-760.612) (-760.883) * (-758.734) [-761.127] (-762.902) (-759.380) -- 0:00:40
401000 -- (-760.556) (-762.368) (-763.799) [-760.996] * (-758.422) (-761.444) (-760.502) [-760.008] -- 0:00:40
401500 -- [-759.340] (-759.698) (-760.872) (-764.793) * (-757.496) (-759.997) (-762.493) [-763.055] -- 0:00:40
402000 -- [-762.536] (-760.846) (-762.839) (-760.353) * (-758.806) [-759.155] (-768.667) (-759.498) -- 0:00:40
402500 -- (-763.949) (-762.886) (-765.913) [-758.726] * [-764.222] (-760.798) (-761.586) (-760.954) -- 0:00:40
403000 -- (-763.184) [-762.028] (-759.600) (-762.142) * [-761.461] (-761.267) (-761.538) (-761.762) -- 0:00:39
403500 -- (-760.842) (-759.435) [-758.374] (-764.560) * (-759.067) [-760.225] (-765.095) (-760.528) -- 0:00:39
404000 -- (-762.026) [-760.296] (-758.960) (-762.875) * [-761.532] (-762.041) (-763.384) (-761.783) -- 0:00:39
404500 -- (-761.942) [-761.852] (-760.375) (-763.165) * (-761.471) (-759.081) (-764.949) [-761.362] -- 0:00:39
405000 -- (-760.370) (-761.093) [-759.919] (-763.933) * [-758.430] (-760.120) (-758.976) (-758.881) -- 0:00:39
Average standard deviation of split frequencies: 0.007923
405500 -- (-758.645) [-758.057] (-760.828) (-760.341) * (-758.574) (-760.809) [-761.276] (-759.706) -- 0:00:39
406000 -- (-759.723) [-759.846] (-759.264) (-760.736) * (-758.531) [-758.107] (-761.849) (-763.473) -- 0:00:39
406500 -- (-761.743) [-759.947] (-758.633) (-761.187) * (-760.524) (-758.063) [-759.087] (-760.227) -- 0:00:39
407000 -- (-759.792) (-760.984) [-760.785] (-761.051) * (-759.339) (-759.501) (-760.659) [-758.516] -- 0:00:39
407500 -- (-760.201) (-759.577) [-761.156] (-761.770) * (-759.078) (-758.812) [-761.971] (-761.008) -- 0:00:39
408000 -- (-760.880) (-760.146) [-759.138] (-760.228) * [-759.309] (-757.805) (-762.111) (-760.901) -- 0:00:39
408500 -- (-762.182) (-760.025) (-762.047) [-762.278] * [-761.827] (-759.257) (-762.328) (-758.286) -- 0:00:39
409000 -- (-764.127) (-764.462) [-759.278] (-761.829) * [-758.115] (-761.323) (-761.876) (-757.780) -- 0:00:39
409500 -- [-762.470] (-760.618) (-760.939) (-764.017) * (-758.914) (-763.448) [-760.495] (-760.000) -- 0:00:38
410000 -- (-761.690) [-760.176] (-760.963) (-762.946) * (-763.773) [-760.742] (-759.102) (-760.340) -- 0:00:38
Average standard deviation of split frequencies: 0.008170
410500 -- (-759.401) (-759.975) [-758.947] (-761.966) * [-759.733] (-764.714) (-761.640) (-761.488) -- 0:00:38
411000 -- [-764.310] (-762.192) (-761.017) (-761.551) * [-760.640] (-760.148) (-762.575) (-761.520) -- 0:00:38
411500 -- (-761.144) (-760.223) [-762.099] (-760.308) * [-759.428] (-761.867) (-760.374) (-758.442) -- 0:00:38
412000 -- [-763.219] (-761.720) (-759.088) (-758.771) * [-759.975] (-761.621) (-763.090) (-760.340) -- 0:00:39
412500 -- (-762.298) (-760.513) (-759.935) [-758.021] * (-760.313) (-761.384) (-760.466) [-759.877] -- 0:00:39
413000 -- (-760.590) (-760.771) (-763.259) [-759.955] * (-761.838) [-760.126] (-759.515) (-758.553) -- 0:00:39
413500 -- (-758.574) [-757.953] (-762.248) (-760.538) * (-762.486) [-759.656] (-758.242) (-759.487) -- 0:00:39
414000 -- [-760.659] (-758.323) (-762.889) (-760.878) * (-767.202) (-768.974) (-758.425) [-759.894] -- 0:00:39
414500 -- (-762.976) [-761.475] (-760.745) (-763.682) * (-762.584) (-760.829) (-759.786) [-759.560] -- 0:00:39
415000 -- (-762.033) [-759.181] (-763.494) (-760.000) * (-761.186) (-760.095) [-760.277] (-758.666) -- 0:00:39
Average standard deviation of split frequencies: 0.008532
415500 -- (-758.665) (-758.463) [-761.379] (-760.482) * (-760.723) (-762.287) [-759.445] (-766.241) -- 0:00:39
416000 -- (-763.228) (-759.039) [-762.512] (-758.431) * (-760.053) (-763.023) (-762.015) [-758.647] -- 0:00:39
416500 -- [-760.327] (-759.534) (-764.880) (-759.204) * (-763.744) (-760.701) (-760.528) [-760.829] -- 0:00:39
417000 -- [-759.011] (-760.688) (-762.258) (-760.510) * [-760.090] (-761.049) (-762.618) (-764.380) -- 0:00:39
417500 -- (-760.186) [-758.153] (-760.420) (-759.774) * (-764.405) [-760.371] (-760.980) (-760.003) -- 0:00:39
418000 -- (-760.707) [-759.665] (-762.883) (-761.018) * (-760.765) (-758.183) [-757.563] (-762.053) -- 0:00:38
418500 -- (-758.236) [-759.529] (-761.604) (-760.226) * (-761.156) [-762.973] (-759.515) (-759.589) -- 0:00:38
419000 -- (-759.515) [-761.140] (-761.674) (-760.012) * (-761.434) (-760.825) (-763.104) [-760.561] -- 0:00:38
419500 -- (-759.785) [-758.731] (-760.662) (-760.734) * (-759.918) (-763.915) [-761.385] (-760.849) -- 0:00:38
420000 -- [-760.893] (-760.200) (-760.542) (-760.901) * (-760.483) (-762.597) [-758.138] (-760.044) -- 0:00:38
Average standard deviation of split frequencies: 0.007984
420500 -- (-761.428) (-760.195) [-760.713] (-759.469) * [-761.309] (-758.604) (-762.078) (-761.412) -- 0:00:38
421000 -- (-761.161) [-760.326] (-761.979) (-758.181) * (-760.222) (-760.152) [-762.491] (-762.656) -- 0:00:38
421500 -- (-762.031) [-760.189] (-759.628) (-758.015) * (-762.005) (-761.067) (-759.505) [-762.653] -- 0:00:38
422000 -- [-759.142] (-760.089) (-758.207) (-760.346) * (-761.045) [-759.769] (-759.663) (-764.238) -- 0:00:38
422500 -- [-759.509] (-760.744) (-759.724) (-759.799) * (-762.210) (-762.973) [-760.588] (-762.710) -- 0:00:38
423000 -- (-761.421) (-762.194) (-761.426) [-761.322] * (-758.449) (-760.861) (-759.547) [-764.640] -- 0:00:38
423500 -- (-761.654) (-758.912) [-759.015] (-764.952) * (-760.033) (-761.820) [-762.958] (-760.119) -- 0:00:38
424000 -- (-760.967) (-759.397) [-758.726] (-758.590) * (-759.218) (-759.864) [-760.247] (-760.848) -- 0:00:38
424500 -- [-760.501] (-757.779) (-761.096) (-758.148) * (-760.959) (-758.361) (-760.046) [-761.181] -- 0:00:37
425000 -- (-760.717) (-763.647) [-764.630] (-760.798) * [-760.839] (-761.702) (-759.733) (-759.596) -- 0:00:37
Average standard deviation of split frequencies: 0.008645
425500 -- (-759.390) (-760.827) [-763.485] (-761.518) * (-759.800) [-761.483] (-761.274) (-760.579) -- 0:00:37
426000 -- (-760.427) [-759.665] (-760.845) (-760.808) * (-758.400) (-763.099) (-763.742) [-760.763] -- 0:00:37
426500 -- [-758.945] (-759.157) (-760.429) (-760.092) * [-757.415] (-761.372) (-761.965) (-758.168) -- 0:00:38
427000 -- (-759.226) (-758.860) (-760.155) [-758.989] * (-761.299) [-758.094] (-761.714) (-758.865) -- 0:00:38
427500 -- [-762.020] (-759.615) (-758.450) (-760.757) * (-760.195) (-758.864) (-760.418) [-759.702] -- 0:00:38
428000 -- (-761.609) [-759.829] (-761.807) (-759.920) * (-762.214) (-760.156) [-760.648] (-757.832) -- 0:00:38
428500 -- (-760.237) [-758.485] (-758.264) (-760.655) * (-760.643) [-759.246] (-759.643) (-761.041) -- 0:00:38
429000 -- [-759.993] (-761.959) (-759.931) (-758.943) * (-757.718) (-761.154) (-759.064) [-760.050] -- 0:00:38
429500 -- (-760.724) (-762.910) [-760.497] (-759.971) * (-759.801) [-759.289] (-759.575) (-759.556) -- 0:00:38
430000 -- (-764.362) (-758.801) (-760.554) [-765.455] * [-758.875] (-759.615) (-761.501) (-759.463) -- 0:00:38
Average standard deviation of split frequencies: 0.008173
430500 -- (-760.734) (-762.030) [-760.048] (-759.929) * (-759.998) (-759.573) (-758.506) [-760.412] -- 0:00:38
431000 -- (-759.138) (-758.320) [-758.376] (-763.343) * [-759.613] (-759.787) (-761.802) (-759.071) -- 0:00:38
431500 -- (-758.238) (-761.590) [-762.538] (-764.580) * (-760.605) (-761.388) (-758.718) [-757.903] -- 0:00:38
432000 -- (-762.383) [-761.113] (-762.315) (-764.846) * (-760.677) (-759.894) [-759.519] (-759.690) -- 0:00:38
432500 -- (-760.136) [-761.716] (-761.920) (-759.757) * [-761.789] (-758.420) (-759.769) (-763.601) -- 0:00:38
433000 -- (-760.826) (-762.695) (-761.560) [-758.416] * [-761.528] (-758.085) (-759.914) (-760.983) -- 0:00:37
433500 -- (-761.163) (-759.027) [-760.400] (-762.769) * (-761.237) (-761.654) [-761.328] (-762.182) -- 0:00:37
434000 -- (-761.464) [-760.614] (-760.849) (-759.505) * [-758.040] (-763.222) (-758.613) (-766.359) -- 0:00:37
434500 -- (-760.650) (-757.967) [-762.597] (-758.902) * [-759.798] (-761.501) (-760.262) (-759.908) -- 0:00:37
435000 -- [-758.946] (-759.853) (-763.467) (-761.164) * (-759.346) (-761.290) (-760.612) [-758.083] -- 0:00:37
Average standard deviation of split frequencies: 0.008217
435500 -- (-760.755) (-757.775) (-761.919) [-759.427] * (-758.867) (-761.378) (-759.599) [-759.270] -- 0:00:37
436000 -- (-761.116) (-759.113) [-761.885] (-767.480) * (-762.321) [-759.446] (-760.398) (-761.470) -- 0:00:37
436500 -- (-763.255) [-759.803] (-760.893) (-765.817) * (-757.962) [-760.333] (-761.725) (-761.112) -- 0:00:37
437000 -- (-767.171) [-760.835] (-762.330) (-759.935) * (-757.972) (-762.756) (-757.625) [-760.410] -- 0:00:37
437500 -- (-763.608) (-758.486) [-760.826] (-762.764) * (-759.724) (-763.014) (-759.341) [-760.753] -- 0:00:37
438000 -- (-759.265) (-763.405) [-758.858] (-761.177) * (-761.593) (-760.452) [-759.397] (-760.430) -- 0:00:37
438500 -- (-762.345) (-761.253) (-759.176) [-759.810] * (-763.620) (-758.032) [-760.598] (-763.667) -- 0:00:37
439000 -- (-764.905) (-764.974) (-759.941) [-759.082] * [-761.012] (-760.667) (-761.376) (-760.304) -- 0:00:37
439500 -- (-760.568) [-760.013] (-760.844) (-760.852) * (-760.325) (-761.108) [-759.335] (-762.451) -- 0:00:36
440000 -- [-760.681] (-761.221) (-761.723) (-759.965) * (-759.563) (-758.217) [-760.071] (-759.449) -- 0:00:36
Average standard deviation of split frequencies: 0.008344
440500 -- (-760.998) (-759.988) (-759.597) [-759.086] * [-760.342] (-761.949) (-759.699) (-767.204) -- 0:00:36
441000 -- (-761.411) [-758.399] (-758.839) (-760.641) * (-759.847) (-761.461) [-759.084] (-761.836) -- 0:00:36
441500 -- (-760.624) (-758.684) [-761.447] (-759.283) * [-760.140] (-760.650) (-758.224) (-765.633) -- 0:00:37
442000 -- (-760.424) (-757.007) [-759.873] (-761.636) * [-761.610] (-764.086) (-759.232) (-761.712) -- 0:00:37
442500 -- (-762.468) (-762.041) [-760.185] (-759.181) * [-761.333] (-759.590) (-759.670) (-762.952) -- 0:00:37
443000 -- (-762.944) (-758.817) (-765.263) [-759.478] * (-760.468) [-759.907] (-761.913) (-761.230) -- 0:00:37
443500 -- (-760.466) (-760.143) (-764.417) [-762.803] * (-759.306) (-760.037) [-761.405] (-760.775) -- 0:00:37
444000 -- (-759.707) (-760.411) (-759.102) [-763.368] * (-761.591) (-761.792) [-759.411] (-764.175) -- 0:00:37
444500 -- (-761.346) (-760.446) [-762.174] (-763.271) * (-757.685) [-758.814] (-759.258) (-762.102) -- 0:00:37
445000 -- (-762.108) [-757.789] (-761.955) (-757.175) * (-759.937) [-762.164] (-762.114) (-764.240) -- 0:00:37
Average standard deviation of split frequencies: 0.008526
445500 -- (-759.744) (-759.633) (-765.774) [-757.895] * (-760.235) [-761.501] (-758.351) (-761.636) -- 0:00:37
446000 -- [-760.329] (-757.624) (-763.597) (-759.234) * (-760.077) [-758.179] (-759.883) (-763.329) -- 0:00:37
446500 -- (-762.282) (-759.595) (-761.875) [-758.497] * (-758.860) (-764.428) (-762.181) [-761.028] -- 0:00:37
447000 -- (-759.755) (-759.277) [-762.438] (-764.198) * [-759.229] (-766.548) (-761.162) (-760.220) -- 0:00:37
447500 -- (-760.522) (-763.367) [-759.693] (-762.795) * (-760.361) [-761.010] (-765.575) (-760.904) -- 0:00:37
448000 -- (-760.003) (-759.354) [-762.315] (-764.097) * (-764.714) (-759.747) (-757.979) [-760.647] -- 0:00:36
448500 -- [-771.889] (-761.234) (-757.606) (-760.649) * (-763.297) [-759.958] (-765.354) (-762.294) -- 0:00:36
449000 -- (-761.873) (-758.699) [-758.666] (-762.049) * (-762.327) (-760.248) [-758.412] (-764.636) -- 0:00:36
449500 -- [-760.859] (-759.669) (-764.533) (-761.602) * [-761.590] (-759.633) (-756.816) (-762.502) -- 0:00:36
450000 -- [-762.067] (-760.590) (-760.926) (-761.370) * (-761.961) (-759.842) [-756.809] (-759.520) -- 0:00:36
Average standard deviation of split frequencies: 0.008159
450500 -- (-761.061) (-759.941) (-759.946) [-760.374] * (-762.846) (-766.901) (-759.756) [-762.643] -- 0:00:36
451000 -- (-762.401) [-757.778] (-758.468) (-763.546) * (-760.907) (-759.527) [-758.577] (-759.558) -- 0:00:36
451500 -- [-761.311] (-760.418) (-760.364) (-760.878) * [-760.795] (-759.842) (-760.835) (-759.330) -- 0:00:36
452000 -- (-760.489) (-759.922) [-760.664] (-761.235) * (-760.977) [-758.691] (-762.458) (-760.008) -- 0:00:36
452500 -- [-757.926] (-760.431) (-758.989) (-761.189) * (-764.263) (-760.633) [-758.771] (-761.911) -- 0:00:36
453000 -- (-765.018) (-759.938) [-760.436] (-761.022) * (-761.961) [-759.843] (-759.782) (-761.011) -- 0:00:36
453500 -- [-759.602] (-761.190) (-757.475) (-760.785) * (-759.357) [-760.967] (-761.535) (-762.141) -- 0:00:36
454000 -- (-759.668) (-758.254) (-759.119) [-761.696] * (-758.329) (-760.828) (-759.585) [-758.002] -- 0:00:36
454500 -- (-759.637) [-758.287] (-759.509) (-758.962) * [-760.328] (-761.828) (-762.377) (-761.690) -- 0:00:37
455000 -- [-758.817] (-761.761) (-760.908) (-759.965) * (-761.986) [-762.422] (-760.438) (-758.950) -- 0:00:37
Average standard deviation of split frequencies: 0.008723
455500 -- (-759.165) (-759.988) [-758.462] (-766.461) * (-764.492) (-761.418) (-761.005) [-759.449] -- 0:00:37
456000 -- (-761.111) (-757.796) [-759.910] (-766.077) * (-761.131) (-760.832) [-760.440] (-762.871) -- 0:00:36
456500 -- [-759.786] (-759.056) (-762.052) (-763.587) * (-764.874) (-759.992) [-760.683] (-760.110) -- 0:00:36
457000 -- (-759.824) [-756.945] (-761.783) (-761.556) * (-762.218) [-763.058] (-759.655) (-759.135) -- 0:00:36
457500 -- (-759.698) (-766.033) [-763.984] (-760.167) * [-760.866] (-760.119) (-760.072) (-759.660) -- 0:00:36
458000 -- [-758.932] (-766.239) (-761.664) (-761.493) * (-760.437) (-760.976) [-761.805] (-760.786) -- 0:00:36
458500 -- [-760.183] (-760.828) (-763.103) (-763.466) * (-759.859) (-761.339) (-760.632) [-760.577] -- 0:00:36
459000 -- [-759.318] (-761.788) (-760.613) (-760.961) * (-759.710) (-762.021) (-760.140) [-759.365] -- 0:00:36
459500 -- [-758.493] (-763.783) (-763.038) (-762.096) * [-760.943] (-760.950) (-761.392) (-761.022) -- 0:00:36
460000 -- [-759.694] (-759.478) (-759.358) (-761.289) * [-760.909] (-766.080) (-760.008) (-760.319) -- 0:00:36
Average standard deviation of split frequencies: 0.009278
460500 -- (-760.285) (-763.617) [-764.019] (-763.124) * (-760.566) (-760.877) (-761.744) [-762.605] -- 0:00:36
461000 -- (-768.097) (-758.378) [-760.327] (-762.011) * (-764.448) (-761.615) [-760.547] (-762.496) -- 0:00:36
461500 -- (-760.492) [-761.311] (-759.531) (-763.217) * (-759.005) [-761.318] (-759.528) (-762.376) -- 0:00:36
462000 -- (-762.438) (-761.268) (-759.122) [-761.399] * (-761.001) (-762.103) [-762.183] (-760.431) -- 0:00:36
462500 -- (-760.488) [-760.325] (-760.989) (-760.210) * (-758.945) (-760.424) (-763.218) [-761.584] -- 0:00:36
463000 -- (-761.279) [-757.936] (-761.451) (-761.793) * (-761.204) (-762.241) [-761.257] (-762.367) -- 0:00:35
463500 -- (-759.594) [-759.798] (-759.175) (-760.314) * (-762.061) (-760.231) [-761.039] (-762.454) -- 0:00:35
464000 -- (-759.839) [-761.781] (-758.785) (-761.507) * (-762.959) (-764.216) (-763.921) [-761.804] -- 0:00:35
464500 -- (-761.917) (-760.940) (-761.822) [-760.554] * (-762.519) (-762.926) (-761.677) [-760.233] -- 0:00:35
465000 -- (-760.319) (-760.080) (-759.057) [-759.087] * [-761.181] (-762.051) (-761.842) (-761.920) -- 0:00:35
Average standard deviation of split frequencies: 0.009307
465500 -- (-759.723) (-761.942) (-759.288) [-760.906] * [-765.689] (-762.412) (-760.386) (-762.044) -- 0:00:35
466000 -- (-762.160) (-760.645) [-759.589] (-759.067) * (-761.414) (-765.115) [-760.249] (-759.561) -- 0:00:35
466500 -- (-760.823) [-758.369] (-765.471) (-761.816) * (-760.765) (-764.274) (-760.149) [-760.746] -- 0:00:35
467000 -- [-761.382] (-758.273) (-761.543) (-759.284) * [-763.462] (-760.859) (-758.891) (-761.725) -- 0:00:35
467500 -- (-757.842) (-760.570) [-758.749] (-763.297) * (-759.957) (-762.176) [-761.628] (-763.798) -- 0:00:35
468000 -- [-761.133] (-758.877) (-764.077) (-762.346) * [-759.831] (-761.325) (-762.771) (-762.828) -- 0:00:35
468500 -- (-762.804) (-761.538) (-761.483) [-761.271] * (-762.672) (-763.476) [-761.642] (-757.421) -- 0:00:35
469000 -- (-762.981) [-762.318] (-762.675) (-760.867) * (-760.641) (-758.979) [-760.610] (-760.732) -- 0:00:35
469500 -- [-759.565] (-759.247) (-761.496) (-760.620) * [-759.295] (-758.260) (-764.012) (-760.531) -- 0:00:35
470000 -- (-758.176) (-767.293) [-758.981] (-757.931) * (-759.471) (-758.648) (-763.919) [-759.453] -- 0:00:34
Average standard deviation of split frequencies: 0.009281
470500 -- (-759.861) [-762.185] (-760.011) (-762.999) * (-758.371) [-759.599] (-759.883) (-762.336) -- 0:00:36
471000 -- (-760.394) (-761.027) [-759.917] (-760.790) * (-760.207) [-759.216] (-760.465) (-758.944) -- 0:00:35
471500 -- (-759.834) [-762.245] (-759.950) (-761.613) * [-760.344] (-759.169) (-763.347) (-758.122) -- 0:00:35
472000 -- [-758.868] (-761.897) (-760.503) (-760.492) * [-760.128] (-759.930) (-763.299) (-758.669) -- 0:00:35
472500 -- (-761.694) (-761.291) [-758.159] (-760.493) * [-761.255] (-759.268) (-764.245) (-759.888) -- 0:00:35
473000 -- (-762.653) (-762.425) [-762.519] (-760.884) * [-760.326] (-760.669) (-760.348) (-759.023) -- 0:00:35
473500 -- (-764.730) (-760.245) (-763.248) [-759.292] * (-765.006) (-758.180) [-758.152] (-761.097) -- 0:00:35
474000 -- [-759.637] (-762.598) (-764.728) (-759.444) * (-761.801) (-761.817) [-757.848] (-759.632) -- 0:00:35
474500 -- (-760.889) [-759.856] (-762.997) (-756.576) * (-758.303) (-764.534) [-758.545] (-758.797) -- 0:00:35
475000 -- (-764.953) (-760.311) [-761.466] (-758.948) * [-762.145] (-770.379) (-762.468) (-760.234) -- 0:00:35
Average standard deviation of split frequencies: 0.009705
475500 -- (-764.247) (-758.710) [-764.327] (-759.306) * (-761.027) (-762.772) [-760.189] (-760.746) -- 0:00:35
476000 -- (-764.795) (-762.215) [-760.340] (-761.258) * [-759.728] (-760.121) (-762.259) (-761.784) -- 0:00:35
476500 -- (-762.704) (-763.292) [-762.014] (-758.368) * [-758.911] (-760.649) (-760.777) (-759.233) -- 0:00:35
477000 -- (-762.315) [-761.357] (-762.758) (-758.957) * [-760.529] (-762.188) (-759.833) (-759.181) -- 0:00:35
477500 -- (-761.958) (-762.163) (-761.787) [-759.634] * (-767.393) (-761.302) [-762.769] (-759.964) -- 0:00:35
478000 -- (-761.651) [-763.325] (-759.468) (-759.250) * [-759.413] (-759.049) (-760.266) (-762.740) -- 0:00:34
478500 -- (-762.849) [-765.560] (-763.481) (-759.309) * (-759.861) [-757.803] (-760.953) (-761.493) -- 0:00:34
479000 -- (-762.201) (-758.720) (-761.577) [-758.431] * (-759.040) (-761.114) [-759.213] (-762.731) -- 0:00:34
479500 -- (-762.175) (-759.866) [-761.637] (-761.054) * (-759.744) (-761.775) (-759.074) [-759.393] -- 0:00:34
480000 -- (-761.617) (-760.820) [-760.350] (-766.923) * (-761.102) (-758.290) (-760.225) [-757.301] -- 0:00:34
Average standard deviation of split frequencies: 0.009284
480500 -- [-760.294] (-761.323) (-758.275) (-759.520) * [-757.047] (-761.292) (-760.858) (-760.290) -- 0:00:34
481000 -- [-760.277] (-761.546) (-758.928) (-762.531) * (-760.362) [-760.677] (-760.404) (-762.811) -- 0:00:34
481500 -- (-759.973) [-759.733] (-759.356) (-759.721) * [-758.698] (-760.229) (-761.055) (-759.819) -- 0:00:34
482000 -- [-761.336] (-758.308) (-759.575) (-760.397) * (-760.635) (-760.312) (-760.680) [-759.228] -- 0:00:34
482500 -- (-758.946) [-760.158] (-760.665) (-758.141) * [-760.743] (-760.244) (-760.858) (-761.913) -- 0:00:34
483000 -- (-758.776) (-760.558) (-760.880) [-760.088] * (-761.888) (-761.095) (-763.204) [-759.571] -- 0:00:34
483500 -- (-758.951) (-758.662) (-760.622) [-758.234] * [-762.070] (-761.090) (-761.919) (-758.390) -- 0:00:34
484000 -- (-761.630) [-758.275] (-761.113) (-758.766) * (-758.802) (-761.138) (-761.131) [-760.043] -- 0:00:34
484500 -- (-759.890) (-759.541) [-759.542] (-762.480) * [-759.743] (-759.729) (-760.162) (-760.702) -- 0:00:34
485000 -- (-761.003) [-762.685] (-761.715) (-763.373) * [-760.104] (-762.768) (-760.881) (-759.750) -- 0:00:33
Average standard deviation of split frequencies: 0.008471
485500 -- [-761.432] (-760.789) (-759.359) (-762.326) * (-760.653) (-760.831) (-759.811) [-758.737] -- 0:00:33
486000 -- (-760.117) [-762.021] (-760.537) (-759.264) * [-761.177] (-760.625) (-760.055) (-759.943) -- 0:00:34
486500 -- (-760.508) [-759.260] (-761.436) (-758.533) * (-759.865) [-760.289] (-760.932) (-759.934) -- 0:00:34
487000 -- (-759.756) (-765.549) [-759.152] (-757.946) * (-760.145) [-760.360] (-761.781) (-760.145) -- 0:00:34
487500 -- (-761.543) (-762.690) (-760.732) [-758.523] * (-759.705) [-759.176] (-761.044) (-764.152) -- 0:00:34
488000 -- (-759.556) (-761.069) (-759.705) [-761.582] * [-760.614] (-760.278) (-761.038) (-760.792) -- 0:00:34
488500 -- [-760.131] (-760.566) (-762.001) (-761.943) * (-761.146) (-758.117) (-761.032) [-761.008] -- 0:00:34
489000 -- (-762.394) (-760.390) [-760.837] (-760.365) * (-760.615) (-762.067) [-761.123] (-766.835) -- 0:00:34
489500 -- (-765.651) [-759.203] (-759.835) (-758.502) * (-761.540) [-759.795] (-760.809) (-764.001) -- 0:00:34
490000 -- (-761.550) (-759.435) (-761.036) [-757.429] * [-761.026] (-762.679) (-761.363) (-764.350) -- 0:00:34
Average standard deviation of split frequencies: 0.008455
490500 -- (-760.420) [-760.735] (-757.920) (-761.740) * [-759.410] (-761.688) (-762.525) (-762.906) -- 0:00:34
491000 -- (-759.199) (-761.168) (-760.736) [-760.010] * [-761.924] (-760.702) (-763.776) (-761.470) -- 0:00:34
491500 -- (-759.258) (-760.581) [-765.247] (-758.656) * (-760.689) (-761.349) (-761.117) [-762.983] -- 0:00:34
492000 -- (-758.970) (-762.097) (-761.173) [-759.285] * (-761.524) (-762.956) [-759.736] (-759.758) -- 0:00:34
492500 -- (-758.108) [-760.143] (-762.469) (-758.819) * (-761.888) [-762.534] (-759.981) (-763.392) -- 0:00:34
493000 -- (-758.626) (-759.635) [-761.409] (-760.799) * [-761.987] (-760.559) (-762.330) (-765.066) -- 0:00:33
493500 -- (-759.517) [-759.868] (-758.808) (-759.547) * (-761.337) [-759.639] (-760.128) (-761.986) -- 0:00:33
494000 -- (-760.836) (-765.311) (-761.107) [-760.283] * (-763.050) (-763.327) (-761.957) [-758.673] -- 0:00:33
494500 -- (-759.008) [-760.114] (-760.265) (-759.384) * [-762.410] (-763.455) (-759.405) (-760.099) -- 0:00:33
495000 -- (-758.491) (-763.228) [-759.007] (-760.112) * (-761.867) (-761.029) (-763.086) [-759.709] -- 0:00:33
Average standard deviation of split frequencies: 0.008744
495500 -- (-760.232) (-762.613) (-758.842) [-761.560] * (-761.140) (-758.496) (-759.690) [-759.599] -- 0:00:33
496000 -- (-765.231) (-759.630) (-760.498) [-762.635] * [-760.976] (-758.866) (-760.645) (-759.057) -- 0:00:33
496500 -- (-759.967) (-760.359) [-760.088] (-762.255) * (-759.516) [-758.513] (-762.282) (-759.934) -- 0:00:33
497000 -- (-760.060) [-767.769] (-758.697) (-761.306) * (-761.311) [-758.463] (-767.373) (-760.270) -- 0:00:33
497500 -- [-759.886] (-762.169) (-760.264) (-762.924) * [-760.144] (-761.168) (-763.765) (-761.387) -- 0:00:33
498000 -- (-759.522) [-763.115] (-760.648) (-758.208) * (-759.364) (-761.649) (-760.717) [-762.157] -- 0:00:33
498500 -- (-760.316) (-761.729) (-758.630) [-758.615] * (-760.590) (-759.289) (-761.904) [-761.864] -- 0:00:33
499000 -- (-759.181) [-760.179] (-758.234) (-758.401) * (-761.339) (-759.591) (-762.544) [-762.484] -- 0:00:33
499500 -- (-761.054) (-760.732) (-758.158) [-758.768] * [-762.656] (-759.897) (-762.033) (-766.084) -- 0:00:33
500000 -- (-759.960) [-759.659] (-763.561) (-761.098) * (-761.220) [-757.380] (-760.556) (-761.487) -- 0:00:33
Average standard deviation of split frequencies: 0.008286
500500 -- (-759.640) (-763.325) [-761.946] (-761.208) * (-760.835) [-758.222] (-759.789) (-761.441) -- 0:00:32
501000 -- (-761.858) [-757.624] (-759.530) (-763.687) * [-760.592] (-757.910) (-761.934) (-763.692) -- 0:00:32
501500 -- (-760.758) (-760.247) [-759.549] (-758.523) * [-760.235] (-758.598) (-759.517) (-760.517) -- 0:00:32
502000 -- (-765.295) (-759.765) [-759.560] (-759.083) * (-761.346) (-761.074) [-761.684] (-759.427) -- 0:00:33
502500 -- [-759.238] (-761.133) (-761.340) (-761.243) * [-759.616] (-762.431) (-760.130) (-762.730) -- 0:00:33
503000 -- (-761.016) (-761.247) [-760.860] (-761.325) * (-762.675) (-761.854) (-762.191) [-759.309] -- 0:00:33
503500 -- [-760.428] (-773.227) (-763.134) (-761.076) * (-759.387) [-764.043] (-763.048) (-758.600) -- 0:00:33
504000 -- [-760.595] (-764.144) (-761.823) (-759.113) * (-759.704) (-764.832) [-760.680] (-765.331) -- 0:00:33
504500 -- (-757.569) [-759.675] (-758.375) (-762.531) * (-761.766) (-760.700) [-762.871] (-766.048) -- 0:00:33
505000 -- (-760.341) (-758.823) (-759.534) [-757.732] * (-758.458) (-760.859) (-761.072) [-758.991] -- 0:00:33
Average standard deviation of split frequencies: 0.008385
505500 -- (-759.561) [-759.638] (-759.868) (-760.392) * (-763.922) (-760.666) [-758.421] (-760.274) -- 0:00:33
506000 -- (-761.392) [-758.993] (-760.900) (-764.834) * (-761.310) (-762.093) (-760.282) [-757.725] -- 0:00:33
506500 -- (-759.050) (-761.218) [-761.079] (-759.647) * (-761.624) (-759.330) (-759.244) [-759.391] -- 0:00:33
507000 -- (-760.116) (-759.441) (-760.743) [-762.921] * (-758.379) (-758.237) (-758.160) [-757.568] -- 0:00:33
507500 -- (-760.148) (-762.190) [-760.830] (-758.891) * (-762.747) (-762.944) [-760.272] (-760.012) -- 0:00:32
508000 -- [-761.279] (-763.502) (-760.705) (-758.832) * (-760.566) (-763.611) (-758.625) [-758.443] -- 0:00:32
508500 -- (-761.084) (-763.695) (-759.159) [-758.371] * (-760.974) [-758.422] (-765.328) (-760.040) -- 0:00:32
509000 -- (-759.693) [-762.626] (-757.876) (-760.275) * (-758.216) (-760.256) [-762.226] (-758.730) -- 0:00:32
509500 -- [-761.156] (-760.302) (-762.281) (-759.540) * (-760.969) [-759.103] (-761.088) (-762.509) -- 0:00:32
510000 -- (-759.806) (-759.201) [-758.618] (-759.663) * [-761.301] (-760.160) (-768.721) (-761.158) -- 0:00:32
Average standard deviation of split frequencies: 0.008493
510500 -- (-763.797) [-761.156] (-759.884) (-760.266) * (-761.720) (-760.046) [-758.507] (-762.754) -- 0:00:32
511000 -- (-760.329) [-759.691] (-758.909) (-757.639) * (-759.106) (-761.440) (-764.298) [-759.033] -- 0:00:32
511500 -- [-759.530] (-758.766) (-763.105) (-761.038) * [-760.112] (-762.497) (-763.537) (-759.944) -- 0:00:32
512000 -- [-758.818] (-759.442) (-759.831) (-763.329) * [-762.489] (-761.511) (-759.368) (-759.754) -- 0:00:32
512500 -- (-760.474) [-760.134] (-758.316) (-762.741) * (-763.699) [-760.273] (-760.539) (-757.137) -- 0:00:32
513000 -- (-759.040) (-759.017) [-758.789] (-762.192) * (-758.436) [-758.424] (-761.482) (-759.988) -- 0:00:32
513500 -- (-762.192) (-762.278) [-760.083] (-763.766) * (-757.769) (-759.485) (-763.023) [-762.975] -- 0:00:32
514000 -- (-765.865) [-759.198] (-761.288) (-766.377) * (-758.363) (-758.086) (-760.006) [-762.917] -- 0:00:32
514500 -- (-757.566) [-757.767] (-758.907) (-762.422) * [-759.671] (-765.557) (-761.086) (-759.805) -- 0:00:32
515000 -- (-760.495) [-758.395] (-760.518) (-761.533) * (-768.449) (-763.574) (-764.070) [-760.070] -- 0:00:32
Average standard deviation of split frequencies: 0.008100
515500 -- (-759.568) (-759.613) [-759.693] (-760.278) * [-760.241] (-763.814) (-759.392) (-759.708) -- 0:00:31
516000 -- (-764.514) [-761.241] (-759.335) (-760.734) * (-761.843) (-761.817) [-760.687] (-758.431) -- 0:00:31
516500 -- [-758.500] (-760.986) (-757.693) (-760.920) * [-761.611] (-761.026) (-761.728) (-759.996) -- 0:00:31
517000 -- [-761.010] (-760.916) (-761.807) (-764.348) * [-762.520] (-763.871) (-763.656) (-756.374) -- 0:00:31
517500 -- (-758.656) (-761.866) [-759.304] (-763.022) * (-766.133) [-760.805] (-764.709) (-760.636) -- 0:00:32
518000 -- (-758.564) (-759.042) [-758.958] (-764.575) * (-759.199) (-760.523) [-759.472] (-759.494) -- 0:00:32
518500 -- (-760.300) (-761.180) (-760.969) [-761.231] * [-759.836] (-758.295) (-761.239) (-762.003) -- 0:00:32
519000 -- (-760.150) (-760.051) [-759.322] (-758.151) * (-760.730) (-759.434) [-762.271] (-758.915) -- 0:00:32
519500 -- (-764.822) (-758.635) [-759.748] (-760.703) * (-759.659) (-760.873) (-761.673) [-760.198] -- 0:00:32
520000 -- [-763.281] (-761.397) (-760.391) (-762.160) * (-759.363) (-761.593) (-762.285) [-759.627] -- 0:00:32
Average standard deviation of split frequencies: 0.007666
520500 -- (-759.906) (-759.913) [-760.218] (-758.556) * (-757.170) (-759.657) [-761.085] (-761.081) -- 0:00:32
521000 -- [-760.857] (-760.903) (-761.112) (-764.929) * (-762.972) [-759.485] (-759.961) (-763.005) -- 0:00:32
521500 -- (-761.814) [-759.989] (-761.656) (-761.743) * (-763.453) [-759.845] (-758.260) (-760.471) -- 0:00:32
522000 -- [-762.208] (-760.310) (-761.428) (-762.058) * (-761.848) (-761.746) [-758.617] (-764.630) -- 0:00:32
522500 -- (-760.007) (-760.653) [-760.355] (-758.432) * (-762.458) (-762.611) (-758.738) [-761.120] -- 0:00:31
523000 -- (-763.987) (-760.583) (-761.392) [-760.566] * (-762.514) (-761.129) (-759.643) [-761.135] -- 0:00:31
523500 -- (-758.891) (-760.803) [-761.265] (-758.954) * (-760.366) [-760.739] (-760.690) (-762.700) -- 0:00:31
524000 -- [-758.357] (-759.247) (-760.676) (-759.314) * (-762.200) (-762.722) (-759.952) [-760.764] -- 0:00:31
524500 -- (-761.507) [-759.360] (-759.717) (-760.432) * (-763.652) (-758.674) [-759.047] (-764.313) -- 0:00:31
525000 -- [-761.417] (-761.899) (-760.960) (-760.420) * (-761.971) (-760.012) (-758.168) [-761.574] -- 0:00:31
Average standard deviation of split frequencies: 0.007827
525500 -- (-759.685) (-759.946) [-762.276] (-767.238) * [-764.193] (-759.908) (-758.022) (-762.683) -- 0:00:31
526000 -- (-763.376) [-759.438] (-760.199) (-762.118) * (-763.442) [-764.171] (-760.089) (-759.524) -- 0:00:31
526500 -- (-760.103) (-761.961) (-760.396) [-761.555] * (-763.697) (-760.090) (-759.671) [-759.385] -- 0:00:31
527000 -- (-761.099) (-759.917) [-758.168] (-759.903) * (-765.691) (-759.962) [-760.770] (-761.312) -- 0:00:31
527500 -- (-758.117) (-760.743) (-760.247) [-761.568] * (-759.773) [-760.304] (-759.017) (-763.091) -- 0:00:31
528000 -- (-760.550) [-758.562] (-761.863) (-759.532) * [-760.170] (-760.512) (-761.416) (-759.744) -- 0:00:31
528500 -- [-760.409] (-760.904) (-760.829) (-761.601) * (-761.716) [-763.326] (-760.970) (-761.553) -- 0:00:31
529000 -- (-762.732) (-760.766) [-758.934] (-763.373) * (-759.161) [-759.486] (-757.723) (-759.406) -- 0:00:31
529500 -- [-762.058] (-761.191) (-759.960) (-758.970) * [-757.438] (-760.218) (-762.532) (-759.660) -- 0:00:31
530000 -- (-763.139) (-763.651) (-761.602) [-758.735] * (-762.811) (-758.804) (-758.711) [-761.689] -- 0:00:31
Average standard deviation of split frequencies: 0.008232
530500 -- (-763.814) (-758.784) (-759.215) [-759.533] * [-760.751] (-760.224) (-759.536) (-761.010) -- 0:00:30
531000 -- (-765.429) (-759.176) [-757.840] (-760.958) * (-760.651) [-759.231] (-761.126) (-763.936) -- 0:00:30
531500 -- (-764.413) (-760.257) [-758.635] (-760.819) * (-758.551) (-758.487) [-760.124] (-760.764) -- 0:00:30
532000 -- (-760.884) [-759.506] (-765.574) (-761.903) * (-760.874) [-758.742] (-760.080) (-760.264) -- 0:00:30
532500 -- [-760.577] (-760.300) (-765.964) (-764.524) * (-762.131) [-761.858] (-762.248) (-761.156) -- 0:00:30
533000 -- (-761.970) (-758.766) (-759.061) [-759.678] * [-760.675] (-760.046) (-764.266) (-763.525) -- 0:00:30
533500 -- [-759.126] (-758.384) (-763.577) (-759.321) * (-760.563) [-761.062] (-763.772) (-759.417) -- 0:00:31
534000 -- [-760.257] (-760.754) (-760.987) (-762.286) * (-760.741) (-760.561) [-762.830] (-759.976) -- 0:00:31
534500 -- (-760.262) (-761.843) (-758.938) [-757.923] * (-762.815) (-759.385) (-762.198) [-763.041] -- 0:00:31
535000 -- [-760.685] (-761.015) (-759.749) (-760.881) * (-759.077) (-765.829) (-761.067) [-761.951] -- 0:00:31
Average standard deviation of split frequencies: 0.008091
535500 -- [-760.413] (-760.327) (-761.989) (-759.428) * (-760.864) (-765.234) (-762.593) [-759.982] -- 0:00:31
536000 -- (-760.223) [-759.571] (-761.611) (-759.731) * (-762.321) (-762.912) [-760.156] (-761.572) -- 0:00:31
536500 -- (-760.635) (-766.440) (-763.414) [-757.375] * (-760.682) (-760.610) [-763.938] (-761.675) -- 0:00:31
537000 -- (-758.025) (-760.699) (-763.562) [-759.415] * (-759.115) (-760.180) (-759.375) [-763.114] -- 0:00:31
537500 -- (-761.436) (-760.567) (-759.525) [-758.716] * (-761.814) (-761.807) (-765.689) [-760.867] -- 0:00:30
538000 -- (-761.937) (-763.184) [-758.491] (-761.827) * (-761.138) (-760.892) [-762.246] (-758.176) -- 0:00:30
538500 -- (-760.489) (-756.720) [-757.554] (-760.398) * (-763.429) (-758.869) [-761.712] (-759.445) -- 0:00:30
539000 -- (-759.798) (-759.806) (-759.479) [-759.323] * (-760.847) [-759.174] (-762.668) (-761.392) -- 0:00:30
539500 -- (-760.171) (-759.922) [-761.337] (-760.801) * (-759.045) [-757.528] (-759.896) (-761.342) -- 0:00:30
540000 -- (-761.823) (-760.013) (-763.867) [-758.549] * (-764.043) (-762.704) [-764.172] (-769.500) -- 0:00:30
Average standard deviation of split frequencies: 0.008719
540500 -- (-759.925) [-759.150] (-761.139) (-759.247) * (-764.396) (-759.855) [-762.022] (-759.031) -- 0:00:30
541000 -- [-760.271] (-766.187) (-759.517) (-765.722) * (-761.570) (-760.097) (-762.463) [-758.086] -- 0:00:30
541500 -- (-761.391) (-765.455) [-762.713] (-763.936) * (-760.670) [-761.466] (-762.186) (-760.139) -- 0:00:30
542000 -- (-760.856) [-759.317] (-760.971) (-764.578) * (-762.400) [-757.334] (-760.293) (-758.258) -- 0:00:30
542500 -- (-761.997) (-758.621) [-760.476] (-763.844) * [-760.962] (-758.696) (-762.341) (-758.693) -- 0:00:30
543000 -- (-761.990) (-759.080) [-760.559] (-759.634) * (-761.069) [-759.538] (-759.425) (-761.122) -- 0:00:30
543500 -- (-761.342) (-758.735) (-760.408) [-760.383] * (-760.243) [-759.797] (-761.401) (-763.122) -- 0:00:30
544000 -- (-759.587) (-760.879) [-761.093] (-761.384) * (-760.040) (-759.992) (-764.191) [-761.357] -- 0:00:30
544500 -- (-758.668) (-758.808) [-761.179] (-763.319) * (-761.038) (-759.342) (-757.682) [-758.034] -- 0:00:30
545000 -- (-762.628) [-762.242] (-760.304) (-759.988) * (-760.456) (-761.851) (-760.781) [-757.519] -- 0:00:30
Average standard deviation of split frequencies: 0.008404
545500 -- (-763.302) (-760.330) [-759.951] (-760.890) * (-761.869) (-761.621) [-763.078] (-759.207) -- 0:00:29
546000 -- [-760.480] (-766.607) (-760.627) (-759.151) * [-758.903] (-758.645) (-760.061) (-760.376) -- 0:00:29
546500 -- (-761.961) (-759.303) (-767.434) [-757.978] * (-758.519) [-761.563] (-761.644) (-763.915) -- 0:00:29
547000 -- (-760.231) (-761.289) (-763.786) [-759.597] * [-765.301] (-759.389) (-761.825) (-766.725) -- 0:00:29
547500 -- (-763.099) (-763.225) (-760.706) [-760.749] * (-761.092) [-759.796] (-763.139) (-763.294) -- 0:00:29
548000 -- (-760.339) (-758.530) (-766.163) [-761.417] * [-759.668] (-762.040) (-759.417) (-758.358) -- 0:00:29
548500 -- (-761.045) [-759.029] (-765.474) (-760.008) * (-760.572) [-759.360] (-758.815) (-761.023) -- 0:00:29
549000 -- (-760.723) (-757.782) (-765.406) [-760.399] * (-759.538) (-760.390) (-763.540) [-760.657] -- 0:00:29
549500 -- (-760.925) [-760.093] (-759.509) (-759.671) * (-760.254) [-764.113] (-762.345) (-760.333) -- 0:00:30
550000 -- (-761.404) [-757.721] (-759.259) (-762.682) * [-762.211] (-758.050) (-765.500) (-757.690) -- 0:00:30
Average standard deviation of split frequencies: 0.008104
550500 -- (-765.439) (-760.253) [-758.958] (-759.978) * [-758.448] (-765.546) (-761.567) (-759.209) -- 0:00:30
551000 -- (-762.053) (-759.391) [-759.282] (-760.668) * (-760.086) (-758.104) (-762.155) [-757.774] -- 0:00:30
551500 -- (-762.276) (-759.748) (-762.119) [-758.920] * (-760.665) (-758.336) (-761.052) [-760.084] -- 0:00:30
552000 -- (-758.859) (-759.305) (-759.408) [-761.659] * (-760.002) (-760.937) [-758.649] (-761.216) -- 0:00:30
552500 -- (-759.615) (-764.274) [-760.873] (-759.815) * (-760.319) (-760.620) (-762.911) [-759.489] -- 0:00:29
553000 -- (-760.085) (-760.826) (-759.331) [-759.938] * [-759.293] (-758.690) (-761.527) (-761.387) -- 0:00:29
553500 -- (-761.690) (-771.930) [-758.592] (-761.088) * (-760.404) (-757.616) [-760.842] (-758.547) -- 0:00:29
554000 -- (-759.983) (-769.145) (-759.142) [-763.906] * [-759.968] (-761.632) (-762.084) (-759.117) -- 0:00:29
554500 -- (-759.273) (-762.337) (-757.822) [-761.841] * (-757.837) (-763.543) (-761.017) [-759.562] -- 0:00:29
555000 -- (-764.322) [-762.352] (-759.694) (-761.577) * (-760.002) (-761.726) [-761.012] (-762.384) -- 0:00:29
Average standard deviation of split frequencies: 0.008592
555500 -- [-758.336] (-760.932) (-762.365) (-759.127) * [-760.749] (-759.623) (-761.391) (-762.310) -- 0:00:29
556000 -- (-759.852) (-761.596) (-761.339) [-759.460] * (-764.020) [-759.723] (-766.098) (-760.574) -- 0:00:29
556500 -- (-759.209) [-759.737] (-759.750) (-761.181) * (-760.854) (-757.323) [-760.869] (-762.922) -- 0:00:29
557000 -- (-759.544) [-762.695] (-760.271) (-758.942) * (-759.262) [-759.306] (-758.966) (-759.734) -- 0:00:29
557500 -- (-760.574) (-759.596) [-760.369] (-758.441) * [-759.302] (-760.224) (-758.772) (-760.372) -- 0:00:29
558000 -- (-761.657) [-760.158] (-759.971) (-762.201) * (-762.106) (-759.703) [-759.210] (-761.808) -- 0:00:29
558500 -- (-759.104) (-759.534) (-764.135) [-758.582] * (-763.289) (-759.313) [-758.130] (-763.127) -- 0:00:29
559000 -- (-760.691) (-766.411) (-761.866) [-759.906] * (-763.962) [-758.280] (-759.208) (-762.665) -- 0:00:29
559500 -- (-760.090) (-759.799) (-761.419) [-760.502] * [-762.230] (-760.714) (-764.056) (-761.881) -- 0:00:29
560000 -- (-760.301) (-758.989) (-759.277) [-760.950] * (-760.100) [-761.032] (-761.266) (-762.269) -- 0:00:29
Average standard deviation of split frequencies: 0.008632
560500 -- (-761.278) (-757.275) (-760.971) [-757.935] * (-760.755) [-764.334] (-757.766) (-760.047) -- 0:00:29
561000 -- [-761.654] (-762.603) (-759.993) (-761.079) * [-762.211] (-761.922) (-761.363) (-759.963) -- 0:00:28
561500 -- (-760.974) (-763.781) (-761.033) [-760.745] * (-765.986) (-757.517) (-760.216) [-761.444] -- 0:00:28
562000 -- [-758.791] (-760.221) (-760.069) (-759.847) * [-761.960] (-761.473) (-761.589) (-760.718) -- 0:00:28
562500 -- [-757.929] (-760.767) (-758.789) (-764.376) * [-759.255] (-759.216) (-763.175) (-759.752) -- 0:00:28
563000 -- (-759.513) [-758.675] (-759.004) (-760.319) * [-760.097] (-762.250) (-762.554) (-762.756) -- 0:00:28
563500 -- (-761.235) (-759.970) [-758.550] (-760.415) * [-761.055] (-759.852) (-763.582) (-760.851) -- 0:00:28
564000 -- [-759.421] (-759.759) (-761.775) (-764.088) * [-757.785] (-760.105) (-762.976) (-758.346) -- 0:00:28
564500 -- [-758.356] (-760.008) (-761.764) (-763.215) * [-760.636] (-761.153) (-760.791) (-760.048) -- 0:00:28
565000 -- (-761.074) (-761.994) [-759.887] (-764.186) * (-761.830) [-758.571] (-759.696) (-758.079) -- 0:00:29
Average standard deviation of split frequencies: 0.008440
565500 -- (-760.975) (-760.608) (-761.226) [-761.787] * (-763.487) (-761.906) [-761.889] (-762.466) -- 0:00:29
566000 -- (-762.023) (-762.093) (-762.133) [-762.986] * (-760.348) (-760.495) [-761.527] (-760.533) -- 0:00:29
566500 -- (-760.670) [-760.773] (-762.955) (-758.650) * (-761.507) (-760.058) [-759.990] (-762.879) -- 0:00:29
567000 -- [-759.075] (-762.549) (-761.508) (-758.273) * (-759.815) [-760.147] (-763.872) (-764.373) -- 0:00:29
567500 -- (-759.811) (-762.704) (-762.897) [-761.189] * (-760.165) (-757.863) (-761.227) [-766.819] -- 0:00:28
568000 -- (-761.784) [-760.204] (-760.365) (-761.171) * (-759.212) [-758.122] (-758.700) (-758.382) -- 0:00:28
568500 -- (-758.712) (-759.206) [-762.101] (-757.968) * (-761.010) [-760.166] (-761.619) (-760.204) -- 0:00:28
569000 -- [-759.701] (-761.018) (-763.649) (-760.895) * (-759.050) (-761.622) (-763.532) [-758.732] -- 0:00:28
569500 -- (-763.455) (-759.774) [-760.990] (-760.247) * (-757.831) [-758.388] (-763.984) (-762.205) -- 0:00:28
570000 -- (-762.072) [-759.508] (-763.763) (-766.568) * (-759.746) (-764.832) (-760.584) [-758.246] -- 0:00:28
Average standard deviation of split frequencies: 0.009252
570500 -- (-761.758) (-761.158) (-765.365) [-762.837] * [-761.189] (-761.883) (-760.727) (-759.359) -- 0:00:28
571000 -- (-761.487) [-759.226] (-762.278) (-760.803) * (-757.600) (-761.502) [-759.804] (-762.837) -- 0:00:28
571500 -- [-758.830] (-758.906) (-760.804) (-764.068) * (-757.506) [-759.214] (-762.691) (-758.004) -- 0:00:28
572000 -- [-758.021] (-758.838) (-761.729) (-761.462) * (-766.185) (-759.310) (-758.585) [-762.528] -- 0:00:28
572500 -- (-761.918) [-758.578] (-758.513) (-760.557) * [-760.319] (-765.887) (-765.036) (-758.293) -- 0:00:28
573000 -- (-758.565) (-759.880) [-760.914] (-759.112) * [-760.951] (-763.988) (-763.005) (-761.933) -- 0:00:28
573500 -- [-756.602] (-759.609) (-759.557) (-758.937) * [-759.818] (-759.808) (-761.822) (-761.597) -- 0:00:28
574000 -- (-756.887) (-762.619) (-761.196) [-761.162] * (-761.469) [-763.982] (-766.627) (-761.382) -- 0:00:28
574500 -- (-760.743) (-759.509) [-760.868] (-762.090) * (-764.173) (-761.701) [-760.805] (-761.208) -- 0:00:28
575000 -- (-762.198) [-760.497] (-761.487) (-761.772) * (-763.752) (-758.937) (-764.324) [-761.517] -- 0:00:28
Average standard deviation of split frequencies: 0.008893
575500 -- [-760.310] (-761.133) (-760.518) (-762.837) * (-761.321) (-760.707) [-757.680] (-759.263) -- 0:00:28
576000 -- (-759.491) [-759.950] (-758.573) (-768.921) * (-760.145) [-761.033] (-761.255) (-762.821) -- 0:00:27
576500 -- (-760.720) [-759.778] (-762.149) (-764.533) * [-759.868] (-763.103) (-760.979) (-760.218) -- 0:00:27
577000 -- [-758.490] (-760.700) (-760.938) (-760.254) * (-759.133) (-760.841) (-759.210) [-759.368] -- 0:00:27
577500 -- [-758.077] (-761.401) (-758.621) (-757.597) * [-759.826] (-760.200) (-759.174) (-758.720) -- 0:00:27
578000 -- (-760.421) [-761.013] (-757.181) (-758.140) * (-758.504) (-764.536) (-758.968) [-760.336] -- 0:00:27
578500 -- (-759.118) (-758.966) (-759.309) [-760.261] * [-758.794] (-760.607) (-758.996) (-758.684) -- 0:00:27
579000 -- (-761.143) (-760.709) [-761.199] (-759.118) * (-759.440) (-759.819) (-759.993) [-762.341] -- 0:00:27
579500 -- (-759.675) (-759.867) [-761.417] (-759.059) * (-759.956) [-758.595] (-760.652) (-762.745) -- 0:00:28
580000 -- (-759.940) (-760.940) (-759.587) [-759.993] * (-758.795) (-760.565) (-761.220) [-759.300] -- 0:00:28
Average standard deviation of split frequencies: 0.008876
580500 -- (-758.722) [-760.041] (-758.713) (-760.400) * (-758.519) (-761.270) (-759.277) [-757.728] -- 0:00:28
581000 -- (-760.663) (-762.890) (-760.364) [-760.604] * (-757.832) (-760.817) (-761.459) [-757.754] -- 0:00:28
581500 -- (-759.787) [-764.725] (-762.120) (-760.270) * (-758.193) [-758.890] (-758.823) (-758.292) -- 0:00:28
582000 -- [-759.719] (-760.397) (-759.800) (-766.644) * [-759.834] (-761.124) (-763.573) (-763.304) -- 0:00:28
582500 -- [-757.655] (-760.793) (-762.749) (-762.630) * (-761.991) [-758.809] (-759.903) (-763.818) -- 0:00:27
583000 -- (-761.637) (-757.577) (-760.544) [-759.333] * [-760.966] (-762.182) (-758.940) (-761.714) -- 0:00:27
583500 -- (-762.320) (-757.887) (-760.812) [-760.650] * (-758.232) (-759.742) (-761.372) [-762.221] -- 0:00:27
584000 -- (-759.907) [-761.033] (-760.594) (-760.560) * (-760.402) [-762.170] (-760.955) (-766.412) -- 0:00:27
584500 -- (-759.099) (-759.881) (-764.118) [-760.019] * (-757.709) (-763.201) (-761.145) [-766.444] -- 0:00:27
585000 -- (-758.142) (-761.222) (-766.393) [-761.000] * (-760.203) [-762.762] (-758.501) (-760.454) -- 0:00:27
Average standard deviation of split frequencies: 0.009010
585500 -- [-758.754] (-760.916) (-764.660) (-761.116) * (-758.554) (-763.345) [-758.593] (-769.952) -- 0:00:27
586000 -- (-763.237) (-762.032) [-761.725] (-757.627) * (-761.051) [-763.470] (-757.965) (-763.173) -- 0:00:27
586500 -- (-759.620) (-761.960) [-758.679] (-760.572) * [-758.562] (-764.238) (-760.776) (-762.571) -- 0:00:27
587000 -- (-761.029) (-760.016) [-761.858] (-763.075) * [-758.892] (-762.547) (-762.744) (-762.084) -- 0:00:27
587500 -- (-760.677) (-761.098) [-762.619] (-758.414) * (-761.561) (-761.016) (-763.110) [-757.604] -- 0:00:27
588000 -- (-765.416) (-759.392) [-760.202] (-762.626) * (-759.658) (-760.162) [-758.695] (-760.911) -- 0:00:27
588500 -- (-759.962) (-759.886) (-761.056) [-762.639] * [-758.893] (-758.192) (-761.946) (-758.924) -- 0:00:27
589000 -- (-758.044) (-760.010) (-762.908) [-761.623] * (-765.565) [-760.495] (-762.701) (-758.817) -- 0:00:27
589500 -- [-761.254] (-761.376) (-764.207) (-760.853) * [-762.216] (-759.212) (-761.685) (-760.496) -- 0:00:27
590000 -- (-763.989) (-762.801) (-761.784) [-757.380] * (-761.558) (-761.347) [-765.000] (-761.140) -- 0:00:27
Average standard deviation of split frequencies: 0.008779
590500 -- [-757.998] (-760.869) (-763.170) (-760.533) * (-760.261) [-760.637] (-763.110) (-764.026) -- 0:00:27
591000 -- [-760.684] (-759.788) (-758.206) (-759.311) * (-760.764) [-762.942] (-760.113) (-764.040) -- 0:00:26
591500 -- (-757.106) [-759.772] (-760.321) (-763.628) * (-759.010) [-761.918] (-765.135) (-760.604) -- 0:00:26
592000 -- (-759.149) (-763.268) (-760.353) [-760.189] * [-760.717] (-766.749) (-761.010) (-764.271) -- 0:00:26
592500 -- (-760.856) [-764.124] (-764.057) (-760.446) * (-762.963) (-762.281) [-761.458] (-761.852) -- 0:00:26
593000 -- (-760.833) (-761.330) (-759.478) [-760.108] * (-762.331) [-760.791] (-761.358) (-759.651) -- 0:00:26
593500 -- [-761.235] (-765.377) (-765.617) (-760.153) * (-761.450) (-760.652) (-765.312) [-762.275] -- 0:00:26
594000 -- (-762.800) [-763.662] (-761.990) (-760.200) * [-760.225] (-760.457) (-761.583) (-763.845) -- 0:00:26
594500 -- (-759.338) [-762.975] (-761.167) (-761.887) * [-759.456] (-763.443) (-760.741) (-763.663) -- 0:00:27
595000 -- (-765.472) [-761.107] (-759.438) (-764.470) * (-763.464) (-760.932) [-760.948] (-761.086) -- 0:00:27
Average standard deviation of split frequencies: 0.009544
595500 -- [-760.912] (-762.181) (-758.474) (-761.137) * (-767.720) (-760.934) (-758.452) [-759.850] -- 0:00:27
596000 -- [-760.809] (-760.317) (-763.022) (-760.263) * (-760.662) (-760.156) [-759.693] (-759.552) -- 0:00:27
596500 -- (-762.832) (-760.003) [-763.405] (-762.342) * [-760.049] (-760.319) (-758.406) (-760.068) -- 0:00:27
597000 -- [-757.758] (-760.607) (-759.419) (-761.329) * [-760.198] (-758.828) (-758.171) (-762.371) -- 0:00:27
597500 -- (-761.203) (-763.477) (-762.414) [-759.378] * (-764.008) [-759.396] (-759.440) (-762.052) -- 0:00:26
598000 -- [-759.743] (-758.823) (-768.570) (-763.826) * (-759.015) (-758.460) [-759.495] (-767.751) -- 0:00:26
598500 -- (-757.680) [-762.674] (-760.898) (-765.186) * (-759.394) [-759.569] (-760.780) (-766.292) -- 0:00:26
599000 -- [-757.549] (-760.946) (-760.867) (-763.385) * [-759.089] (-758.827) (-759.250) (-766.587) -- 0:00:26
599500 -- (-759.370) [-760.868] (-758.364) (-758.444) * [-761.205] (-762.669) (-758.782) (-763.438) -- 0:00:26
600000 -- (-759.735) [-759.996] (-761.143) (-760.303) * (-760.051) (-759.700) [-759.615] (-761.431) -- 0:00:26
Average standard deviation of split frequencies: 0.009313
600500 -- (-758.991) (-763.212) (-760.880) [-763.171] * [-759.690] (-763.875) (-760.123) (-760.143) -- 0:00:26
601000 -- (-759.626) (-765.994) (-759.636) [-758.534] * [-758.993] (-761.271) (-758.965) (-765.397) -- 0:00:26
601500 -- (-761.457) (-760.052) [-758.746] (-758.389) * [-758.345] (-757.387) (-761.508) (-763.474) -- 0:00:26
602000 -- [-758.512] (-759.089) (-759.871) (-760.824) * (-760.899) (-759.608) [-759.135] (-760.473) -- 0:00:26
602500 -- (-760.939) (-760.365) (-759.868) [-763.923] * (-758.499) [-758.950] (-756.928) (-760.726) -- 0:00:26
603000 -- [-759.763] (-759.003) (-759.187) (-760.899) * [-759.428] (-757.883) (-757.635) (-760.353) -- 0:00:26
603500 -- (-760.918) (-760.606) [-759.737] (-760.307) * (-760.324) [-759.014] (-758.627) (-761.522) -- 0:00:26
604000 -- (-760.908) (-757.968) [-758.777] (-760.382) * [-763.786] (-760.624) (-758.344) (-765.149) -- 0:00:26
604500 -- (-762.625) [-759.389] (-760.317) (-759.277) * (-760.008) (-760.410) (-761.650) [-759.776] -- 0:00:26
605000 -- (-763.613) (-760.709) [-762.251] (-759.443) * (-765.221) (-759.860) (-762.138) [-759.352] -- 0:00:26
Average standard deviation of split frequencies: 0.008972
605500 -- [-760.931] (-762.912) (-761.218) (-763.409) * (-762.877) (-758.787) [-759.759] (-761.418) -- 0:00:26
606000 -- (-760.416) [-760.590] (-763.183) (-760.004) * (-761.791) (-759.980) (-759.391) [-760.762] -- 0:00:26
606500 -- (-758.315) (-763.379) (-761.648) [-760.358] * (-760.664) [-757.811] (-761.667) (-762.530) -- 0:00:25
607000 -- [-758.302] (-759.345) (-759.760) (-758.561) * [-763.054] (-759.752) (-761.371) (-760.937) -- 0:00:25
607500 -- [-758.525] (-759.285) (-762.568) (-758.761) * (-758.760) (-761.038) (-759.713) [-758.805] -- 0:00:25
608000 -- (-760.513) (-759.880) (-762.423) [-760.270] * (-762.362) (-760.023) (-760.570) [-756.824] -- 0:00:25
608500 -- (-757.755) (-758.966) (-757.533) [-759.895] * [-760.289] (-759.460) (-760.820) (-761.238) -- 0:00:25
609000 -- (-761.646) [-760.399] (-759.478) (-763.725) * [-761.272] (-760.699) (-759.539) (-762.177) -- 0:00:25
609500 -- (-764.203) (-760.360) [-757.662] (-760.807) * (-759.082) (-761.553) (-760.868) [-758.975] -- 0:00:25
610000 -- [-759.534] (-762.477) (-757.494) (-762.311) * (-759.888) (-761.510) (-760.760) [-759.476] -- 0:00:26
Average standard deviation of split frequencies: 0.009521
610500 -- [-760.845] (-758.069) (-759.473) (-761.738) * (-764.155) (-761.408) (-757.508) [-762.856] -- 0:00:26
611000 -- (-763.556) (-758.955) (-762.548) [-761.637] * (-759.825) (-761.308) [-760.535] (-763.235) -- 0:00:26
611500 -- (-761.354) (-759.345) (-759.105) [-759.638] * (-761.444) [-757.222] (-758.639) (-761.532) -- 0:00:26
612000 -- (-761.524) (-758.811) [-760.276] (-763.418) * [-761.861] (-758.864) (-759.864) (-760.202) -- 0:00:25
612500 -- (-764.817) [-762.579] (-760.428) (-760.889) * (-765.697) (-762.278) (-761.451) [-761.772] -- 0:00:25
613000 -- (-763.395) (-762.068) [-760.402] (-759.090) * (-763.691) [-760.284] (-759.663) (-760.429) -- 0:00:25
613500 -- (-758.887) [-759.279] (-760.883) (-761.805) * (-765.405) [-759.842] (-760.042) (-756.577) -- 0:00:25
614000 -- [-759.752] (-759.039) (-759.794) (-761.964) * (-760.973) (-761.773) (-761.727) [-756.871] -- 0:00:25
614500 -- [-759.633] (-761.939) (-760.220) (-761.018) * (-762.407) (-758.060) (-761.053) [-759.602] -- 0:00:25
615000 -- [-758.290] (-760.790) (-757.310) (-759.761) * (-759.988) (-760.411) (-762.372) [-760.483] -- 0:00:25
Average standard deviation of split frequencies: 0.009642
615500 -- (-758.442) (-760.843) (-762.308) [-757.563] * [-761.361] (-760.945) (-764.611) (-763.367) -- 0:00:25
616000 -- (-763.210) (-760.987) (-763.036) [-762.322] * (-758.271) (-759.694) (-763.890) [-759.252] -- 0:00:25
616500 -- (-757.171) (-760.184) [-759.938] (-770.659) * (-763.563) (-763.008) (-763.457) [-758.260] -- 0:00:25
617000 -- [-759.122] (-764.831) (-759.418) (-763.954) * [-762.182] (-758.890) (-760.181) (-759.916) -- 0:00:25
617500 -- (-761.238) [-761.362] (-761.976) (-759.852) * (-763.377) (-760.134) (-759.684) [-757.215] -- 0:00:25
618000 -- (-758.652) [-760.276] (-761.023) (-758.005) * (-763.167) (-758.525) (-760.162) [-762.193] -- 0:00:25
618500 -- (-765.073) (-761.798) (-761.022) [-759.333] * [-760.490] (-758.176) (-760.390) (-760.593) -- 0:00:25
619000 -- (-760.875) (-759.557) (-759.479) [-757.648] * (-763.019) (-760.662) (-762.881) [-759.565] -- 0:00:25
619500 -- [-759.521] (-758.740) (-759.241) (-760.265) * [-760.001] (-759.538) (-760.860) (-763.496) -- 0:00:25
620000 -- (-757.969) [-759.452] (-760.431) (-758.831) * (-760.643) (-761.980) (-759.833) [-759.755] -- 0:00:25
Average standard deviation of split frequencies: 0.009519
620500 -- (-760.195) [-761.786] (-760.587) (-760.489) * (-762.855) (-758.807) (-759.570) [-760.897] -- 0:00:25
621000 -- (-761.852) (-762.669) [-763.267] (-761.331) * (-757.281) (-757.965) [-760.845] (-761.220) -- 0:00:25
621500 -- (-757.441) (-765.208) (-761.218) [-761.472] * (-760.759) (-757.840) [-762.699] (-762.215) -- 0:00:24
622000 -- (-758.919) (-765.183) [-760.899] (-761.427) * [-761.938] (-761.600) (-758.656) (-761.242) -- 0:00:24
622500 -- [-759.951] (-760.529) (-761.191) (-761.260) * (-760.283) (-759.679) (-759.620) [-759.056] -- 0:00:24
623000 -- (-758.621) (-761.084) [-758.377] (-760.156) * (-757.899) [-760.127] (-759.053) (-761.777) -- 0:00:24
623500 -- [-758.231] (-763.848) (-759.830) (-764.044) * [-758.735] (-760.601) (-760.293) (-762.828) -- 0:00:24
624000 -- (-760.402) (-764.133) (-758.892) [-759.831] * [-760.813] (-759.745) (-761.632) (-764.507) -- 0:00:24
624500 -- (-761.419) (-758.333) [-758.807] (-764.063) * (-760.507) (-762.589) [-758.836] (-762.217) -- 0:00:24
625000 -- (-759.232) [-760.338] (-761.017) (-759.371) * (-759.834) (-760.853) [-760.226] (-763.001) -- 0:00:25
Average standard deviation of split frequencies: 0.009288
625500 -- [-759.734] (-764.569) (-759.217) (-761.321) * (-760.145) (-759.828) [-759.739] (-760.054) -- 0:00:25
626000 -- (-762.892) [-763.371] (-762.208) (-759.781) * (-759.086) [-759.816] (-764.463) (-760.152) -- 0:00:25
626500 -- (-761.894) (-757.354) [-761.666] (-763.035) * [-759.933] (-757.161) (-761.483) (-758.926) -- 0:00:25
627000 -- (-760.444) [-758.498] (-761.013) (-760.001) * (-758.225) [-759.693] (-763.443) (-761.492) -- 0:00:24
627500 -- [-762.001] (-760.231) (-760.326) (-759.864) * [-759.827] (-763.301) (-759.622) (-761.453) -- 0:00:24
628000 -- (-758.546) (-759.379) (-763.781) [-759.513] * [-757.852] (-756.833) (-761.680) (-759.244) -- 0:00:24
628500 -- (-759.606) (-761.506) [-758.635] (-761.649) * (-761.677) (-760.870) [-761.701] (-759.735) -- 0:00:24
629000 -- (-757.488) [-761.208] (-759.008) (-762.000) * (-761.930) [-760.649] (-760.933) (-761.557) -- 0:00:24
629500 -- (-757.874) (-758.400) [-761.526] (-761.936) * (-758.539) (-759.531) (-758.471) [-761.993] -- 0:00:24
630000 -- (-759.071) (-759.979) [-758.347] (-760.766) * [-761.747] (-760.843) (-759.986) (-760.714) -- 0:00:24
Average standard deviation of split frequencies: 0.009617
630500 -- (-759.452) (-762.293) (-757.157) [-760.473] * (-759.938) [-759.570] (-762.147) (-761.558) -- 0:00:24
631000 -- [-761.799] (-761.742) (-758.928) (-760.679) * (-759.599) [-759.402] (-758.867) (-766.154) -- 0:00:24
631500 -- (-757.974) [-760.862] (-762.231) (-759.989) * (-761.048) (-760.546) (-760.563) [-763.794] -- 0:00:24
632000 -- [-757.712] (-757.448) (-761.429) (-762.080) * (-764.566) (-759.924) (-760.668) [-759.382] -- 0:00:24
632500 -- (-759.974) (-758.573) [-759.955] (-759.473) * (-764.567) [-758.924] (-764.448) (-761.524) -- 0:00:24
633000 -- (-759.607) (-756.942) (-759.236) [-759.597] * (-761.605) (-760.462) [-762.548] (-765.835) -- 0:00:24
633500 -- (-762.218) (-760.363) (-761.899) [-758.661] * (-759.740) (-759.964) [-759.311] (-761.130) -- 0:00:24
634000 -- [-757.893] (-762.116) (-760.391) (-759.813) * (-761.375) (-759.971) [-760.410] (-759.088) -- 0:00:24
634500 -- (-760.089) (-761.603) [-762.695] (-757.932) * (-760.949) [-759.971] (-759.517) (-763.573) -- 0:00:24
635000 -- [-757.480] (-758.577) (-762.441) (-759.532) * (-761.604) (-757.968) [-762.790] (-761.605) -- 0:00:24
Average standard deviation of split frequencies: 0.009586
635500 -- [-757.125] (-757.851) (-761.492) (-760.950) * (-759.403) (-758.828) (-765.843) [-764.914] -- 0:00:24
636000 -- (-760.206) (-758.575) [-759.506] (-759.040) * (-763.204) (-760.941) (-765.434) [-762.484] -- 0:00:24
636500 -- [-759.930] (-758.021) (-758.752) (-758.855) * (-763.425) (-764.249) (-757.780) [-758.125] -- 0:00:23
637000 -- [-762.006] (-761.505) (-760.001) (-760.892) * (-759.554) (-762.068) (-757.847) [-759.641] -- 0:00:23
637500 -- (-760.134) (-761.864) (-760.070) [-762.167] * [-761.133] (-762.095) (-759.300) (-758.720) -- 0:00:23
638000 -- (-759.972) (-759.030) (-758.178) [-762.210] * (-759.836) (-761.820) [-757.917] (-764.324) -- 0:00:23
638500 -- [-758.320] (-757.202) (-759.563) (-763.650) * (-760.353) (-760.417) (-762.492) [-762.925] -- 0:00:23
639000 -- [-761.910] (-759.777) (-763.032) (-762.428) * (-760.788) [-762.509] (-763.390) (-759.104) -- 0:00:23
639500 -- [-760.958] (-768.238) (-759.991) (-761.312) * (-760.283) (-765.616) [-756.167] (-760.295) -- 0:00:23
640000 -- (-762.040) (-768.890) (-758.891) [-759.959] * (-759.367) [-760.126] (-760.785) (-759.673) -- 0:00:23
Average standard deviation of split frequencies: 0.009565
640500 -- (-758.347) [-761.386] (-759.813) (-759.652) * (-760.059) [-759.859] (-760.289) (-759.732) -- 0:00:24
641000 -- [-760.140] (-762.270) (-759.194) (-759.230) * (-762.476) (-759.273) [-759.764] (-761.641) -- 0:00:24
641500 -- [-761.457] (-761.786) (-758.321) (-760.217) * (-762.191) [-762.740] (-759.013) (-761.167) -- 0:00:24
642000 -- (-761.418) (-759.308) (-759.550) [-759.943] * (-759.613) [-763.183] (-761.164) (-760.784) -- 0:00:23
642500 -- (-761.682) [-760.124] (-759.473) (-758.621) * (-760.684) (-759.234) [-758.948] (-763.017) -- 0:00:23
643000 -- (-759.785) [-760.138] (-758.333) (-761.105) * (-761.942) (-760.759) (-758.411) [-760.494] -- 0:00:23
643500 -- (-760.388) (-760.732) [-758.600] (-760.249) * (-769.297) (-758.825) (-758.823) [-761.222] -- 0:00:23
644000 -- [-761.445] (-760.496) (-760.858) (-760.049) * (-761.404) (-760.465) [-760.503] (-760.623) -- 0:00:23
644500 -- (-762.049) (-761.547) (-762.169) [-759.584] * (-762.286) [-759.371] (-759.493) (-759.313) -- 0:00:23
645000 -- [-760.840] (-761.677) (-762.538) (-760.418) * [-756.915] (-759.801) (-758.703) (-762.388) -- 0:00:23
Average standard deviation of split frequencies: 0.009584
645500 -- [-760.299] (-759.973) (-762.324) (-759.361) * [-758.944] (-758.846) (-761.851) (-760.358) -- 0:00:23
646000 -- (-761.198) (-761.776) [-760.572] (-761.619) * (-758.635) [-758.804] (-758.366) (-760.008) -- 0:00:23
646500 -- [-761.155] (-760.228) (-757.640) (-762.763) * (-761.017) (-759.118) (-761.517) [-759.025] -- 0:00:23
647000 -- (-763.172) (-760.292) [-758.590] (-763.191) * (-764.188) (-761.366) (-763.255) [-764.678] -- 0:00:23
647500 -- (-759.120) (-761.245) [-759.387] (-759.482) * (-760.397) [-759.358] (-762.503) (-764.128) -- 0:00:23
648000 -- (-759.073) (-763.716) [-757.551] (-761.062) * (-759.280) (-764.285) [-761.789] (-758.380) -- 0:00:23
648500 -- (-760.251) (-759.004) (-762.412) [-761.612] * (-762.324) [-759.522] (-762.242) (-759.799) -- 0:00:23
649000 -- (-759.442) (-761.358) (-761.098) [-760.159] * (-761.608) (-762.253) [-761.052] (-761.323) -- 0:00:23
649500 -- [-759.298] (-761.195) (-759.813) (-760.711) * [-758.645] (-763.482) (-760.152) (-759.833) -- 0:00:23
650000 -- [-764.682] (-760.238) (-758.700) (-762.190) * (-760.460) (-760.464) (-759.592) [-759.249] -- 0:00:23
Average standard deviation of split frequencies: 0.008839
650500 -- (-761.694) [-761.017] (-761.517) (-762.224) * (-759.127) [-762.609] (-760.285) (-756.960) -- 0:00:23
651000 -- (-759.154) (-760.597) [-761.665] (-762.419) * (-759.614) (-762.720) (-761.977) [-760.821] -- 0:00:23
651500 -- (-760.612) (-762.081) [-761.726] (-760.748) * [-760.335] (-762.309) (-760.657) (-760.682) -- 0:00:23
652000 -- (-760.841) (-761.182) [-760.162] (-760.142) * [-758.996] (-760.679) (-760.277) (-761.791) -- 0:00:22
652500 -- [-765.174] (-761.642) (-762.993) (-764.263) * [-759.948] (-761.983) (-759.664) (-763.309) -- 0:00:22
653000 -- (-759.990) (-762.173) (-764.066) [-759.614] * (-758.275) (-761.230) (-758.415) [-761.102] -- 0:00:22
653500 -- [-760.572] (-768.456) (-759.171) (-760.785) * (-760.633) (-760.361) [-758.708] (-766.270) -- 0:00:22
654000 -- (-759.090) (-764.421) [-760.062] (-764.079) * [-760.379] (-760.066) (-759.414) (-760.401) -- 0:00:22
654500 -- (-759.917) (-759.223) (-760.508) [-760.988] * (-761.265) (-759.629) (-761.021) [-762.058] -- 0:00:22
655000 -- [-763.017] (-760.805) (-761.240) (-762.167) * (-764.017) (-761.870) (-761.753) [-759.401] -- 0:00:22
Average standard deviation of split frequencies: 0.008815
655500 -- (-761.931) [-763.172] (-761.066) (-761.658) * (-761.831) (-759.104) [-760.310] (-758.199) -- 0:00:22
656000 -- [-761.351] (-763.175) (-756.624) (-763.408) * [-759.089] (-762.373) (-761.553) (-760.004) -- 0:00:22
656500 -- [-760.059] (-760.352) (-757.408) (-762.717) * (-762.901) (-761.336) (-762.303) [-760.822] -- 0:00:23
657000 -- (-761.203) (-760.782) [-758.124] (-760.928) * (-761.649) (-758.995) [-763.006] (-763.119) -- 0:00:22
657500 -- (-763.673) (-760.027) (-758.902) [-758.213] * (-762.874) [-759.737] (-760.718) (-761.363) -- 0:00:22
658000 -- (-761.716) (-760.085) (-758.917) [-759.583] * [-760.326] (-758.775) (-763.837) (-763.548) -- 0:00:22
658500 -- (-759.702) (-762.966) (-761.660) [-759.599] * [-759.388] (-759.450) (-762.209) (-761.781) -- 0:00:22
659000 -- (-759.320) [-761.770] (-759.311) (-762.134) * (-759.909) (-759.473) (-762.102) [-758.965] -- 0:00:22
659500 -- (-761.850) [-759.832] (-758.477) (-761.425) * [-760.008] (-761.766) (-766.600) (-765.725) -- 0:00:22
660000 -- (-761.560) [-760.625] (-761.554) (-760.579) * (-761.442) [-761.655] (-768.177) (-760.610) -- 0:00:22
Average standard deviation of split frequencies: 0.008657
660500 -- (-760.460) (-758.271) [-759.900] (-760.424) * (-762.641) (-760.282) [-762.267] (-763.595) -- 0:00:22
661000 -- (-761.660) (-760.212) [-759.385] (-760.629) * (-760.769) (-764.788) (-759.870) [-764.565] -- 0:00:22
661500 -- (-762.994) (-761.738) [-762.105] (-762.669) * [-760.251] (-761.071) (-759.385) (-767.030) -- 0:00:22
662000 -- (-762.979) [-761.936] (-762.853) (-759.110) * [-759.525] (-759.764) (-761.187) (-760.288) -- 0:00:22
662500 -- [-763.400] (-760.014) (-759.947) (-763.435) * [-761.364] (-759.711) (-759.490) (-760.535) -- 0:00:22
663000 -- (-762.020) (-759.846) [-759.740] (-760.868) * [-759.516] (-757.561) (-760.964) (-760.172) -- 0:00:22
663500 -- [-759.999] (-758.500) (-761.412) (-760.913) * (-760.755) (-759.308) [-761.052] (-761.090) -- 0:00:22
664000 -- (-761.887) (-759.143) [-760.214] (-765.243) * (-760.371) (-758.853) [-760.528] (-761.252) -- 0:00:22
664500 -- (-761.774) [-763.345] (-762.167) (-761.048) * (-762.436) (-762.544) [-762.589] (-759.119) -- 0:00:22
665000 -- (-762.447) (-761.466) [-759.637] (-764.171) * (-761.150) (-764.367) (-763.813) [-760.643] -- 0:00:22
Average standard deviation of split frequencies: 0.008069
665500 -- (-761.119) [-767.919] (-762.679) (-762.922) * [-759.208] (-763.621) (-762.742) (-761.111) -- 0:00:22
666000 -- (-763.781) (-764.019) (-759.926) [-760.932] * [-759.332] (-761.951) (-762.701) (-759.328) -- 0:00:22
666500 -- (-761.192) (-762.978) [-763.817] (-762.309) * (-761.190) (-761.072) (-761.678) [-758.728] -- 0:00:22
667000 -- (-760.925) (-764.310) (-762.437) [-763.813] * (-761.305) (-759.554) (-763.386) [-759.458] -- 0:00:21
667500 -- [-760.490] (-763.499) (-760.672) (-760.550) * (-758.770) [-761.434] (-764.120) (-760.933) -- 0:00:21
668000 -- (-759.782) (-761.222) [-759.005] (-758.295) * [-761.813] (-757.621) (-761.050) (-759.759) -- 0:00:21
668500 -- (-760.948) (-762.927) (-760.000) [-761.341] * (-762.574) (-759.333) (-761.490) [-761.226] -- 0:00:21
669000 -- [-760.320] (-761.680) (-758.806) (-760.071) * [-759.719] (-763.207) (-761.228) (-760.516) -- 0:00:21
669500 -- [-759.276] (-761.137) (-764.202) (-760.510) * (-759.439) [-758.562] (-760.361) (-758.582) -- 0:00:21
670000 -- (-759.317) (-764.245) [-761.363] (-760.136) * [-760.306] (-761.051) (-761.874) (-760.117) -- 0:00:21
Average standard deviation of split frequencies: 0.007123
670500 -- (-760.561) (-758.657) [-762.291] (-762.415) * (-762.806) (-759.537) [-759.890] (-758.804) -- 0:00:21
671000 -- (-761.419) (-759.705) [-760.876] (-764.244) * (-761.440) (-758.852) [-762.036] (-759.142) -- 0:00:21
671500 -- (-763.722) [-760.306] (-761.442) (-761.881) * (-763.001) (-759.960) [-760.406] (-762.233) -- 0:00:21
672000 -- (-761.161) (-762.193) (-763.335) [-761.299] * [-764.050] (-762.389) (-760.191) (-758.398) -- 0:00:21
672500 -- (-761.808) [-760.564] (-759.049) (-759.796) * (-761.845) (-761.535) (-759.625) [-759.070] -- 0:00:21
673000 -- (-762.096) (-761.439) [-758.558] (-758.942) * (-758.374) (-760.007) [-761.734] (-762.572) -- 0:00:21
673500 -- [-758.746] (-763.166) (-761.184) (-760.456) * (-760.511) (-761.408) [-761.906] (-761.009) -- 0:00:21
674000 -- [-759.861] (-759.643) (-760.834) (-760.234) * (-760.372) (-759.244) (-762.025) [-762.083] -- 0:00:21
674500 -- [-762.500] (-758.847) (-759.079) (-758.763) * [-762.001] (-759.450) (-760.762) (-760.250) -- 0:00:21
675000 -- [-759.165] (-761.737) (-761.655) (-761.023) * [-759.149] (-761.851) (-761.261) (-758.998) -- 0:00:21
Average standard deviation of split frequencies: 0.006927
675500 -- (-760.395) (-760.711) [-764.621] (-761.833) * (-761.796) (-761.783) (-760.869) [-758.254] -- 0:00:21
676000 -- [-763.821] (-762.261) (-765.924) (-760.262) * (-763.088) (-763.417) [-760.570] (-760.242) -- 0:00:21
676500 -- (-761.104) [-761.890] (-761.936) (-762.932) * (-760.361) (-763.321) [-760.643] (-762.288) -- 0:00:21
677000 -- (-760.401) (-760.951) [-761.083] (-759.923) * [-758.841] (-759.884) (-760.754) (-761.529) -- 0:00:21
677500 -- (-761.329) (-763.541) (-760.342) [-761.886] * (-764.945) (-760.117) [-758.629] (-759.017) -- 0:00:21
678000 -- (-762.800) [-761.307] (-760.224) (-762.032) * (-760.809) (-760.803) (-759.794) [-760.336] -- 0:00:21
678500 -- (-759.728) (-761.497) (-770.737) [-760.653] * [-759.730] (-758.429) (-762.649) (-764.722) -- 0:00:21
679000 -- [-761.083] (-760.481) (-764.883) (-760.729) * (-759.989) (-761.132) [-759.004] (-763.008) -- 0:00:21
679500 -- (-759.238) (-758.007) [-760.612] (-763.768) * [-761.195] (-759.678) (-760.520) (-759.942) -- 0:00:21
680000 -- (-760.389) [-758.707] (-762.677) (-761.579) * [-760.696] (-760.748) (-762.324) (-760.688) -- 0:00:21
Average standard deviation of split frequencies: 0.006833
680500 -- [-762.566] (-759.043) (-763.545) (-760.427) * (-764.622) (-760.492) (-761.956) [-760.791] -- 0:00:21
681000 -- [-759.451] (-757.779) (-762.577) (-760.941) * (-762.746) (-763.329) (-763.023) [-761.784] -- 0:00:21
681500 -- (-760.691) [-761.815] (-759.497) (-761.173) * [-764.056] (-763.094) (-762.903) (-760.319) -- 0:00:21
682000 -- (-763.751) (-762.814) [-762.978] (-759.589) * [-761.569] (-762.052) (-763.352) (-758.561) -- 0:00:20
682500 -- (-761.867) [-760.367] (-760.785) (-761.677) * (-761.631) [-758.428] (-760.867) (-760.718) -- 0:00:20
683000 -- (-764.915) (-764.817) (-759.776) [-762.578] * (-765.882) [-758.375] (-760.070) (-760.427) -- 0:00:20
683500 -- (-762.407) [-761.285] (-760.970) (-762.727) * (-763.853) (-760.441) (-759.758) [-759.343] -- 0:00:20
684000 -- [-760.921] (-762.485) (-760.608) (-762.045) * (-765.260) (-759.123) (-758.342) [-760.779] -- 0:00:20
684500 -- (-761.498) (-760.709) (-763.312) [-764.261] * [-759.652] (-757.035) (-764.329) (-763.424) -- 0:00:20
685000 -- [-762.489] (-763.680) (-761.102) (-756.983) * (-763.687) (-761.503) (-762.783) [-759.175] -- 0:00:20
Average standard deviation of split frequencies: 0.006689
685500 -- (-760.845) (-760.174) (-760.232) [-760.086] * [-763.387] (-761.277) (-761.881) (-763.811) -- 0:00:20
686000 -- [-758.191] (-765.522) (-761.851) (-762.540) * (-761.602) [-761.773] (-762.624) (-761.373) -- 0:00:20
686500 -- [-760.927] (-761.681) (-760.859) (-761.663) * (-759.552) (-759.425) (-760.521) [-759.140] -- 0:00:21
687000 -- (-761.010) [-758.080] (-761.231) (-763.345) * [-760.032] (-759.396) (-760.456) (-761.424) -- 0:00:20
687500 -- (-759.317) [-760.347] (-759.905) (-760.502) * (-760.763) [-760.061] (-760.983) (-762.873) -- 0:00:20
688000 -- [-760.204] (-758.732) (-761.398) (-761.208) * (-759.534) [-759.599] (-761.063) (-759.551) -- 0:00:20
688500 -- (-760.520) (-759.413) (-758.522) [-761.352] * [-760.880] (-758.108) (-760.257) (-764.668) -- 0:00:20
689000 -- [-756.571] (-759.072) (-757.484) (-760.542) * [-761.960] (-760.370) (-759.314) (-761.300) -- 0:00:20
689500 -- (-760.756) [-759.223] (-758.218) (-761.667) * (-761.864) (-760.331) (-759.796) [-760.175] -- 0:00:20
690000 -- (-760.288) [-758.471] (-759.162) (-761.060) * (-761.145) (-761.972) (-759.356) [-758.482] -- 0:00:20
Average standard deviation of split frequencies: 0.006962
690500 -- [-760.043] (-762.800) (-763.270) (-761.524) * (-763.364) (-758.258) [-757.204] (-759.959) -- 0:00:20
691000 -- (-761.831) (-759.264) (-762.120) [-759.265] * (-763.605) (-757.580) (-758.174) [-761.586] -- 0:00:20
691500 -- (-761.758) [-757.478] (-763.871) (-761.060) * (-762.785) (-758.279) (-765.400) [-759.845] -- 0:00:20
692000 -- (-758.729) (-761.228) (-766.815) [-761.826] * [-761.875] (-760.526) (-759.194) (-760.156) -- 0:00:20
692500 -- (-758.599) [-760.064] (-761.987) (-760.072) * (-765.631) (-758.500) [-763.750] (-759.420) -- 0:00:20
693000 -- [-759.212] (-758.318) (-762.383) (-761.303) * (-763.847) [-757.586] (-767.484) (-759.954) -- 0:00:20
693500 -- [-761.690] (-759.659) (-760.872) (-760.793) * (-761.428) (-766.702) (-760.995) [-760.312] -- 0:00:20
694000 -- (-764.467) [-760.613] (-758.504) (-760.557) * (-761.004) (-761.273) (-762.091) [-756.574] -- 0:00:20
694500 -- (-759.424) (-757.845) (-760.892) [-761.794] * (-760.611) [-760.420] (-759.999) (-759.622) -- 0:00:20
695000 -- (-760.638) [-759.161] (-759.139) (-760.409) * (-763.179) (-758.384) [-760.878] (-760.978) -- 0:00:20
Average standard deviation of split frequencies: 0.006592
695500 -- (-759.508) (-763.748) (-760.823) [-763.657] * (-758.312) [-761.133] (-762.588) (-759.784) -- 0:00:20
696000 -- [-760.138] (-763.195) (-758.542) (-760.235) * (-758.553) (-762.610) [-760.861] (-758.635) -- 0:00:20
696500 -- (-761.157) [-760.990] (-758.286) (-760.154) * [-760.496] (-765.697) (-759.729) (-760.647) -- 0:00:20
697000 -- (-759.428) (-764.458) [-759.011] (-759.327) * (-760.012) (-763.381) [-761.026] (-759.552) -- 0:00:19
697500 -- (-761.316) (-759.226) (-758.958) [-761.245] * [-763.668] (-762.050) (-761.254) (-763.694) -- 0:00:19
698000 -- (-762.107) [-760.598] (-761.720) (-761.189) * [-758.230] (-760.881) (-761.305) (-762.125) -- 0:00:19
698500 -- (-766.128) (-759.517) [-760.400] (-760.815) * [-758.022] (-760.793) (-760.344) (-759.524) -- 0:00:19
699000 -- (-761.053) [-759.129] (-758.332) (-762.096) * [-757.544] (-761.337) (-762.162) (-759.324) -- 0:00:20
699500 -- (-761.513) (-759.323) (-765.933) [-757.561] * [-758.960] (-765.243) (-762.709) (-761.135) -- 0:00:20
700000 -- [-761.106] (-761.596) (-763.633) (-759.761) * (-759.188) (-760.200) [-759.525] (-760.437) -- 0:00:20
Average standard deviation of split frequencies: 0.006235
700500 -- (-760.215) (-760.495) [-758.148] (-758.929) * (-765.109) (-759.424) [-757.509] (-763.163) -- 0:00:20
701000 -- [-760.656] (-760.831) (-761.437) (-759.978) * (-759.258) [-759.655] (-759.639) (-759.773) -- 0:00:20
701500 -- (-759.284) (-757.482) [-757.299] (-758.211) * [-759.735] (-759.918) (-762.853) (-762.326) -- 0:00:19
702000 -- (-758.289) (-758.852) [-759.330] (-758.703) * (-762.522) [-760.334] (-765.967) (-763.035) -- 0:00:19
702500 -- [-761.210] (-758.886) (-763.744) (-758.452) * (-758.792) (-759.502) [-762.707] (-766.864) -- 0:00:19
703000 -- (-758.313) (-760.970) (-758.243) [-759.367] * [-759.910] (-760.950) (-760.305) (-766.078) -- 0:00:19
703500 -- (-762.577) (-759.780) (-760.595) [-758.602] * (-765.304) (-761.859) [-761.030] (-758.789) -- 0:00:19
704000 -- (-760.723) [-762.910] (-760.403) (-760.426) * (-759.246) (-760.657) [-759.977] (-759.519) -- 0:00:19
704500 -- (-760.256) [-760.579] (-760.047) (-761.612) * (-760.382) [-761.984] (-763.826) (-759.440) -- 0:00:19
705000 -- [-760.019] (-760.143) (-760.551) (-760.789) * (-761.413) (-760.668) (-764.271) [-758.672] -- 0:00:19
Average standard deviation of split frequencies: 0.006499
705500 -- (-760.482) [-760.537] (-761.572) (-758.970) * (-760.740) [-759.402] (-761.289) (-762.069) -- 0:00:19
706000 -- [-760.838] (-758.478) (-757.940) (-760.609) * [-759.399] (-766.250) (-761.690) (-760.030) -- 0:00:19
706500 -- (-759.123) [-759.901] (-760.134) (-759.786) * [-758.497] (-762.214) (-761.937) (-760.769) -- 0:00:19
707000 -- (-760.606) [-758.664] (-760.825) (-757.238) * (-758.390) (-761.387) (-760.332) [-760.054] -- 0:00:19
707500 -- (-762.637) (-758.004) [-759.023] (-759.969) * [-761.988] (-763.291) (-759.890) (-759.047) -- 0:00:19
708000 -- (-759.362) (-764.193) (-762.854) [-760.474] * (-759.232) (-760.262) (-761.687) [-761.848] -- 0:00:19
708500 -- (-761.770) [-758.144] (-763.569) (-764.249) * [-760.350] (-760.543) (-763.844) (-760.123) -- 0:00:19
709000 -- (-759.502) (-756.362) (-760.045) [-758.737] * (-759.914) [-759.981] (-761.720) (-763.307) -- 0:00:19
709500 -- (-760.963) (-759.823) (-764.230) [-759.285] * (-759.879) (-762.123) [-763.983] (-761.110) -- 0:00:19
710000 -- (-762.120) (-763.490) (-766.011) [-757.838] * [-760.083] (-758.804) (-762.088) (-760.721) -- 0:00:19
Average standard deviation of split frequencies: 0.006279
710500 -- (-762.184) [-761.292] (-759.385) (-759.254) * (-766.856) [-758.935] (-763.525) (-760.545) -- 0:00:19
711000 -- (-763.180) (-763.357) (-757.632) [-762.525] * [-763.157] (-760.059) (-764.662) (-762.943) -- 0:00:19
711500 -- (-766.593) [-761.712] (-758.201) (-762.325) * (-760.364) (-760.697) (-761.925) [-759.229] -- 0:00:19
712000 -- (-761.247) (-761.515) (-766.612) [-757.688] * (-761.908) (-760.638) [-760.278] (-762.586) -- 0:00:19
712500 -- [-758.468] (-761.471) (-761.206) (-760.672) * (-762.016) [-760.640] (-758.986) (-763.591) -- 0:00:18
713000 -- (-760.556) [-758.152] (-759.962) (-760.316) * [-761.559] (-762.014) (-760.861) (-759.971) -- 0:00:18
713500 -- [-759.800] (-761.640) (-761.384) (-760.813) * (-768.621) (-764.045) (-762.717) [-763.654] -- 0:00:18
714000 -- [-762.296] (-762.146) (-758.473) (-762.450) * (-761.152) (-762.934) (-760.609) [-758.034] -- 0:00:19
714500 -- (-761.012) (-760.824) (-759.160) [-758.711] * (-761.077) [-757.813] (-762.198) (-761.021) -- 0:00:19
715000 -- (-764.478) [-762.675] (-758.469) (-762.161) * (-762.683) [-758.443] (-763.065) (-760.521) -- 0:00:19
Average standard deviation of split frequencies: 0.006057
715500 -- (-760.761) [-759.794] (-761.962) (-760.850) * [-759.742] (-760.203) (-763.518) (-760.050) -- 0:00:19
716000 -- (-761.193) (-762.765) (-763.770) [-761.165] * (-760.120) (-759.818) (-761.904) [-759.756] -- 0:00:19
716500 -- (-762.868) (-760.372) (-762.708) [-759.905] * (-760.739) (-759.805) [-761.166] (-759.192) -- 0:00:18
717000 -- (-760.320) [-760.232] (-763.564) (-759.207) * (-761.033) (-760.091) [-760.433] (-760.148) -- 0:00:18
717500 -- [-761.821] (-761.505) (-760.549) (-760.219) * [-761.081] (-761.241) (-760.783) (-760.372) -- 0:00:18
718000 -- (-761.034) (-762.055) [-761.183] (-761.476) * (-762.126) (-759.644) [-761.314] (-760.762) -- 0:00:18
718500 -- (-757.682) (-760.192) [-761.911] (-760.092) * [-759.431] (-760.314) (-758.095) (-762.094) -- 0:00:18
719000 -- [-757.700] (-763.775) (-762.128) (-764.778) * [-758.649] (-757.648) (-759.693) (-760.825) -- 0:00:18
719500 -- (-757.693) [-760.819] (-759.957) (-760.383) * [-759.407] (-758.275) (-759.800) (-759.842) -- 0:00:18
720000 -- (-760.637) (-762.140) [-757.650] (-761.637) * (-760.428) (-762.452) [-759.729] (-761.600) -- 0:00:18
Average standard deviation of split frequencies: 0.005974
720500 -- (-760.819) [-760.423] (-760.708) (-760.557) * (-758.497) [-760.696] (-762.577) (-765.939) -- 0:00:18
721000 -- (-758.964) [-758.128] (-757.952) (-761.849) * [-757.947] (-760.168) (-759.545) (-766.055) -- 0:00:18
721500 -- [-759.056] (-760.577) (-761.439) (-760.681) * (-758.764) [-758.689] (-760.249) (-763.980) -- 0:00:18
722000 -- [-758.631] (-759.947) (-762.602) (-765.279) * (-765.177) [-761.449] (-762.737) (-761.101) -- 0:00:18
722500 -- [-758.470] (-759.960) (-764.752) (-762.581) * (-763.292) [-761.844] (-760.720) (-760.490) -- 0:00:18
723000 -- (-757.627) (-761.975) [-757.971] (-761.448) * [-765.702] (-760.506) (-762.731) (-760.502) -- 0:00:18
723500 -- (-760.074) (-759.590) [-759.710] (-760.362) * [-758.860] (-759.847) (-759.438) (-759.829) -- 0:00:18
724000 -- [-760.008] (-764.223) (-757.911) (-760.565) * (-758.904) (-765.816) (-760.986) [-760.137] -- 0:00:18
724500 -- (-761.706) [-757.559] (-759.815) (-762.726) * (-760.205) (-761.436) [-760.402] (-762.748) -- 0:00:18
725000 -- (-764.353) (-763.536) (-766.969) [-761.247] * (-765.811) (-760.991) (-759.940) [-760.568] -- 0:00:18
Average standard deviation of split frequencies: 0.006017
725500 -- (-765.141) (-758.149) (-758.548) [-759.444] * (-763.705) [-758.512] (-762.614) (-764.949) -- 0:00:18
726000 -- (-761.332) (-759.507) [-761.062] (-761.427) * (-761.493) [-759.947] (-760.330) (-764.687) -- 0:00:18
726500 -- (-759.996) [-758.507] (-759.905) (-761.372) * (-762.448) (-762.647) (-761.156) [-760.443] -- 0:00:18
727000 -- [-757.073] (-760.678) (-762.356) (-760.443) * (-758.766) (-767.036) (-760.028) [-756.759] -- 0:00:18
727500 -- (-761.990) (-761.304) (-761.156) [-759.671] * (-761.694) (-758.405) [-761.016] (-764.473) -- 0:00:17
728000 -- (-767.893) (-758.045) [-762.392] (-760.941) * (-759.876) [-759.690] (-759.965) (-758.471) -- 0:00:17
728500 -- [-759.750] (-761.944) (-758.858) (-760.701) * (-761.172) (-758.570) (-758.791) [-761.314] -- 0:00:18
729000 -- (-762.820) [-760.370] (-761.360) (-761.224) * (-760.302) [-760.518] (-761.030) (-759.954) -- 0:00:18
729500 -- (-760.136) (-759.967) [-759.099] (-761.115) * (-762.585) (-759.607) (-760.842) [-758.656] -- 0:00:18
730000 -- (-760.011) (-762.548) [-759.337] (-761.503) * (-758.260) [-758.816] (-761.015) (-758.468) -- 0:00:18
Average standard deviation of split frequencies: 0.005936
730500 -- (-760.489) [-762.597] (-758.477) (-760.566) * [-758.160] (-760.542) (-764.003) (-760.479) -- 0:00:18
731000 -- (-760.332) (-761.118) [-761.886] (-760.339) * (-759.656) (-763.688) [-767.094] (-759.797) -- 0:00:18
731500 -- (-760.351) (-758.508) [-759.428] (-757.470) * (-761.115) [-759.467] (-760.976) (-760.177) -- 0:00:17
732000 -- (-757.740) (-759.030) [-760.932] (-759.553) * [-760.383] (-761.961) (-765.241) (-761.169) -- 0:00:17
732500 -- (-757.890) (-758.572) (-763.268) [-758.426] * (-760.854) (-759.003) [-765.523] (-758.096) -- 0:00:17
733000 -- (-761.271) [-760.604] (-763.006) (-760.077) * (-760.335) [-762.359] (-761.370) (-763.285) -- 0:00:17
733500 -- [-757.671] (-759.857) (-764.749) (-759.021) * (-759.615) (-760.528) [-761.458] (-760.363) -- 0:00:17
734000 -- [-761.743] (-757.711) (-759.078) (-758.791) * (-760.974) (-769.232) [-761.873] (-758.159) -- 0:00:17
734500 -- (-758.676) (-758.175) (-762.054) [-759.896] * (-762.471) (-761.564) (-762.239) [-758.574] -- 0:00:17
735000 -- (-759.505) (-760.314) [-760.443] (-757.742) * (-758.741) (-762.855) (-760.510) [-758.125] -- 0:00:17
Average standard deviation of split frequencies: 0.006234
735500 -- (-761.172) [-759.731] (-760.142) (-760.684) * [-757.918] (-761.163) (-761.599) (-759.402) -- 0:00:17
736000 -- (-763.140) [-758.562] (-764.530) (-760.456) * (-759.908) (-760.213) (-760.672) [-758.215] -- 0:00:17
736500 -- [-761.425] (-757.696) (-762.483) (-762.493) * [-758.181] (-761.109) (-760.118) (-762.909) -- 0:00:17
737000 -- (-761.746) [-760.312] (-760.526) (-757.992) * [-760.886] (-759.562) (-760.893) (-758.285) -- 0:00:17
737500 -- [-761.240] (-759.664) (-761.837) (-759.007) * (-760.011) (-760.141) [-760.141] (-760.105) -- 0:00:17
738000 -- (-764.112) (-761.436) [-760.974] (-761.241) * (-760.852) (-760.881) (-763.096) [-760.961] -- 0:00:17
738500 -- (-760.159) (-759.217) (-761.939) [-759.565] * (-760.506) [-760.572] (-760.385) (-759.530) -- 0:00:17
739000 -- (-759.284) [-758.939] (-761.282) (-760.435) * (-760.097) (-759.274) [-759.872] (-763.457) -- 0:00:17
739500 -- (-760.910) (-759.478) (-763.757) [-758.989] * (-758.370) [-757.518] (-760.271) (-757.310) -- 0:00:17
740000 -- (-759.190) (-756.845) [-761.503] (-760.585) * (-762.263) (-763.430) (-759.290) [-758.348] -- 0:00:17
Average standard deviation of split frequencies: 0.006237
740500 -- (-763.769) [-759.963] (-763.312) (-760.519) * (-761.572) [-758.244] (-759.307) (-756.884) -- 0:00:17
741000 -- (-762.090) (-760.821) (-764.333) [-760.609] * (-760.226) [-762.799] (-758.963) (-759.950) -- 0:00:17
741500 -- [-760.665] (-757.804) (-762.127) (-761.377) * (-760.644) [-759.664] (-758.705) (-762.997) -- 0:00:17
742000 -- (-763.211) (-759.607) (-762.850) [-758.268] * [-759.635] (-760.684) (-760.365) (-765.465) -- 0:00:17
742500 -- (-760.796) [-757.902] (-762.900) (-760.102) * (-760.992) (-759.886) (-758.246) [-761.867] -- 0:00:16
743000 -- (-761.561) (-764.173) (-760.091) [-758.765] * [-759.402] (-762.913) (-760.768) (-759.600) -- 0:00:16
743500 -- [-761.260] (-762.992) (-761.273) (-760.932) * [-761.513] (-763.059) (-757.263) (-764.134) -- 0:00:17
744000 -- (-763.487) [-761.649] (-758.842) (-758.158) * (-758.469) (-760.463) [-760.843] (-762.641) -- 0:00:17
744500 -- (-766.295) (-761.285) (-759.399) [-758.287] * (-762.532) (-757.884) (-760.644) [-762.741] -- 0:00:17
745000 -- [-762.563] (-759.035) (-761.303) (-764.665) * (-762.202) [-761.008] (-761.656) (-760.048) -- 0:00:17
Average standard deviation of split frequencies: 0.006108
745500 -- (-759.456) [-761.465] (-760.147) (-758.804) * (-769.695) (-763.029) [-761.870] (-757.576) -- 0:00:17
746000 -- (-762.147) (-761.838) (-762.027) [-759.404] * (-762.993) [-762.913] (-763.925) (-760.283) -- 0:00:17
746500 -- (-760.703) (-761.253) (-758.800) [-758.928] * [-761.930] (-761.077) (-763.225) (-760.902) -- 0:00:16
747000 -- [-760.274] (-758.978) (-763.601) (-758.671) * [-759.878] (-764.388) (-759.179) (-758.039) -- 0:00:16
747500 -- (-759.357) [-758.217] (-764.164) (-758.893) * [-761.936] (-759.275) (-759.485) (-762.128) -- 0:00:16
748000 -- (-760.374) [-759.976] (-763.963) (-759.390) * (-762.733) (-762.016) [-760.073] (-759.691) -- 0:00:16
748500 -- (-759.756) [-764.817] (-763.285) (-760.016) * (-759.563) (-762.365) (-760.718) [-757.942] -- 0:00:16
749000 -- (-761.114) (-762.401) (-760.672) [-757.951] * (-758.706) (-762.271) [-760.179] (-760.183) -- 0:00:16
749500 -- (-761.104) (-759.995) (-759.073) [-759.642] * [-758.995] (-761.875) (-760.201) (-758.808) -- 0:00:16
750000 -- (-761.877) (-758.026) [-760.974] (-762.542) * (-758.443) (-759.726) (-760.486) [-759.588] -- 0:00:16
Average standard deviation of split frequencies: 0.006070
750500 -- (-758.924) (-757.838) (-759.432) [-759.797] * (-763.080) (-758.861) (-760.296) [-757.773] -- 0:00:16
751000 -- (-761.035) [-758.899] (-759.746) (-760.880) * [-762.065] (-760.556) (-758.713) (-759.231) -- 0:00:16
751500 -- (-761.237) [-761.339] (-758.724) (-764.990) * (-762.649) (-759.332) (-760.819) [-761.324] -- 0:00:16
752000 -- [-760.936] (-759.266) (-759.573) (-764.542) * [-758.705] (-762.987) (-760.863) (-760.724) -- 0:00:16
752500 -- (-759.529) (-759.786) (-763.358) [-764.405] * (-760.641) (-761.737) (-760.622) [-759.747] -- 0:00:16
753000 -- (-759.989) [-759.246] (-762.613) (-761.877) * (-759.932) (-760.063) (-760.859) [-761.225] -- 0:00:16
753500 -- (-760.777) (-761.114) (-761.491) [-761.095] * (-765.247) [-759.178] (-762.876) (-759.830) -- 0:00:16
754000 -- (-760.813) (-760.594) [-759.382] (-761.574) * (-763.257) (-760.399) [-762.264] (-757.796) -- 0:00:16
754500 -- (-761.464) (-760.064) [-759.558] (-764.339) * (-758.798) (-760.016) (-761.139) [-760.588] -- 0:00:16
755000 -- (-758.632) (-763.274) [-758.260] (-761.066) * (-760.470) (-760.183) [-760.931] (-760.962) -- 0:00:16
Average standard deviation of split frequencies: 0.005778
755500 -- [-763.866] (-759.937) (-762.092) (-761.094) * (-764.440) (-759.033) (-760.855) [-758.887] -- 0:00:16
756000 -- (-761.286) (-756.979) [-758.610] (-761.073) * (-764.258) (-764.616) (-762.161) [-761.244] -- 0:00:16
756500 -- (-761.375) [-759.960] (-761.567) (-759.353) * (-764.359) (-765.994) [-760.974] (-760.094) -- 0:00:16
757000 -- [-761.776] (-760.804) (-762.011) (-760.912) * (-764.627) [-760.826] (-764.760) (-758.709) -- 0:00:16
757500 -- [-760.755] (-761.184) (-757.320) (-762.251) * [-761.817] (-758.721) (-761.155) (-758.683) -- 0:00:16
758000 -- [-760.392] (-758.481) (-759.829) (-760.526) * (-763.112) (-761.977) (-760.322) [-762.653] -- 0:00:15
758500 -- (-760.770) (-762.043) [-759.939] (-759.132) * (-762.829) (-764.968) (-761.839) [-757.737] -- 0:00:16
759000 -- (-763.047) (-761.167) (-762.303) [-760.064] * (-759.004) (-764.916) (-760.731) [-760.079] -- 0:00:16
759500 -- (-760.343) (-762.375) [-759.045] (-760.563) * [-759.574] (-765.158) (-760.156) (-761.704) -- 0:00:16
760000 -- (-761.469) (-762.363) [-758.503] (-761.339) * (-760.776) (-760.974) (-761.508) [-758.339] -- 0:00:16
Average standard deviation of split frequencies: 0.005578
760500 -- (-760.618) [-760.543] (-758.973) (-759.857) * (-760.059) [-761.717] (-762.150) (-758.275) -- 0:00:16
761000 -- [-760.825] (-760.806) (-760.336) (-758.225) * (-758.215) (-760.695) [-761.973] (-759.069) -- 0:00:16
761500 -- (-760.672) [-762.697] (-761.962) (-763.069) * [-759.464] (-762.215) (-761.182) (-758.810) -- 0:00:15
762000 -- (-762.469) (-759.915) [-761.587] (-762.349) * (-765.056) (-761.129) (-760.101) [-758.692] -- 0:00:15
762500 -- (-759.316) (-758.892) (-761.556) [-759.429] * (-759.291) (-759.741) (-762.233) [-760.754] -- 0:00:15
763000 -- (-759.465) (-762.150) [-758.425] (-762.263) * (-761.630) (-760.679) (-762.035) [-758.876] -- 0:00:15
763500 -- (-761.100) [-758.453] (-757.861) (-761.198) * (-762.175) (-760.300) [-762.954] (-759.820) -- 0:00:15
764000 -- (-760.910) (-763.699) (-763.702) [-762.430] * (-763.138) [-757.740] (-760.981) (-762.990) -- 0:00:15
764500 -- [-761.399] (-764.975) (-760.023) (-764.682) * [-761.633] (-758.067) (-764.793) (-759.328) -- 0:00:15
765000 -- (-762.060) (-759.115) [-759.923] (-760.875) * (-762.997) (-761.585) (-759.659) [-762.715] -- 0:00:15
Average standard deviation of split frequencies: 0.005539
765500 -- (-762.712) (-761.981) [-759.800] (-760.262) * (-763.675) (-758.858) [-761.282] (-758.857) -- 0:00:15
766000 -- (-761.681) (-759.659) (-760.212) [-760.448] * (-759.059) (-758.173) [-759.359] (-759.959) -- 0:00:15
766500 -- (-761.143) [-759.978] (-761.691) (-760.842) * (-760.664) [-757.540] (-759.339) (-760.757) -- 0:00:15
767000 -- [-760.587] (-760.002) (-760.893) (-760.810) * (-765.141) (-761.721) (-759.339) [-760.663] -- 0:00:15
767500 -- (-760.844) (-761.414) (-760.998) [-760.220] * (-760.552) [-758.860] (-760.655) (-761.617) -- 0:00:15
768000 -- (-759.780) (-759.293) [-756.291] (-763.180) * (-758.717) (-758.629) [-762.135] (-760.609) -- 0:00:15
768500 -- [-760.913] (-763.309) (-759.197) (-764.563) * (-760.994) (-758.745) (-761.068) [-761.110] -- 0:00:15
769000 -- (-760.593) (-760.489) (-759.603) [-762.091] * (-761.415) (-759.397) (-761.514) [-761.039] -- 0:00:15
769500 -- (-761.790) (-759.527) (-761.383) [-762.522] * [-756.933] (-760.104) (-762.795) (-760.414) -- 0:00:15
770000 -- (-758.690) [-764.251] (-764.398) (-763.882) * (-763.013) (-762.718) [-759.414] (-763.729) -- 0:00:15
Average standard deviation of split frequencies: 0.005546
770500 -- (-760.424) (-760.720) [-757.906] (-762.421) * (-761.031) (-759.200) [-762.178] (-760.955) -- 0:00:15
771000 -- [-762.014] (-758.475) (-760.160) (-759.639) * (-760.344) (-760.474) [-761.721] (-761.329) -- 0:00:15
771500 -- (-762.636) (-758.092) [-757.717] (-761.543) * (-760.563) [-759.339] (-758.568) (-759.348) -- 0:00:15
772000 -- (-760.063) (-759.396) [-760.196] (-758.780) * [-759.303] (-759.895) (-758.438) (-760.021) -- 0:00:15
772500 -- (-758.973) [-759.825] (-761.688) (-762.114) * (-760.706) (-758.530) (-759.907) [-759.527] -- 0:00:15
773000 -- (-761.543) (-759.354) [-759.496] (-761.609) * (-760.604) (-758.913) [-758.829] (-763.160) -- 0:00:14
773500 -- [-760.897] (-761.762) (-761.577) (-762.764) * [-761.655] (-761.714) (-760.449) (-759.419) -- 0:00:15
774000 -- [-759.958] (-761.685) (-763.306) (-759.752) * (-763.282) [-758.472] (-760.451) (-764.610) -- 0:00:15
774500 -- (-763.447) (-758.908) (-761.752) [-760.373] * (-759.332) [-760.540] (-761.959) (-761.512) -- 0:00:15
775000 -- [-759.315] (-759.016) (-763.103) (-764.840) * (-758.455) (-760.018) (-764.675) [-756.986] -- 0:00:15
Average standard deviation of split frequencies: 0.005791
775500 -- (-760.674) (-760.171) (-760.798) [-761.982] * (-763.395) (-759.265) (-763.350) [-760.343] -- 0:00:15
776000 -- [-758.814] (-758.846) (-760.933) (-760.118) * (-757.650) [-759.034] (-760.193) (-760.084) -- 0:00:15
776500 -- (-760.757) (-763.111) (-760.447) [-757.495] * (-759.393) (-758.574) (-762.152) [-759.112] -- 0:00:14
777000 -- (-759.097) (-764.368) (-761.567) [-764.373] * (-759.812) (-761.173) [-762.018] (-759.030) -- 0:00:14
777500 -- [-757.881] (-763.275) (-763.122) (-758.689) * [-759.118] (-758.010) (-758.417) (-763.559) -- 0:00:14
778000 -- (-762.023) [-758.913] (-758.260) (-758.743) * (-759.671) (-758.934) (-759.481) [-763.353] -- 0:00:14
778500 -- (-758.702) (-759.539) (-767.124) [-759.230] * (-760.688) (-757.611) [-760.461] (-759.189) -- 0:00:14
779000 -- (-761.413) (-759.493) (-762.379) [-761.493] * (-760.697) (-759.635) [-758.789] (-758.497) -- 0:00:14
779500 -- (-761.280) (-757.824) (-765.061) [-759.253] * (-759.510) (-761.131) (-761.987) [-756.587] -- 0:00:14
780000 -- (-759.490) (-760.105) (-760.682) [-759.482] * (-759.618) (-763.146) [-758.253] (-759.622) -- 0:00:14
Average standard deviation of split frequencies: 0.006159
780500 -- (-758.921) (-760.105) [-760.468] (-762.540) * (-761.849) (-759.736) [-757.342] (-760.100) -- 0:00:14
781000 -- (-759.865) (-759.565) [-757.648] (-760.706) * (-759.639) (-758.170) (-758.834) [-760.664] -- 0:00:14
781500 -- [-760.108] (-759.525) (-761.017) (-759.933) * [-758.254] (-765.031) (-757.537) (-758.817) -- 0:00:14
782000 -- (-759.481) (-762.741) [-762.369] (-759.099) * (-758.556) (-761.426) (-758.133) [-758.386] -- 0:00:14
782500 -- (-757.863) (-760.202) [-758.491] (-763.223) * (-757.465) (-761.083) (-761.726) [-759.841] -- 0:00:14
783000 -- (-759.594) (-760.381) (-758.259) [-760.979] * [-761.119] (-758.001) (-761.150) (-761.415) -- 0:00:14
783500 -- [-761.216] (-762.882) (-760.351) (-761.045) * [-759.396] (-761.430) (-760.096) (-767.774) -- 0:00:14
784000 -- (-759.819) (-760.550) [-759.151] (-762.001) * (-760.019) [-758.264] (-758.788) (-762.689) -- 0:00:14
784500 -- (-762.334) [-759.934] (-760.303) (-762.699) * [-759.984] (-759.024) (-759.779) (-764.886) -- 0:00:14
785000 -- (-762.265) (-761.939) (-759.942) [-760.222] * (-758.840) (-760.223) [-758.982] (-761.552) -- 0:00:14
Average standard deviation of split frequencies: 0.006357
785500 -- (-762.798) (-760.222) (-762.567) [-757.992] * [-759.543] (-757.093) (-760.793) (-761.560) -- 0:00:14
786000 -- [-760.156] (-763.097) (-761.299) (-761.387) * (-761.562) (-760.987) [-760.009] (-760.937) -- 0:00:14
786500 -- (-760.562) [-761.250] (-762.058) (-762.148) * (-761.224) (-770.264) [-758.885] (-757.582) -- 0:00:14
787000 -- (-764.554) (-761.742) (-761.162) [-758.179] * (-759.718) [-765.473] (-763.758) (-764.053) -- 0:00:14
787500 -- [-759.063] (-759.840) (-760.980) (-760.812) * (-758.957) [-761.114] (-763.916) (-758.420) -- 0:00:14
788000 -- [-759.368] (-762.595) (-760.952) (-760.868) * (-759.603) (-760.368) [-758.405] (-760.426) -- 0:00:13
788500 -- [-760.506] (-766.518) (-758.365) (-760.946) * (-761.576) (-760.250) (-760.357) [-758.979] -- 0:00:14
789000 -- (-759.299) [-760.255] (-764.788) (-760.488) * (-761.031) (-762.533) (-760.833) [-759.165] -- 0:00:14
789500 -- (-759.172) [-762.905] (-762.163) (-759.538) * (-762.700) (-763.049) (-760.861) [-759.671] -- 0:00:14
790000 -- [-760.261] (-760.473) (-760.975) (-763.376) * (-766.148) (-758.960) [-759.986] (-757.823) -- 0:00:14
Average standard deviation of split frequencies: 0.006201
790500 -- (-760.338) (-760.732) (-759.167) [-758.300] * (-760.975) (-760.237) [-757.795] (-760.582) -- 0:00:14
791000 -- (-759.920) (-759.969) [-761.302] (-760.663) * (-760.713) (-760.923) [-765.507] (-759.586) -- 0:00:14
791500 -- (-761.286) (-759.712) (-759.623) [-758.953] * (-760.147) [-758.873] (-762.278) (-758.405) -- 0:00:13
792000 -- (-761.338) (-760.255) (-760.963) [-757.624] * (-762.561) (-763.301) [-762.815] (-756.764) -- 0:00:13
792500 -- (-759.304) (-757.719) (-759.510) [-758.089] * (-762.074) (-761.106) [-758.352] (-761.119) -- 0:00:13
793000 -- (-761.196) (-760.255) (-759.671) [-759.324] * (-762.025) (-759.818) (-759.513) [-759.490] -- 0:00:13
793500 -- (-765.494) (-760.822) [-762.604] (-762.779) * (-765.638) [-760.739] (-759.149) (-757.097) -- 0:00:13
794000 -- (-759.952) (-762.720) (-762.377) [-762.221] * [-760.786] (-759.744) (-759.561) (-761.385) -- 0:00:13
794500 -- [-762.823] (-763.058) (-765.384) (-760.217) * (-762.603) [-759.726] (-760.836) (-762.300) -- 0:00:13
795000 -- (-761.274) (-758.669) (-760.019) [-762.555] * (-766.100) (-762.993) (-761.382) [-762.864] -- 0:00:13
Average standard deviation of split frequencies: 0.006159
795500 -- (-760.855) (-760.892) [-758.666] (-760.745) * (-762.906) (-760.198) (-759.488) [-758.014] -- 0:00:13
796000 -- [-760.600] (-764.838) (-760.844) (-759.385) * (-759.591) (-761.467) [-760.019] (-762.451) -- 0:00:13
796500 -- [-760.668] (-759.268) (-761.796) (-758.865) * (-760.899) (-760.622) [-760.095] (-758.670) -- 0:00:13
797000 -- [-761.948] (-761.443) (-758.478) (-763.718) * (-762.727) (-761.320) (-760.806) [-761.722] -- 0:00:13
797500 -- [-766.034] (-759.000) (-758.885) (-758.776) * (-759.478) (-760.365) [-759.881] (-762.636) -- 0:00:13
798000 -- [-761.319] (-765.867) (-761.884) (-759.642) * (-760.051) (-758.972) (-758.658) [-757.641] -- 0:00:13
798500 -- (-760.050) (-759.632) [-760.903] (-760.565) * (-759.421) (-760.534) (-761.553) [-758.242] -- 0:00:13
799000 -- [-758.580] (-758.501) (-762.926) (-760.683) * (-762.313) (-759.861) (-759.327) [-759.555] -- 0:00:13
799500 -- (-762.217) [-759.192] (-762.564) (-760.612) * (-763.506) (-758.716) (-760.145) [-758.575] -- 0:00:13
800000 -- (-759.655) (-759.701) [-761.274] (-760.391) * (-764.437) (-764.045) (-763.232) [-758.410] -- 0:00:13
Average standard deviation of split frequencies: 0.005534
800500 -- (-760.784) (-760.475) (-762.453) [-758.518] * [-761.887] (-760.287) (-762.271) (-763.994) -- 0:00:13
801000 -- (-760.379) (-760.463) [-761.302] (-760.887) * (-760.795) (-761.656) (-761.893) [-760.325] -- 0:00:13
801500 -- [-761.615] (-766.138) (-761.252) (-760.666) * (-760.115) (-763.059) (-762.447) [-758.773] -- 0:00:13
802000 -- [-759.717] (-760.876) (-759.173) (-758.699) * (-760.838) (-760.004) (-763.646) [-759.897] -- 0:00:13
802500 -- (-761.318) (-760.595) [-759.686] (-764.856) * (-760.343) [-760.275] (-759.929) (-759.739) -- 0:00:13
803000 -- (-758.230) (-759.388) (-760.250) [-758.655] * (-764.170) (-760.788) [-757.489] (-760.690) -- 0:00:13
803500 -- (-759.718) (-760.770) (-758.075) [-759.312] * (-762.986) [-760.395] (-761.674) (-760.469) -- 0:00:13
804000 -- (-762.547) (-762.680) [-761.163] (-759.887) * (-761.853) (-759.884) (-763.354) [-762.965] -- 0:00:13
804500 -- (-757.882) [-759.841] (-759.552) (-759.785) * (-760.612) (-759.654) [-762.139] (-763.763) -- 0:00:13
805000 -- (-760.789) (-757.860) (-760.622) [-758.544] * (-758.029) [-762.498] (-760.208) (-760.351) -- 0:00:13
Average standard deviation of split frequencies: 0.005459
805500 -- (-758.101) (-760.666) [-765.512] (-759.281) * (-760.683) (-760.241) (-760.562) [-759.579] -- 0:00:13
806000 -- (-760.273) [-758.460] (-762.139) (-759.603) * (-760.349) (-759.477) [-760.663] (-761.273) -- 0:00:12
806500 -- (-759.896) [-757.852] (-759.665) (-759.102) * (-758.857) (-759.882) (-758.963) [-758.832] -- 0:00:12
807000 -- [-759.046] (-761.217) (-762.795) (-762.415) * (-759.079) (-760.014) [-758.936] (-761.712) -- 0:00:12
807500 -- [-759.828] (-759.922) (-760.713) (-763.536) * [-759.657] (-760.538) (-764.287) (-760.506) -- 0:00:12
808000 -- (-758.964) [-760.165] (-766.015) (-762.914) * (-759.627) (-760.053) (-759.013) [-760.443] -- 0:00:12
808500 -- (-759.224) (-758.903) (-760.322) [-761.098] * (-762.411) (-762.567) [-762.027] (-761.001) -- 0:00:12
809000 -- (-759.315) (-759.861) (-760.806) [-761.466] * (-760.091) (-761.294) [-763.581] (-760.270) -- 0:00:12
809500 -- (-759.028) (-760.866) [-762.445] (-757.933) * (-762.548) [-762.610] (-761.354) (-764.727) -- 0:00:12
810000 -- (-758.768) (-760.831) (-762.574) [-763.705] * [-760.027] (-763.899) (-759.705) (-759.933) -- 0:00:12
Average standard deviation of split frequencies: 0.005931
810500 -- (-762.983) (-761.574) (-765.441) [-759.676] * (-757.979) (-761.100) [-760.290] (-758.920) -- 0:00:12
811000 -- (-759.566) [-763.885] (-760.860) (-763.670) * (-758.857) [-759.587] (-762.769) (-758.744) -- 0:00:12
811500 -- [-758.126] (-762.437) (-760.154) (-763.329) * (-759.919) (-761.176) (-760.159) [-758.241] -- 0:00:12
812000 -- (-761.211) (-759.638) [-764.018] (-762.056) * (-762.856) (-758.703) [-758.026] (-760.760) -- 0:00:12
812500 -- [-760.941] (-761.395) (-759.212) (-762.547) * (-759.041) [-758.258] (-761.104) (-761.433) -- 0:00:12
813000 -- (-758.258) (-761.619) (-761.413) [-760.211] * (-760.866) (-760.948) [-761.948] (-761.368) -- 0:00:12
813500 -- (-760.264) [-761.656] (-761.842) (-757.885) * (-757.355) [-757.647] (-757.856) (-760.879) -- 0:00:12
814000 -- (-761.314) (-761.435) [-760.787] (-757.873) * (-761.193) (-759.421) [-759.544] (-758.878) -- 0:00:12
814500 -- (-762.079) (-760.358) (-765.315) [-760.576] * (-761.816) [-759.796] (-760.919) (-759.200) -- 0:00:12
815000 -- (-758.747) (-762.621) [-762.152] (-761.468) * (-759.867) (-765.043) (-757.004) [-763.049] -- 0:00:12
Average standard deviation of split frequencies: 0.006201
815500 -- [-757.839] (-761.179) (-771.136) (-760.235) * (-761.766) (-760.331) (-761.173) [-759.896] -- 0:00:12
816000 -- [-760.261] (-761.925) (-761.522) (-760.821) * [-759.078] (-760.605) (-758.481) (-758.098) -- 0:00:12
816500 -- (-761.400) (-758.535) (-764.688) [-757.695] * (-758.987) (-759.901) [-758.986] (-761.252) -- 0:00:12
817000 -- (-758.547) [-759.704] (-758.093) (-760.259) * (-758.937) [-761.205] (-759.585) (-764.561) -- 0:00:12
817500 -- [-758.006] (-759.814) (-759.511) (-759.784) * [-761.686] (-763.729) (-765.240) (-763.521) -- 0:00:12
818000 -- (-760.824) (-760.277) [-760.572] (-769.131) * (-761.975) (-764.104) [-760.270] (-761.233) -- 0:00:12
818500 -- [-759.021] (-761.960) (-761.557) (-764.832) * (-761.460) (-763.751) [-759.077] (-762.238) -- 0:00:12
819000 -- [-758.881] (-764.700) (-761.222) (-761.213) * [-759.849] (-760.926) (-759.322) (-761.068) -- 0:00:12
819500 -- [-758.512] (-765.520) (-761.492) (-760.147) * [-760.699] (-767.454) (-761.894) (-762.385) -- 0:00:12
820000 -- [-758.641] (-762.148) (-759.294) (-759.847) * [-758.844] (-763.499) (-760.135) (-761.397) -- 0:00:12
Average standard deviation of split frequencies: 0.005706
820500 -- [-758.410] (-761.209) (-760.423) (-761.096) * [-759.338] (-761.692) (-765.711) (-766.570) -- 0:00:12
821000 -- (-760.067) [-762.661] (-761.082) (-761.138) * [-760.432] (-764.937) (-761.699) (-760.182) -- 0:00:11
821500 -- (-761.461) (-763.860) [-762.031] (-763.799) * (-759.620) [-764.523] (-761.935) (-759.617) -- 0:00:11
822000 -- [-759.989] (-757.884) (-763.238) (-759.921) * (-761.714) [-765.485] (-762.602) (-758.922) -- 0:00:11
822500 -- (-761.392) [-759.380] (-760.194) (-762.153) * (-761.484) (-762.158) [-762.511] (-760.879) -- 0:00:11
823000 -- (-761.485) (-759.756) (-757.707) [-760.906] * (-758.815) [-760.520] (-760.720) (-759.356) -- 0:00:11
823500 -- [-760.597] (-760.786) (-765.084) (-761.052) * (-769.767) [-760.194] (-759.203) (-759.348) -- 0:00:11
824000 -- (-759.757) (-761.570) [-764.744] (-763.257) * (-764.630) (-760.808) (-759.199) [-760.221] -- 0:00:11
824500 -- (-761.779) (-760.355) (-762.889) [-757.489] * (-758.880) (-763.482) (-759.588) [-761.544] -- 0:00:11
825000 -- [-758.920] (-762.110) (-761.254) (-762.417) * (-763.446) [-761.718] (-759.899) (-762.878) -- 0:00:11
Average standard deviation of split frequencies: 0.005365
825500 -- (-761.399) (-758.528) (-762.552) [-761.314] * (-760.678) [-761.853] (-759.193) (-761.274) -- 0:00:11
826000 -- (-759.700) (-763.060) (-763.564) [-760.496] * [-760.115] (-759.786) (-761.283) (-761.557) -- 0:00:11
826500 -- [-756.769] (-760.793) (-766.040) (-763.789) * (-760.758) (-760.517) (-761.568) [-762.666] -- 0:00:11
827000 -- [-759.498] (-760.061) (-758.540) (-763.686) * (-760.178) (-762.097) [-760.643] (-764.323) -- 0:00:11
827500 -- (-763.109) (-760.166) [-759.516] (-763.754) * [-760.856] (-766.911) (-757.690) (-762.867) -- 0:00:11
828000 -- (-761.552) (-763.225) [-761.928] (-759.296) * (-761.072) (-761.719) [-760.343] (-759.987) -- 0:00:11
828500 -- [-761.258] (-760.475) (-763.157) (-760.300) * (-758.671) (-760.223) [-760.479] (-759.417) -- 0:00:11
829000 -- [-762.023] (-759.524) (-760.753) (-758.514) * [-758.633] (-759.884) (-761.829) (-761.764) -- 0:00:11
829500 -- [-762.553] (-759.897) (-759.886) (-759.061) * (-759.714) (-761.273) [-760.641] (-759.137) -- 0:00:11
830000 -- (-761.602) (-768.062) (-764.577) [-759.144] * (-759.938) (-762.695) [-758.888] (-766.411) -- 0:00:11
Average standard deviation of split frequencies: 0.005448
830500 -- (-759.256) [-760.170] (-760.030) (-760.596) * (-760.219) [-761.551] (-762.658) (-760.783) -- 0:00:11
831000 -- [-759.011] (-761.896) (-760.902) (-758.696) * (-758.793) (-762.437) [-759.598] (-760.328) -- 0:00:11
831500 -- (-761.845) [-760.656] (-761.871) (-763.752) * [-760.243] (-761.052) (-761.703) (-765.985) -- 0:00:11
832000 -- (-760.964) (-761.047) (-761.151) [-760.722] * (-762.112) [-762.835] (-761.047) (-764.153) -- 0:00:11
832500 -- [-760.444] (-760.601) (-767.689) (-759.401) * (-761.419) (-761.667) (-759.915) [-765.018] -- 0:00:11
833000 -- (-759.996) [-762.173] (-761.281) (-760.185) * (-761.803) (-761.569) (-761.654) [-761.328] -- 0:00:11
833500 -- (-761.464) (-761.313) (-759.513) [-759.799] * (-760.176) (-760.106) [-758.376] (-758.592) -- 0:00:11
834000 -- (-762.084) (-760.020) [-759.775] (-760.678) * (-761.959) (-761.261) [-757.906] (-763.408) -- 0:00:11
834500 -- (-761.591) (-758.943) (-764.469) [-766.296] * (-760.527) [-761.813] (-761.429) (-760.003) -- 0:00:11
835000 -- (-767.005) [-760.478] (-765.130) (-764.481) * [-759.303] (-762.284) (-761.831) (-758.738) -- 0:00:11
Average standard deviation of split frequencies: 0.006090
835500 -- [-758.642] (-760.272) (-761.061) (-760.873) * (-757.701) (-762.185) (-757.837) [-760.318] -- 0:00:11
836000 -- (-760.427) (-763.224) (-761.216) [-761.518] * (-761.687) [-759.774] (-759.176) (-760.824) -- 0:00:10
836500 -- (-758.052) [-761.715] (-760.256) (-760.863) * [-761.954] (-761.333) (-760.091) (-765.230) -- 0:00:10
837000 -- [-760.675] (-759.340) (-758.612) (-761.243) * [-760.773] (-761.269) (-759.951) (-761.136) -- 0:00:10
837500 -- (-761.886) [-760.206] (-760.333) (-761.133) * (-760.821) (-759.775) [-759.793] (-762.366) -- 0:00:10
838000 -- (-761.789) (-759.655) (-765.131) [-758.920] * [-760.892] (-760.784) (-759.750) (-759.838) -- 0:00:10
838500 -- (-761.679) [-759.109] (-764.193) (-759.087) * (-760.989) [-762.663] (-759.639) (-762.693) -- 0:00:10
839000 -- (-766.025) [-759.452] (-759.600) (-758.342) * [-759.811] (-760.297) (-758.992) (-759.517) -- 0:00:10
839500 -- [-761.889] (-762.408) (-759.640) (-760.025) * (-762.066) (-759.831) [-757.781] (-758.944) -- 0:00:10
840000 -- (-762.226) (-762.928) (-763.853) [-761.450] * [-758.386] (-761.267) (-762.471) (-763.522) -- 0:00:10
Average standard deviation of split frequencies: 0.005869
840500 -- (-759.727) [-759.555] (-762.028) (-761.465) * (-763.900) (-766.454) [-759.965] (-763.383) -- 0:00:10
841000 -- (-761.499) (-762.438) (-762.825) [-760.459] * (-761.148) (-766.056) (-759.801) [-760.637] -- 0:00:10
841500 -- (-761.652) (-759.887) (-763.465) [-762.600] * (-761.026) (-762.728) (-759.352) [-758.950] -- 0:00:10
842000 -- (-761.866) (-763.046) (-759.719) [-765.657] * (-759.955) (-762.852) [-757.364] (-760.479) -- 0:00:10
842500 -- [-760.142] (-760.960) (-758.580) (-765.543) * (-759.816) (-763.233) [-759.708] (-760.770) -- 0:00:10
843000 -- (-760.233) (-763.677) [-759.273] (-761.809) * (-760.565) [-761.810] (-763.294) (-761.501) -- 0:00:10
843500 -- (-760.560) (-760.298) (-762.752) [-759.161] * (-761.225) (-762.067) [-759.876] (-761.959) -- 0:00:10
844000 -- [-760.308] (-762.598) (-757.166) (-759.237) * [-760.606] (-762.967) (-762.214) (-762.835) -- 0:00:10
844500 -- (-760.160) (-760.563) (-759.024) [-758.799] * [-758.227] (-762.673) (-760.615) (-761.847) -- 0:00:10
845000 -- (-759.543) [-763.589] (-760.426) (-762.723) * [-759.142] (-762.671) (-758.277) (-759.119) -- 0:00:10
Average standard deviation of split frequencies: 0.005758
845500 -- [-759.485] (-762.545) (-761.491) (-759.565) * [-758.199] (-766.691) (-762.176) (-758.217) -- 0:00:10
846000 -- [-757.365] (-762.308) (-759.821) (-759.721) * (-761.221) (-760.844) (-758.530) [-758.252] -- 0:00:10
846500 -- [-759.661] (-762.154) (-761.473) (-760.454) * [-758.403] (-759.708) (-763.793) (-760.486) -- 0:00:10
847000 -- (-759.703) (-760.903) [-761.168] (-763.638) * (-758.931) (-760.948) [-760.955] (-762.681) -- 0:00:10
847500 -- (-759.451) (-763.301) (-760.101) [-761.625] * (-758.512) (-760.494) (-759.352) [-765.063] -- 0:00:10
848000 -- (-761.418) [-761.588] (-758.962) (-764.908) * [-757.618] (-760.628) (-757.385) (-764.194) -- 0:00:10
848500 -- (-763.337) (-759.782) (-760.254) [-762.600] * (-760.701) (-761.304) [-760.771] (-759.043) -- 0:00:10
849000 -- (-763.466) (-759.119) (-760.989) [-761.509] * (-759.453) [-762.512] (-761.743) (-759.713) -- 0:00:10
849500 -- (-760.108) [-760.143] (-765.816) (-759.200) * (-759.141) (-759.691) [-760.719] (-758.551) -- 0:00:10
850000 -- (-759.752) (-759.604) (-765.007) [-759.568] * (-760.526) (-759.992) [-759.381] (-758.971) -- 0:00:10
Average standard deviation of split frequencies: 0.005874
850500 -- [-758.496] (-760.558) (-761.687) (-758.782) * (-763.484) (-761.882) [-759.254] (-760.204) -- 0:00:10
851000 -- (-763.628) (-760.642) [-758.894] (-761.901) * (-758.600) (-759.772) (-758.735) [-759.166] -- 0:00:09
851500 -- [-757.522] (-759.973) (-763.204) (-759.370) * (-761.644) (-760.400) (-760.174) [-760.302] -- 0:00:09
852000 -- (-757.726) (-762.409) [-764.930] (-762.421) * [-764.512] (-760.877) (-759.664) (-759.724) -- 0:00:09
852500 -- (-760.855) (-760.507) [-765.153] (-760.293) * (-769.133) [-761.067] (-759.232) (-763.692) -- 0:00:09
853000 -- (-759.233) (-761.542) (-762.993) [-759.276] * [-761.747] (-760.038) (-758.909) (-760.230) -- 0:00:09
853500 -- (-762.333) [-761.403] (-761.005) (-760.746) * (-763.357) (-761.239) (-761.432) [-760.700] -- 0:00:09
854000 -- [-765.000] (-770.374) (-760.836) (-760.747) * (-762.452) [-759.843] (-756.576) (-760.473) -- 0:00:09
854500 -- (-760.758) (-763.871) (-762.385) [-761.016] * (-760.308) (-760.504) [-760.373] (-762.425) -- 0:00:09
855000 -- (-766.515) (-759.703) [-759.477] (-759.118) * (-757.660) [-761.249] (-761.579) (-759.201) -- 0:00:09
Average standard deviation of split frequencies: 0.005654
855500 -- (-760.580) (-760.418) (-762.332) [-759.806] * (-758.092) [-758.979] (-761.059) (-757.709) -- 0:00:09
856000 -- (-762.098) [-760.046] (-760.362) (-758.273) * (-758.001) [-759.966] (-759.417) (-763.998) -- 0:00:09
856500 -- [-761.103] (-761.684) (-762.420) (-759.952) * (-764.065) (-758.760) (-758.964) [-761.963] -- 0:00:09
857000 -- (-760.493) (-764.386) (-762.452) [-758.318] * (-760.590) (-758.738) [-759.167] (-762.553) -- 0:00:09
857500 -- (-760.924) (-761.608) (-761.720) [-759.975] * (-760.830) [-759.350] (-758.183) (-762.110) -- 0:00:09
858000 -- (-761.392) (-762.813) (-762.644) [-762.415] * (-763.874) [-758.776] (-761.235) (-762.378) -- 0:00:09
858500 -- [-763.427] (-763.889) (-762.139) (-762.064) * [-763.682] (-757.743) (-760.162) (-761.149) -- 0:00:09
859000 -- (-762.251) (-761.675) (-758.440) [-761.806] * (-765.531) [-761.855] (-760.104) (-759.922) -- 0:00:09
859500 -- (-759.167) (-759.753) [-759.852] (-761.486) * (-760.034) [-760.479] (-759.218) (-758.413) -- 0:00:09
860000 -- [-758.534] (-765.167) (-764.482) (-760.017) * [-758.899] (-762.135) (-761.810) (-761.699) -- 0:00:09
Average standard deviation of split frequencies: 0.005733
860500 -- (-761.209) (-760.282) [-760.076] (-760.924) * (-759.570) [-759.213] (-762.109) (-765.695) -- 0:00:09
861000 -- [-759.583] (-759.551) (-767.635) (-760.367) * [-758.124] (-757.850) (-759.267) (-758.586) -- 0:00:09
861500 -- (-760.401) (-757.498) [-763.413] (-761.268) * (-762.114) (-760.369) [-759.703] (-759.791) -- 0:00:09
862000 -- (-759.510) (-759.486) [-761.819] (-761.412) * (-758.821) (-762.990) [-760.256] (-763.707) -- 0:00:09
862500 -- (-760.523) [-758.212] (-759.568) (-760.331) * (-758.736) [-759.149] (-763.556) (-759.447) -- 0:00:09
863000 -- (-760.249) (-760.761) [-760.138] (-759.781) * (-761.959) [-758.771] (-760.650) (-761.629) -- 0:00:09
863500 -- (-758.051) (-763.233) (-760.429) [-763.357] * [-763.585] (-761.848) (-760.822) (-761.158) -- 0:00:09
864000 -- [-758.901] (-762.175) (-761.208) (-770.324) * (-762.225) (-760.151) (-760.628) [-758.088] -- 0:00:09
864500 -- [-758.463] (-762.158) (-758.121) (-761.740) * (-759.192) (-758.414) (-758.196) [-758.984] -- 0:00:09
865000 -- (-758.601) [-762.349] (-758.683) (-761.513) * (-759.620) [-760.596] (-760.286) (-759.754) -- 0:00:09
Average standard deviation of split frequencies: 0.005625
865500 -- (-760.098) (-762.678) (-759.534) [-762.221] * (-758.488) [-761.581] (-761.080) (-760.918) -- 0:00:09
866000 -- (-761.911) (-764.186) [-766.085] (-763.197) * [-760.848] (-762.739) (-758.682) (-763.280) -- 0:00:08
866500 -- (-760.880) (-765.360) (-758.354) [-761.567] * (-759.204) (-762.588) (-759.430) [-759.714] -- 0:00:08
867000 -- [-760.404] (-762.284) (-758.736) (-764.048) * (-762.086) (-760.080) (-759.537) [-758.794] -- 0:00:08
867500 -- (-759.409) [-765.267] (-758.962) (-761.084) * [-756.915] (-763.740) (-757.840) (-761.475) -- 0:00:08
868000 -- (-760.461) [-759.171] (-763.304) (-761.137) * (-757.263) [-757.793] (-761.333) (-764.082) -- 0:00:08
868500 -- (-762.741) [-759.885] (-761.388) (-760.547) * [-760.337] (-759.261) (-759.078) (-760.450) -- 0:00:08
869000 -- (-758.483) (-762.753) [-758.473] (-761.040) * (-764.481) [-761.027] (-761.836) (-759.033) -- 0:00:08
869500 -- (-759.371) (-761.779) [-759.469] (-760.215) * (-759.463) [-761.187] (-760.236) (-759.321) -- 0:00:08
870000 -- (-759.677) (-759.082) [-760.922] (-760.407) * [-758.931] (-762.138) (-760.330) (-758.616) -- 0:00:08
Average standard deviation of split frequencies: 0.005342
870500 -- (-760.048) [-757.627] (-757.850) (-759.631) * (-761.308) (-760.569) [-759.904] (-759.913) -- 0:00:08
871000 -- [-758.615] (-758.916) (-758.492) (-758.589) * (-760.327) [-761.174] (-759.567) (-761.958) -- 0:00:08
871500 -- (-761.091) (-764.860) (-760.083) [-758.905] * (-760.482) [-757.580] (-760.425) (-761.634) -- 0:00:08
872000 -- (-759.972) (-762.776) (-758.913) [-759.612] * [-759.557] (-759.822) (-761.063) (-758.797) -- 0:00:08
872500 -- [-762.968] (-761.512) (-763.390) (-759.891) * (-761.044) [-758.821] (-759.658) (-758.945) -- 0:00:08
873000 -- (-760.211) [-757.733] (-760.974) (-759.573) * (-762.637) [-758.167] (-761.509) (-758.160) -- 0:00:08
873500 -- [-761.177] (-758.397) (-762.028) (-759.806) * (-761.188) (-759.151) [-758.991] (-760.022) -- 0:00:08
874000 -- (-760.822) (-758.365) (-760.569) [-760.632] * [-760.413] (-758.173) (-757.670) (-761.582) -- 0:00:08
874500 -- [-761.200] (-758.535) (-759.023) (-759.615) * (-757.931) (-760.501) (-758.641) [-759.685] -- 0:00:08
875000 -- (-766.881) [-758.720] (-757.611) (-761.137) * [-758.872] (-761.504) (-760.437) (-765.276) -- 0:00:08
Average standard deviation of split frequencies: 0.005238
875500 -- (-759.535) (-763.777) [-760.989] (-764.717) * (-760.345) [-759.965] (-760.050) (-760.873) -- 0:00:08
876000 -- (-761.465) (-761.172) (-763.606) [-758.848] * (-757.817) (-761.298) [-760.400] (-760.435) -- 0:00:08
876500 -- [-759.638] (-761.801) (-758.870) (-762.082) * (-759.528) [-762.786] (-761.191) (-761.641) -- 0:00:08
877000 -- (-759.169) [-766.422] (-762.731) (-756.863) * (-764.717) (-761.554) (-758.966) [-758.966] -- 0:00:08
877500 -- (-764.749) (-759.081) (-759.400) [-761.902] * (-762.593) (-758.302) (-762.615) [-760.418] -- 0:00:08
878000 -- (-763.180) (-760.950) (-761.219) [-759.497] * (-764.202) (-757.905) [-759.958] (-760.709) -- 0:00:08
878500 -- (-760.397) [-759.187] (-765.574) (-759.477) * (-762.490) (-760.424) (-760.016) [-760.767] -- 0:00:08
879000 -- (-759.055) (-761.026) (-759.029) [-760.694] * (-760.830) (-758.414) (-761.313) [-757.691] -- 0:00:08
879500 -- (-763.871) (-760.200) [-760.270] (-758.501) * (-766.894) (-760.370) (-761.350) [-758.370] -- 0:00:08
880000 -- (-760.777) (-763.732) (-760.269) [-759.282] * (-765.555) (-761.481) [-759.935] (-760.387) -- 0:00:08
Average standard deviation of split frequencies: 0.005246
880500 -- (-761.035) (-760.656) [-761.965] (-758.120) * (-760.839) (-766.360) (-761.743) [-758.982] -- 0:00:08
881000 -- (-760.615) [-760.945] (-762.422) (-761.335) * [-761.325] (-761.358) (-760.949) (-758.765) -- 0:00:07
881500 -- (-759.999) (-759.906) (-759.919) [-757.945] * (-761.253) (-763.230) [-763.126] (-763.682) -- 0:00:07
882000 -- [-757.259] (-760.165) (-760.617) (-759.264) * (-762.200) [-757.961] (-759.301) (-760.812) -- 0:00:07
882500 -- (-761.808) (-761.114) [-761.887] (-757.538) * [-765.279] (-759.403) (-760.848) (-759.713) -- 0:00:07
883000 -- (-761.780) (-760.923) (-766.084) [-757.781] * [-763.241] (-766.048) (-758.544) (-757.624) -- 0:00:07
883500 -- (-758.886) (-760.289) [-760.272] (-762.541) * (-760.689) (-759.534) (-760.029) [-759.944] -- 0:00:07
884000 -- (-760.982) (-758.666) (-758.584) [-758.976] * (-761.806) [-759.005] (-760.098) (-760.062) -- 0:00:07
884500 -- [-758.152] (-761.284) (-761.915) (-760.948) * (-759.395) (-760.164) (-762.378) [-760.068] -- 0:00:07
885000 -- [-760.312] (-759.956) (-760.511) (-757.814) * (-759.187) (-759.587) [-760.503] (-759.082) -- 0:00:07
Average standard deviation of split frequencies: 0.005427
885500 -- (-759.326) (-759.847) (-761.349) [-759.162] * (-767.864) [-759.601] (-760.528) (-758.350) -- 0:00:07
886000 -- (-763.089) (-760.162) [-759.053] (-759.201) * (-760.043) [-758.054] (-761.780) (-759.580) -- 0:00:07
886500 -- [-763.480] (-763.202) (-761.372) (-762.307) * (-759.788) [-758.049] (-764.218) (-761.325) -- 0:00:07
887000 -- (-765.609) (-760.207) [-760.865] (-760.265) * (-760.360) (-761.801) [-761.414] (-760.818) -- 0:00:07
887500 -- (-760.852) (-760.858) [-761.350] (-760.457) * (-760.573) (-761.141) [-758.507] (-760.906) -- 0:00:07
888000 -- [-760.666] (-759.421) (-757.769) (-761.927) * (-762.357) (-758.747) (-759.310) [-760.818] -- 0:00:07
888500 -- (-762.146) (-758.921) [-761.346] (-760.877) * (-761.265) [-760.833] (-761.810) (-762.130) -- 0:00:07
889000 -- (-761.534) (-759.068) (-758.611) [-760.809] * (-760.197) [-758.156] (-761.487) (-763.128) -- 0:00:07
889500 -- (-757.650) [-759.352] (-759.208) (-761.465) * (-761.448) (-756.113) [-759.466] (-763.900) -- 0:00:07
890000 -- (-759.613) (-759.693) [-763.366] (-760.783) * (-760.519) [-758.473] (-758.570) (-766.444) -- 0:00:07
Average standard deviation of split frequencies: 0.005434
890500 -- (-762.267) (-761.015) [-763.379] (-759.754) * [-764.363] (-759.487) (-758.877) (-757.583) -- 0:00:07
891000 -- (-762.771) (-760.993) (-762.163) [-760.856] * (-763.584) (-760.292) [-758.598] (-760.545) -- 0:00:07
891500 -- (-760.862) [-759.877] (-764.788) (-759.113) * (-763.071) (-765.517) [-759.651] (-760.173) -- 0:00:07
892000 -- [-760.548] (-759.290) (-759.874) (-761.633) * (-762.460) (-762.338) (-760.305) [-758.276] -- 0:00:07
892500 -- (-761.676) (-760.249) [-759.706] (-764.482) * (-760.981) (-760.751) [-758.348] (-760.654) -- 0:00:07
893000 -- (-764.762) [-759.174] (-759.988) (-761.420) * [-759.070] (-759.715) (-763.669) (-762.380) -- 0:00:07
893500 -- (-760.576) (-759.257) (-762.653) [-758.137] * (-762.115) [-760.761] (-758.791) (-762.162) -- 0:00:07
894000 -- (-764.280) [-759.047] (-761.946) (-763.980) * (-762.330) (-758.472) (-759.604) [-762.731] -- 0:00:07
894500 -- (-765.611) (-761.413) (-761.263) [-760.789] * (-759.892) [-758.761] (-761.061) (-761.719) -- 0:00:07
895000 -- (-761.347) [-767.008] (-759.973) (-760.930) * (-758.751) (-758.979) [-760.669] (-760.862) -- 0:00:07
Average standard deviation of split frequencies: 0.005016
895500 -- (-760.531) (-758.962) [-761.431] (-763.993) * [-760.405] (-763.760) (-760.271) (-759.475) -- 0:00:07
896000 -- (-759.071) (-761.127) (-759.768) [-766.581] * (-759.665) (-761.556) [-759.350] (-763.039) -- 0:00:06
896500 -- (-762.739) [-761.434] (-758.626) (-766.232) * (-758.297) [-758.635] (-758.196) (-758.298) -- 0:00:06
897000 -- (-764.955) [-759.705] (-758.999) (-760.713) * (-762.007) (-760.857) (-760.556) [-759.373] -- 0:00:06
897500 -- (-759.344) (-761.109) (-759.556) [-762.806] * (-760.102) [-759.951] (-763.297) (-759.828) -- 0:00:06
898000 -- [-758.848] (-761.163) (-761.849) (-759.813) * (-759.575) [-759.547] (-761.434) (-761.758) -- 0:00:06
898500 -- (-758.326) [-761.323] (-758.596) (-760.166) * [-757.319] (-759.294) (-761.566) (-761.618) -- 0:00:06
899000 -- [-758.453] (-759.400) (-760.075) (-759.266) * (-759.576) (-760.257) [-760.010] (-762.773) -- 0:00:06
899500 -- [-761.452] (-760.370) (-761.838) (-760.548) * (-760.861) [-762.396] (-760.965) (-759.862) -- 0:00:06
900000 -- (-760.060) (-760.814) [-763.010] (-761.701) * (-760.076) (-764.066) [-760.226] (-758.977) -- 0:00:06
Average standard deviation of split frequencies: 0.004536
900500 -- [-759.078] (-760.406) (-765.037) (-760.026) * (-762.599) (-763.982) (-760.324) [-761.484] -- 0:00:06
901000 -- (-760.014) [-758.514] (-761.001) (-760.034) * (-759.674) (-762.512) (-759.986) [-762.966] -- 0:00:06
901500 -- [-758.671] (-760.376) (-761.938) (-763.595) * (-758.741) (-760.702) (-761.537) [-761.007] -- 0:00:06
902000 -- (-761.735) (-760.331) [-758.786] (-758.993) * (-761.717) (-764.692) [-760.481] (-761.541) -- 0:00:06
902500 -- (-760.828) (-762.221) (-757.728) [-760.887] * (-759.467) (-759.742) [-760.360] (-761.079) -- 0:00:06
903000 -- [-758.755] (-761.219) (-762.151) (-763.453) * [-757.801] (-759.750) (-759.188) (-761.076) -- 0:00:06
903500 -- [-760.831] (-760.860) (-762.996) (-763.417) * (-761.051) (-759.960) (-759.830) [-759.970] -- 0:00:06
904000 -- [-758.443] (-760.335) (-759.350) (-760.880) * [-758.925] (-760.921) (-760.564) (-762.196) -- 0:00:06
904500 -- (-760.474) [-760.488] (-757.479) (-758.086) * (-760.858) (-761.153) [-760.438] (-760.418) -- 0:00:06
905000 -- [-760.387] (-761.632) (-760.835) (-759.956) * (-764.953) (-759.885) (-759.647) [-761.925] -- 0:00:06
Average standard deviation of split frequencies: 0.004752
905500 -- (-761.160) (-759.015) (-760.792) [-759.031] * (-766.620) (-762.224) [-760.838] (-760.608) -- 0:00:06
906000 -- (-762.309) (-759.005) (-766.929) [-761.882] * (-764.949) (-760.463) (-759.151) [-758.349] -- 0:00:06
906500 -- (-760.389) [-761.816] (-762.654) (-759.676) * [-765.165] (-759.588) (-761.644) (-758.124) -- 0:00:06
907000 -- (-760.049) (-760.254) [-759.792] (-757.590) * (-760.767) (-762.539) (-758.843) [-760.127] -- 0:00:06
907500 -- (-759.711) (-760.169) [-763.473] (-758.880) * [-761.495] (-761.979) (-760.232) (-760.214) -- 0:00:06
908000 -- (-761.893) (-761.687) [-758.967] (-763.709) * (-763.716) [-762.413] (-759.397) (-760.445) -- 0:00:06
908500 -- (-761.724) (-758.916) [-759.564] (-758.710) * (-761.190) (-761.010) (-763.495) [-761.569] -- 0:00:06
909000 -- [-760.734] (-760.113) (-758.429) (-758.978) * (-762.264) (-759.626) (-757.989) [-759.921] -- 0:00:06
909500 -- (-756.501) (-758.821) (-758.370) [-760.607] * (-762.028) [-759.936] (-763.553) (-763.593) -- 0:00:06
910000 -- (-756.798) (-761.381) (-758.695) [-762.604] * [-760.868] (-757.836) (-760.606) (-763.622) -- 0:00:06
Average standard deviation of split frequencies: 0.004693
910500 -- (-760.083) [-760.342] (-759.677) (-760.436) * (-760.225) [-761.426] (-758.162) (-762.923) -- 0:00:05
911000 -- (-761.313) (-761.894) [-759.494] (-758.307) * (-761.301) (-760.742) (-762.722) [-761.795] -- 0:00:05
911500 -- [-758.954] (-760.830) (-758.911) (-759.817) * (-763.794) (-763.506) (-758.388) [-761.330] -- 0:00:05
912000 -- (-759.031) (-758.727) (-759.903) [-758.979] * (-760.048) (-763.662) (-760.368) [-760.150] -- 0:00:05
912500 -- [-763.389] (-759.478) (-759.777) (-761.346) * [-761.413] (-763.775) (-761.689) (-759.032) -- 0:00:05
913000 -- [-757.936] (-760.478) (-762.931) (-759.853) * [-762.605] (-764.150) (-760.944) (-758.476) -- 0:00:05
913500 -- (-760.642) (-760.048) (-762.589) [-760.818] * [-759.548] (-762.389) (-763.589) (-761.874) -- 0:00:05
914000 -- (-758.401) (-758.761) [-758.078] (-768.090) * (-759.501) [-758.381] (-769.257) (-760.917) -- 0:00:05
914500 -- [-761.452] (-761.648) (-759.982) (-762.174) * (-761.511) (-760.732) (-765.120) [-763.786] -- 0:00:05
915000 -- [-764.150] (-759.382) (-760.065) (-763.430) * (-761.768) [-759.275] (-764.423) (-759.426) -- 0:00:05
Average standard deviation of split frequencies: 0.004494
915500 -- (-762.180) (-759.672) (-761.718) [-761.284] * [-760.935] (-759.213) (-765.791) (-763.899) -- 0:00:05
916000 -- (-761.878) (-759.981) (-760.804) [-762.085] * (-761.120) (-759.653) [-763.984] (-759.220) -- 0:00:05
916500 -- [-759.284] (-760.362) (-761.874) (-761.190) * (-760.983) (-760.684) [-759.956] (-759.610) -- 0:00:05
917000 -- (-763.583) (-760.928) (-757.200) [-759.219] * (-763.763) [-761.699] (-760.776) (-759.409) -- 0:00:05
917500 -- (-761.997) (-760.049) [-758.564] (-759.898) * (-760.999) [-759.650] (-760.647) (-758.202) -- 0:00:05
918000 -- (-763.740) (-760.889) (-760.911) [-760.023] * (-761.638) (-759.499) (-758.919) [-761.898] -- 0:00:05
918500 -- (-760.297) [-759.902] (-759.554) (-758.904) * (-759.981) (-760.848) (-760.320) [-759.442] -- 0:00:05
919000 -- (-761.011) [-758.360] (-760.151) (-759.131) * (-759.897) (-760.753) (-760.928) [-761.616] -- 0:00:05
919500 -- (-759.544) (-763.594) [-762.472] (-758.688) * (-760.764) [-760.152] (-762.486) (-763.496) -- 0:00:05
920000 -- (-758.870) [-763.182] (-770.104) (-759.341) * (-762.037) [-757.977] (-758.522) (-758.143) -- 0:00:05
Average standard deviation of split frequencies: 0.004506
920500 -- (-761.070) (-761.026) [-761.233] (-766.455) * (-762.122) (-760.005) [-760.846] (-764.214) -- 0:00:05
921000 -- (-760.936) (-762.613) (-762.935) [-756.846] * (-760.787) (-758.581) (-758.592) [-759.836] -- 0:00:05
921500 -- (-763.972) (-761.982) (-764.498) [-762.029] * (-761.526) (-759.523) (-758.218) [-762.225] -- 0:00:05
922000 -- (-766.646) [-761.638] (-760.775) (-758.780) * (-764.451) (-765.032) [-759.141] (-759.114) -- 0:00:05
922500 -- (-762.135) (-761.351) [-760.728] (-763.111) * (-761.746) (-761.534) (-760.720) [-759.231] -- 0:00:05
923000 -- (-761.418) (-760.564) (-761.969) [-757.626] * (-763.787) (-759.023) [-759.398] (-761.156) -- 0:00:05
923500 -- (-762.390) [-762.348] (-764.312) (-760.637) * (-758.896) (-761.709) (-759.574) [-759.063] -- 0:00:05
924000 -- (-762.744) (-759.798) (-762.806) [-757.662] * [-758.109] (-759.843) (-757.819) (-763.913) -- 0:00:05
924500 -- (-760.008) (-759.237) [-760.133] (-758.507) * (-760.632) [-759.947] (-761.566) (-759.362) -- 0:00:05
925000 -- [-760.043] (-760.155) (-765.719) (-761.197) * (-761.397) (-762.605) (-762.509) [-759.836] -- 0:00:05
Average standard deviation of split frequencies: 0.004616
925500 -- (-759.150) [-759.877] (-761.435) (-760.919) * (-759.959) [-760.066] (-762.967) (-759.730) -- 0:00:04
926000 -- (-761.960) (-760.638) (-761.590) [-759.817] * (-768.206) (-759.728) (-760.555) [-761.640] -- 0:00:04
926500 -- (-760.562) (-761.113) [-759.313] (-762.332) * (-764.095) (-759.083) [-760.957] (-761.232) -- 0:00:04
927000 -- (-759.623) [-759.451] (-759.627) (-762.427) * (-762.021) [-758.361] (-762.726) (-761.787) -- 0:00:04
927500 -- (-760.410) (-764.064) [-759.438] (-762.165) * (-758.035) (-759.700) [-761.096] (-764.201) -- 0:00:04
928000 -- (-758.846) (-761.614) [-759.653] (-762.456) * (-761.896) [-761.174] (-759.127) (-760.354) -- 0:00:04
928500 -- (-760.854) (-760.824) [-760.846] (-761.110) * (-765.091) [-760.654] (-759.533) (-759.172) -- 0:00:04
929000 -- (-763.078) (-759.443) [-760.188] (-759.280) * (-759.075) (-761.425) [-758.890] (-760.279) -- 0:00:04
929500 -- (-760.650) (-764.079) [-760.251] (-760.704) * (-760.678) (-762.601) (-757.421) [-760.297] -- 0:00:04
930000 -- (-758.208) [-759.384] (-761.312) (-761.050) * (-764.571) (-759.405) (-759.363) [-760.544] -- 0:00:04
Average standard deviation of split frequencies: 0.004694
930500 -- [-761.000] (-759.671) (-759.625) (-764.472) * (-760.039) (-763.199) [-757.781] (-761.816) -- 0:00:04
931000 -- (-761.146) (-759.109) (-766.542) [-760.255] * (-759.366) (-763.700) [-759.871] (-761.806) -- 0:00:04
931500 -- [-760.921] (-759.695) (-760.297) (-757.675) * (-761.381) (-763.982) (-759.000) [-757.294] -- 0:00:04
932000 -- (-765.439) [-759.829] (-761.931) (-760.312) * [-760.919] (-762.130) (-760.153) (-760.708) -- 0:00:04
932500 -- (-762.199) [-759.451] (-759.118) (-761.718) * (-759.948) [-760.293] (-758.772) (-760.409) -- 0:00:04
933000 -- (-763.327) [-762.287] (-757.230) (-762.070) * (-762.183) (-761.553) (-758.826) [-758.297] -- 0:00:04
933500 -- (-759.836) (-762.385) [-757.303] (-759.386) * (-763.409) [-764.444] (-758.604) (-760.147) -- 0:00:04
934000 -- (-760.180) (-759.926) [-761.644] (-762.391) * (-761.191) (-762.529) [-758.498] (-759.504) -- 0:00:04
934500 -- (-759.898) (-760.507) (-760.950) [-763.388] * (-760.966) (-760.158) (-761.858) [-759.117] -- 0:00:04
935000 -- (-759.259) [-758.960] (-759.567) (-758.835) * (-760.586) (-759.582) [-759.633] (-762.692) -- 0:00:04
Average standard deviation of split frequencies: 0.004701
935500 -- (-759.466) (-759.737) [-759.709] (-760.033) * [-762.594] (-758.737) (-760.129) (-763.516) -- 0:00:04
936000 -- (-760.886) (-759.183) [-758.934] (-760.557) * [-760.621] (-763.362) (-761.429) (-759.180) -- 0:00:04
936500 -- (-759.308) (-759.522) [-760.709] (-762.789) * [-758.671] (-759.798) (-761.091) (-759.613) -- 0:00:04
937000 -- (-760.891) (-760.488) [-760.499] (-763.484) * (-760.947) (-761.086) [-758.287] (-763.038) -- 0:00:04
937500 -- (-761.805) [-758.564] (-760.576) (-761.264) * (-766.758) (-760.318) (-759.278) [-760.684] -- 0:00:04
938000 -- [-759.783] (-758.181) (-761.398) (-760.685) * [-758.847] (-760.000) (-760.818) (-757.968) -- 0:00:04
938500 -- (-761.957) (-760.860) (-759.892) [-757.607] * [-760.490] (-760.676) (-758.571) (-760.728) -- 0:00:04
939000 -- (-760.502) [-757.329] (-766.844) (-757.823) * (-760.646) [-760.269] (-760.495) (-759.964) -- 0:00:04
939500 -- [-758.742] (-760.920) (-761.645) (-761.822) * (-764.573) (-759.782) [-759.318] (-759.648) -- 0:00:04
940000 -- [-761.204] (-759.691) (-762.097) (-759.611) * [-761.266] (-760.181) (-760.274) (-761.642) -- 0:00:04
Average standard deviation of split frequencies: 0.004744
940500 -- (-759.020) (-760.458) (-761.795) [-761.110] * (-761.640) [-759.484] (-761.777) (-759.487) -- 0:00:03
941000 -- (-764.740) (-759.294) (-764.066) [-759.336] * (-761.992) (-758.400) (-760.738) [-758.070] -- 0:00:03
941500 -- (-757.305) (-759.264) [-761.537] (-758.481) * (-760.506) (-762.947) (-759.696) [-761.009] -- 0:00:03
942000 -- [-758.518] (-758.471) (-758.988) (-760.339) * (-760.685) (-761.828) [-758.309] (-759.306) -- 0:00:03
942500 -- [-758.255] (-759.342) (-764.069) (-760.133) * (-760.111) [-759.263] (-762.842) (-759.081) -- 0:00:03
943000 -- [-758.750] (-758.068) (-761.004) (-761.360) * (-761.040) (-760.203) (-757.897) [-759.595] -- 0:00:03
943500 -- [-760.914] (-759.887) (-756.375) (-760.610) * (-763.114) (-761.377) [-760.688] (-760.363) -- 0:00:03
944000 -- (-768.714) (-761.261) [-759.171] (-763.147) * [-762.542] (-762.449) (-759.344) (-757.967) -- 0:00:03
944500 -- (-765.913) (-759.500) [-757.783] (-762.804) * (-760.342) (-761.432) [-758.220] (-762.184) -- 0:00:03
945000 -- (-761.652) [-759.651] (-760.024) (-759.600) * (-762.603) [-760.741] (-758.193) (-761.010) -- 0:00:03
Average standard deviation of split frequencies: 0.004618
945500 -- (-763.047) [-758.605] (-759.840) (-760.312) * (-761.079) (-759.244) (-762.045) [-760.996] -- 0:00:03
946000 -- (-758.353) [-758.609] (-758.574) (-757.978) * [-761.853] (-761.792) (-765.373) (-761.816) -- 0:00:03
946500 -- [-759.128] (-759.922) (-761.045) (-758.517) * (-762.254) (-758.669) [-760.562] (-759.720) -- 0:00:03
947000 -- (-762.104) (-761.335) (-759.930) [-759.651] * (-762.946) (-760.655) (-760.855) [-759.261] -- 0:00:03
947500 -- [-761.951] (-760.582) (-762.217) (-763.197) * (-767.295) (-762.600) (-758.815) [-759.275] -- 0:00:03
948000 -- (-760.954) [-760.519] (-758.096) (-762.845) * (-765.275) [-760.790] (-760.693) (-761.000) -- 0:00:03
948500 -- (-758.731) (-763.433) [-760.057] (-764.888) * (-761.300) (-761.393) (-759.606) [-761.340] -- 0:00:03
949000 -- (-759.106) (-760.989) [-759.407] (-761.018) * [-760.772] (-759.820) (-761.632) (-761.653) -- 0:00:03
949500 -- [-758.987] (-761.169) (-760.253) (-764.714) * [-760.404] (-759.199) (-759.628) (-760.341) -- 0:00:03
950000 -- (-760.195) (-765.900) (-758.124) [-760.546] * [-759.254] (-761.396) (-760.827) (-759.360) -- 0:00:03
Average standard deviation of split frequencies: 0.004959
950500 -- (-759.961) (-759.931) (-766.167) [-761.440] * (-760.273) [-763.215] (-759.377) (-763.424) -- 0:00:03
951000 -- [-764.494] (-760.273) (-758.586) (-763.114) * (-760.566) (-761.498) [-760.002] (-762.150) -- 0:00:03
951500 -- (-761.649) (-760.731) [-759.876] (-761.728) * (-760.204) (-758.987) (-758.542) [-760.870] -- 0:00:03
952000 -- (-761.901) (-760.114) (-759.030) [-763.852] * (-760.266) [-758.646] (-760.302) (-759.636) -- 0:00:03
952500 -- (-762.084) [-759.935] (-761.098) (-762.259) * (-760.219) (-761.944) [-759.193] (-760.231) -- 0:00:03
953000 -- (-768.278) (-762.068) [-760.579] (-762.285) * (-758.963) [-758.807] (-760.731) (-761.539) -- 0:00:03
953500 -- (-765.624) (-761.011) (-758.067) [-760.126] * (-760.077) (-760.733) (-765.226) [-763.127] -- 0:00:03
954000 -- [-762.608] (-758.177) (-760.314) (-759.668) * (-758.744) [-760.358] (-761.807) (-762.107) -- 0:00:03
954500 -- (-764.732) (-759.937) (-763.165) [-760.986] * [-760.080] (-760.276) (-764.650) (-764.901) -- 0:00:03
955000 -- [-760.031] (-761.526) (-762.370) (-759.012) * (-759.983) (-759.724) [-759.907] (-760.160) -- 0:00:03
Average standard deviation of split frequencies: 0.005095
955500 -- (-762.834) (-760.647) (-762.061) [-759.487] * (-760.359) (-760.229) (-758.417) [-760.182] -- 0:00:02
956000 -- [-761.266] (-759.658) (-764.050) (-760.194) * (-758.440) [-759.073] (-761.074) (-761.307) -- 0:00:02
956500 -- (-762.656) (-760.504) (-763.076) [-758.667] * (-759.565) (-760.041) [-760.114] (-760.686) -- 0:00:02
957000 -- (-761.576) (-761.107) [-759.097] (-759.673) * (-761.768) [-762.654] (-761.610) (-762.232) -- 0:00:02
957500 -- (-759.344) (-758.993) [-759.509] (-760.930) * [-759.994] (-760.805) (-760.377) (-761.438) -- 0:00:02
958000 -- (-764.053) (-758.933) (-758.828) [-759.857] * (-764.097) (-762.427) (-760.627) [-760.849] -- 0:00:02
958500 -- (-763.876) (-760.968) (-763.247) [-759.519] * [-762.190] (-763.800) (-760.657) (-759.397) -- 0:00:02
959000 -- (-763.400) [-762.015] (-759.802) (-761.058) * [-760.163] (-759.538) (-760.347) (-760.826) -- 0:00:02
959500 -- (-761.573) (-760.073) [-761.272] (-761.121) * [-759.394] (-756.868) (-759.557) (-760.787) -- 0:00:02
960000 -- (-759.877) (-765.277) [-760.213] (-763.445) * (-760.876) (-764.891) [-756.913] (-759.728) -- 0:00:02
Average standard deviation of split frequencies: 0.005038
960500 -- (-759.107) (-770.587) (-762.656) [-764.778] * (-759.572) (-761.363) (-761.063) [-759.802] -- 0:00:02
961000 -- (-760.336) (-761.274) (-761.566) [-761.151] * [-760.592] (-762.149) (-761.957) (-758.082) -- 0:00:02
961500 -- (-760.387) (-762.527) [-761.883] (-761.211) * (-760.337) [-763.762] (-759.075) (-761.417) -- 0:00:02
962000 -- (-760.403) [-759.737] (-760.792) (-760.862) * [-760.618] (-760.633) (-760.177) (-762.183) -- 0:00:02
962500 -- (-758.828) (-761.720) (-761.572) [-760.691] * [-759.660] (-760.397) (-758.123) (-760.606) -- 0:00:02
963000 -- (-761.284) (-760.582) [-758.545] (-762.834) * [-760.114] (-760.525) (-763.022) (-759.460) -- 0:00:02
963500 -- (-760.574) [-760.831] (-760.247) (-763.213) * (-760.586) (-759.589) (-758.264) [-760.033] -- 0:00:02
964000 -- (-759.978) (-761.745) (-763.457) [-765.890] * [-759.956] (-761.485) (-759.498) (-759.768) -- 0:00:02
964500 -- (-761.350) (-763.471) (-761.299) [-762.635] * (-769.154) (-759.333) [-759.300] (-759.496) -- 0:00:02
965000 -- [-762.891] (-760.336) (-760.227) (-762.453) * (-763.764) (-761.044) [-760.878] (-760.249) -- 0:00:02
Average standard deviation of split frequencies: 0.005173
965500 -- (-762.004) (-758.958) (-761.038) [-758.794] * [-762.077] (-759.545) (-761.878) (-760.145) -- 0:00:02
966000 -- (-757.942) [-758.443] (-762.912) (-763.653) * (-761.615) [-761.807] (-760.280) (-759.203) -- 0:00:02
966500 -- [-759.553] (-759.034) (-760.029) (-763.223) * (-761.317) [-762.641] (-764.687) (-760.147) -- 0:00:02
967000 -- (-760.780) (-763.785) [-758.383] (-761.370) * [-759.151] (-765.854) (-760.151) (-760.417) -- 0:00:02
967500 -- (-760.289) [-761.161] (-760.278) (-760.555) * [-764.197] (-759.875) (-760.591) (-761.282) -- 0:00:02
968000 -- (-759.692) (-759.987) (-761.014) [-761.963] * (-763.248) (-759.686) [-760.427] (-760.943) -- 0:00:02
968500 -- (-762.436) (-764.575) (-760.730) [-758.517] * (-759.940) (-760.054) (-761.704) [-758.629] -- 0:00:02
969000 -- (-763.043) (-763.551) (-766.656) [-758.357] * (-763.276) [-758.999] (-762.065) (-761.101) -- 0:00:02
969500 -- [-764.426] (-762.093) (-762.079) (-762.445) * (-765.809) (-763.106) (-764.576) [-761.469] -- 0:00:02
970000 -- (-759.885) [-760.687] (-766.372) (-764.343) * (-758.849) [-758.970] (-762.673) (-762.264) -- 0:00:02
Average standard deviation of split frequencies: 0.005245
970500 -- (-760.880) (-761.692) (-761.064) [-758.411] * (-766.958) [-758.068] (-764.298) (-759.885) -- 0:00:01
971000 -- [-759.358] (-761.408) (-761.590) (-759.579) * (-758.795) [-760.372] (-759.486) (-761.653) -- 0:00:01
971500 -- (-761.599) (-760.657) (-767.141) [-760.912] * (-761.570) [-759.034] (-760.747) (-758.048) -- 0:00:01
972000 -- [-760.657] (-761.590) (-758.345) (-761.581) * [-759.000] (-761.501) (-760.418) (-759.494) -- 0:00:01
972500 -- [-760.628] (-763.384) (-760.849) (-759.898) * (-760.768) [-760.022] (-760.728) (-764.445) -- 0:00:01
973000 -- (-767.384) [-759.794] (-759.691) (-762.315) * (-758.037) (-761.167) [-761.112] (-762.339) -- 0:00:01
973500 -- (-762.937) [-758.997] (-757.963) (-759.718) * [-757.564] (-759.741) (-759.691) (-761.205) -- 0:00:01
974000 -- [-760.708] (-759.385) (-758.827) (-761.341) * (-756.745) (-759.534) (-761.663) [-758.928] -- 0:00:01
974500 -- (-759.252) (-760.024) (-760.071) [-758.665] * (-758.815) (-760.704) [-759.684] (-762.193) -- 0:00:01
975000 -- (-760.260) (-760.035) [-760.074] (-759.216) * (-760.410) (-756.830) [-758.370] (-759.725) -- 0:00:01
Average standard deviation of split frequencies: 0.005152
975500 -- [-760.188] (-760.834) (-759.631) (-760.143) * (-758.364) [-758.313] (-760.660) (-760.007) -- 0:00:01
976000 -- (-760.213) [-759.931] (-760.409) (-760.326) * (-762.411) (-758.510) (-757.725) [-760.847] -- 0:00:01
976500 -- (-759.690) (-760.289) [-763.436] (-761.289) * (-765.235) [-763.549] (-757.270) (-762.283) -- 0:00:01
977000 -- (-759.259) [-760.834] (-760.114) (-759.294) * (-758.672) (-759.695) (-762.559) [-760.177] -- 0:00:01
977500 -- [-758.203] (-759.985) (-759.523) (-763.534) * (-761.791) (-759.965) (-758.822) [-761.179] -- 0:00:01
978000 -- (-761.829) (-759.849) (-758.937) [-761.925] * [-761.512] (-760.221) (-759.672) (-762.318) -- 0:00:01
978500 -- (-760.519) (-765.819) (-760.255) [-760.527] * (-759.667) (-764.504) [-758.707] (-758.892) -- 0:00:01
979000 -- (-757.969) (-762.564) (-760.919) [-758.760] * (-761.425) (-760.409) [-759.442] (-761.250) -- 0:00:01
979500 -- [-759.612] (-759.957) (-761.603) (-760.332) * [-757.189] (-763.616) (-761.200) (-761.472) -- 0:00:01
980000 -- (-758.745) (-761.541) (-758.909) [-759.820] * (-757.931) [-762.120] (-762.901) (-761.122) -- 0:00:01
Average standard deviation of split frequencies: 0.005640
980500 -- (-760.419) (-759.373) [-759.320] (-759.467) * (-760.556) (-760.528) [-765.095] (-760.418) -- 0:00:01
981000 -- [-760.547] (-759.011) (-760.558) (-765.793) * [-760.003] (-759.343) (-763.079) (-762.155) -- 0:00:01
981500 -- [-759.031] (-766.329) (-762.331) (-761.648) * (-758.334) (-762.637) (-758.997) [-759.040] -- 0:00:01
982000 -- (-761.333) (-763.969) [-760.966] (-761.790) * (-758.580) (-762.765) [-762.231] (-759.780) -- 0:00:01
982500 -- [-761.819] (-769.139) (-760.766) (-762.054) * [-759.331] (-761.545) (-759.344) (-760.379) -- 0:00:01
983000 -- (-762.494) (-762.902) (-761.320) [-760.605] * (-760.016) [-759.878] (-760.669) (-763.696) -- 0:00:01
983500 -- (-763.829) (-764.949) [-760.749] (-766.116) * [-759.584] (-758.956) (-761.060) (-759.806) -- 0:00:01
984000 -- [-762.383] (-761.504) (-760.421) (-763.713) * [-758.397] (-758.873) (-760.707) (-760.552) -- 0:00:01
984500 -- (-765.713) (-759.552) [-759.869] (-758.391) * (-760.645) (-763.178) (-759.960) [-761.444] -- 0:00:01
985000 -- [-760.727] (-762.165) (-761.260) (-758.288) * (-759.028) [-759.928] (-759.389) (-764.671) -- 0:00:01
Average standard deviation of split frequencies: 0.005801
985500 -- (-760.745) (-762.432) [-759.221] (-757.645) * (-758.530) [-763.220] (-761.600) (-763.401) -- 0:00:00
986000 -- (-760.953) [-760.612] (-762.048) (-761.360) * (-757.932) [-761.137] (-761.391) (-759.488) -- 0:00:00
986500 -- (-759.993) (-762.407) (-760.210) [-762.537] * (-758.454) [-760.698] (-761.463) (-759.530) -- 0:00:00
987000 -- [-758.702] (-770.579) (-762.365) (-760.342) * (-758.999) [-759.310] (-761.712) (-759.668) -- 0:00:00
987500 -- (-765.429) (-765.766) [-759.540] (-760.199) * (-764.678) (-759.553) [-760.424] (-758.627) -- 0:00:00
988000 -- (-764.619) (-762.039) [-759.306] (-759.980) * [-765.474] (-758.899) (-769.559) (-759.707) -- 0:00:00
988500 -- (-757.817) [-765.457] (-759.058) (-757.317) * (-765.463) [-760.074] (-762.017) (-761.559) -- 0:00:00
989000 -- (-758.891) [-761.091] (-761.873) (-760.833) * (-760.552) (-762.450) [-764.534] (-759.738) -- 0:00:00
989500 -- (-758.165) [-763.427] (-765.816) (-762.351) * [-761.147] (-759.469) (-765.211) (-762.016) -- 0:00:00
990000 -- (-761.409) (-761.780) [-760.791] (-761.965) * (-760.991) (-761.106) (-762.808) [-764.188] -- 0:00:00
Average standard deviation of split frequencies: 0.006059
990500 -- (-761.497) (-763.047) [-759.514] (-760.309) * (-760.889) (-759.099) [-764.629] (-761.635) -- 0:00:00
991000 -- (-758.254) (-761.928) [-759.759] (-760.173) * (-760.503) (-760.564) (-764.896) [-761.043] -- 0:00:00
991500 -- (-762.173) (-760.965) [-764.107] (-760.249) * (-760.317) (-760.959) (-762.861) [-761.849] -- 0:00:00
992000 -- (-759.309) (-765.031) (-758.720) [-757.750] * (-759.849) (-759.210) (-759.216) [-759.895] -- 0:00:00
992500 -- [-758.979] (-764.687) (-763.199) (-758.185) * (-760.185) (-760.134) (-759.230) [-758.714] -- 0:00:00
993000 -- (-757.752) (-761.388) (-763.126) [-760.794] * [-760.612] (-760.951) (-760.153) (-761.440) -- 0:00:00
993500 -- (-758.775) (-762.871) [-760.889] (-760.789) * (-759.609) (-759.591) (-759.109) [-758.821] -- 0:00:00
994000 -- (-760.952) [-764.717] (-760.189) (-761.091) * (-761.519) (-760.409) [-761.673] (-759.175) -- 0:00:00
994500 -- [-758.228] (-762.974) (-759.742) (-759.600) * (-762.049) (-760.504) [-760.529] (-763.750) -- 0:00:00
995000 -- (-760.493) (-761.554) [-760.498] (-757.971) * (-761.349) [-762.494] (-762.890) (-760.785) -- 0:00:00
Average standard deviation of split frequencies: 0.006027
995500 -- (-759.557) (-757.897) [-759.687] (-764.608) * [-759.608] (-762.585) (-762.469) (-759.908) -- 0:00:00
996000 -- (-758.345) [-760.352] (-762.416) (-762.644) * [-760.707] (-758.866) (-760.593) (-760.833) -- 0:00:00
996500 -- (-757.587) [-760.395] (-760.289) (-758.692) * (-762.884) [-758.644] (-764.094) (-758.430) -- 0:00:00
997000 -- (-756.803) [-758.833] (-758.186) (-758.963) * (-762.167) (-760.991) (-760.620) [-758.962] -- 0:00:00
997500 -- (-757.803) (-759.171) [-760.224] (-760.918) * (-760.471) (-760.705) (-759.284) [-758.073] -- 0:00:00
998000 -- (-758.234) (-762.745) [-762.415] (-758.010) * (-761.680) (-763.927) (-762.881) [-761.755] -- 0:00:00
998500 -- (-758.939) [-761.267] (-761.054) (-759.329) * (-760.433) (-759.583) [-758.653] (-758.853) -- 0:00:00
999000 -- (-758.501) (-765.511) (-758.763) [-760.427] * [-762.225] (-763.621) (-759.805) (-758.682) -- 0:00:00
999500 -- (-764.391) (-758.654) (-761.348) [-760.706] * [-762.170] (-761.875) (-761.735) (-765.115) -- 0:00:00
1000000 -- (-757.262) [-759.007] (-759.391) (-757.255) * (-759.553) (-760.171) (-759.540) [-759.087] -- 0:00:00
Average standard deviation of split frequencies: 0.006124
Analysis completed in 1 mins 7 seconds
Analysis used 66.14 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -755.34
Likelihood of best state for "cold" chain of run 2 was -755.34
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 66 %) Dirichlet(Revmat{all})
98.1 % ( 96 %) Slider(Revmat{all})
29.7 % ( 27 %) Dirichlet(Pi{all})
31.5 % ( 18 %) Slider(Pi{all})
67.6 % ( 42 %) Multiplier(Alpha{1,2})
79.5 % ( 61 %) Multiplier(Alpha{3})
26.1 % ( 31 %) Slider(Pinvar{all})
97.1 % (100 %) ExtSPR(Tau{all},V{all})
69.1 % ( 73 %) ExtTBR(Tau{all},V{all})
98.0 % ( 99 %) NNI(Tau{all},V{all})
87.7 % ( 94 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
95.0 % ( 96 %) Nodeslider(V{all})
30.5 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 76 %) Dirichlet(Revmat{all})
98.1 % ( 94 %) Slider(Revmat{all})
30.0 % ( 26 %) Dirichlet(Pi{all})
31.3 % ( 36 %) Slider(Pi{all})
68.0 % ( 48 %) Multiplier(Alpha{1,2})
79.3 % ( 64 %) Multiplier(Alpha{3})
27.1 % ( 24 %) Slider(Pinvar{all})
97.2 % ( 95 %) ExtSPR(Tau{all},V{all})
69.0 % ( 71 %) ExtTBR(Tau{all},V{all})
98.1 % (100 %) NNI(Tau{all},V{all})
87.8 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
95.0 % ( 98 %) Nodeslider(V{all})
30.7 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166569 0.82 0.66
3 | 167133 166327 0.83
4 | 166211 167355 166405
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166719 0.82 0.66
3 | 166656 166674 0.83
4 | 166499 166548 166904
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -759.41
| 1 |
| 2 2 |
| 2 2 1 1 |
|2 1 2 2 2 2 1 1 2 |
| 1 1 1 1 1 1 2 2 2 |
| 22 2 2 1 1 1 121 2 11 1 1 2 |
| 121 1 * 2 2 2 2 * * 1 2 |
| 11 2 2 2 1 1 22 2 2 2 |
|1 1 1 2 21 * 21* |
| 2 2 22 2 2 2 2 2 1121 1 |
| 21 1 1 * 21 1|
| 1 1 1 1 2 1 2 |
| 2 1 1 |
| 1 2|
| 1 2 11 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -761.23
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -759.31 -764.70
2 -759.24 -762.25
--------------------------------------
TOTAL -759.28 -764.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871156 0.088380 0.328458 1.439747 0.837733 1501.00 1501.00 1.000
r(A<->C){all} 0.149309 0.016849 0.000022 0.402140 0.114843 242.53 290.18 1.000
r(A<->G){all} 0.167178 0.020430 0.000006 0.449695 0.124687 284.45 293.45 1.001
r(A<->T){all} 0.150999 0.015644 0.000205 0.396451 0.120602 130.63 149.25 1.000
r(C<->G){all} 0.130760 0.014715 0.000016 0.378455 0.092014 173.78 263.62 1.003
r(C<->T){all} 0.222545 0.025538 0.000024 0.535819 0.195817 218.83 244.78 1.000
r(G<->T){all} 0.179210 0.021796 0.000068 0.468571 0.141471 194.53 195.52 1.000
pi(A){all} 0.175291 0.000261 0.145043 0.207123 0.174994 1272.69 1319.63 1.001
pi(C){all} 0.287616 0.000359 0.252462 0.326704 0.287634 1034.17 1254.96 1.000
pi(G){all} 0.338994 0.000395 0.303089 0.379160 0.339247 1233.42 1277.36 1.000
pi(T){all} 0.198100 0.000280 0.166785 0.231848 0.197840 1203.00 1280.94 1.000
alpha{1,2} 0.315244 0.140951 0.000160 1.004412 0.201657 797.93 1091.76 1.000
alpha{3} 0.404918 0.225307 0.000200 1.373809 0.240165 1286.92 1294.69 1.000
pinvar{all} 0.993789 0.000024 0.984459 0.999861 0.994988 1337.26 1373.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- .****.
9 -- .*.***
10 -- ..**..
11 -- .*..*.
12 -- ..*..*
13 -- ....**
14 -- ...**.
15 -- .*.*..
16 -- ..*.*.
17 -- ...*.*
18 -- ..****
19 -- .**.**
20 -- .***.*
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 448 0.149234 0.009422 0.142572 0.155896 2
8 448 0.149234 0.003769 0.146569 0.151899 2
9 447 0.148901 0.011777 0.140573 0.157229 2
10 441 0.146902 0.004240 0.143904 0.149900 2
11 439 0.146236 0.008009 0.140573 0.151899 2
12 433 0.144237 0.009893 0.137242 0.151233 2
13 432 0.143904 0.008480 0.137908 0.149900 2
14 429 0.142905 0.001413 0.141905 0.143904 2
15 427 0.142239 0.000471 0.141905 0.142572 2
16 427 0.142239 0.005182 0.138574 0.145903 2
17 426 0.141905 0.004711 0.138574 0.145237 2
18 419 0.139574 0.008009 0.133911 0.145237 2
19 412 0.137242 0.012248 0.128581 0.145903 2
20 408 0.135909 0.000942 0.135243 0.136576 2
21 407 0.135576 0.003298 0.133245 0.137908 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.087413 0.008741 0.000062 0.271311 0.058217 1.000 2
length{all}[2] 0.091810 0.009183 0.000009 0.285506 0.060908 1.000 2
length{all}[3] 0.091197 0.008931 0.000277 0.272899 0.060465 1.000 2
length{all}[4] 0.089732 0.008890 0.000010 0.275097 0.060295 1.000 2
length{all}[5] 0.088093 0.008202 0.000007 0.262694 0.058500 1.000 2
length{all}[6] 0.142526 0.014572 0.000088 0.379529 0.112080 1.000 2
length{all}[7] 0.103582 0.011190 0.000618 0.296408 0.071813 0.999 2
length{all}[8] 0.091471 0.010145 0.000110 0.293949 0.057999 0.998 2
length{all}[9] 0.091240 0.009897 0.000819 0.302629 0.058637 1.002 2
length{all}[10] 0.086200 0.007738 0.000222 0.278587 0.056692 0.998 2
length{all}[11] 0.097505 0.009895 0.000496 0.295097 0.070192 0.999 2
length{all}[12] 0.099040 0.010992 0.000007 0.313142 0.065145 0.998 2
length{all}[13] 0.097751 0.009166 0.000267 0.303981 0.070339 0.998 2
length{all}[14] 0.090422 0.009724 0.000118 0.269639 0.059951 1.004 2
length{all}[15] 0.100241 0.008783 0.000306 0.273805 0.075703 0.998 2
length{all}[16] 0.091287 0.009275 0.000182 0.309843 0.059852 1.002 2
length{all}[17] 0.093856 0.008499 0.000107 0.287723 0.068723 0.998 2
length{all}[18] 0.092517 0.009541 0.000103 0.272980 0.065564 0.998 2
length{all}[19] 0.090208 0.008864 0.000430 0.290066 0.057550 0.999 2
length{all}[20] 0.099429 0.011526 0.000167 0.314365 0.063153 0.998 2
length{all}[21] 0.087773 0.007926 0.000113 0.267435 0.057718 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006124
Maximum standard deviation of split frequencies = 0.012248
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------- C1 (1)
|
|--------------------------------------- C2 (2)
|
|--------------------------------------- C3 (3)
+
|--------------------------------------- C4 (4)
|
|-------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|-----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 552
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 184 / 184 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 184 / 184 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.017404 0.087390 0.076768 0.075031 0.038314 0.056586 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -795.232425
Iterating by ming2
Initial: fx= 795.232425
x= 0.01740 0.08739 0.07677 0.07503 0.03831 0.05659 0.30000 1.30000
1 h-m-p 0.0000 0.0001 434.9379 ++ 777.142499 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 6520.9947 ++ 760.875202 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0000 25643.1080 ++ 738.730883 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0000 178.2659 ++ 738.064802 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0000 8636.2060 ++ 735.961811 m 0.0000 57 | 5/8
6 h-m-p 0.0008 0.4171 2.8687 ++++YCCYCC 733.816564 5 0.3111 81 | 5/8
7 h-m-p 1.2079 8.0000 0.7390 CYC 733.740821 2 0.2153 96 | 5/8
8 h-m-p 0.3889 8.0000 0.4092 +++ 733.131819 m 8.0000 111 | 5/8
9 h-m-p 1.6000 8.0000 0.8472 CYCCC 732.954494 4 1.0835 132 | 5/8
10 h-m-p 1.2229 8.0000 0.7506 ++ 732.704892 m 8.0000 146 | 5/8
11 h-m-p 1.6000 8.0000 2.4329 ++ 732.530739 m 8.0000 160 | 5/8
12 h-m-p 1.6000 8.0000 3.8948 +CY 732.489508 1 6.4729 174 | 5/8
13 h-m-p 1.6000 8.0000 4.8914 YCCC 732.463625 3 3.3513 190 | 5/8
14 h-m-p 1.6000 8.0000 10.0962 +C 732.442260 0 6.4000 202 | 5/8
15 h-m-p 1.6000 8.0000 18.9292 CCC 732.432151 2 1.8810 217 | 5/8
16 h-m-p 1.5733 8.0000 22.6310 ++ 732.422485 m 8.0000 228 | 5/8
17 h-m-p 1.6000 8.0000 39.9238 CCC 732.418337 2 1.6790 243 | 5/8
18 h-m-p 1.3488 8.0000 49.6966 ++ 732.413967 m 8.0000 254 | 5/8
19 h-m-p 0.5351 2.6756 133.7704 +C 732.412588 0 2.0906 266 | 5/8
20 h-m-p 0.1060 0.5301 147.6048 ++ 732.412266 m 0.5301 277 | 6/8
21 h-m-p 0.1869 1.7032 221.2022 ++ 732.411918 m 1.7032 288 | 7/8
22 h-m-p 1.6000 8.0000 0.0001 YC 732.411807 1 1.0091 300 | 7/8
23 h-m-p 1.6000 8.0000 0.0000 +Y 732.411807 0 4.2902 313
Out..
lnL = -732.411807
314 lfun, 314 eigenQcodon, 1884 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.053257 0.098476 0.043294 0.066560 0.018268 0.091413 999.000000 0.640288 0.543908
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.023344
np = 9
lnL0 = -795.387765
Iterating by ming2
Initial: fx= 795.387765
x= 0.05326 0.09848 0.04329 0.06656 0.01827 0.09141 951.42857 0.64029 0.54391
1 h-m-p 0.0000 0.0001 424.8899 ++ 776.864618 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 302.5176 +YCYYCYYCCC 762.609225 9 0.0003 41 | 1/9
3 h-m-p 0.0005 0.0024 90.2529 ++ 748.048107 m 0.0024 53 | 2/9
4 h-m-p 0.0004 0.0019 174.4718 ++ 745.158331 m 0.0019 65 | 2/9
5 h-m-p -0.0000 -0.0000 20123.2091
h-m-p: -2.72071135e-22 -1.36035567e-21 2.01232091e+04 745.158331
.. | 2/9
6 h-m-p 0.0000 0.0001 308.8342 ++ 738.291300 m 0.0001 86 | 3/9
7 h-m-p 0.0000 0.0000 405441.0197 ++ 736.403844 m 0.0000 98 | 4/9
8 h-m-p 0.0000 0.0000 288.5528 ++ 736.130615 m 0.0000 110 | 4/9
9 h-m-p 0.0007 0.2677 2.2050 -----------.. | 4/9
10 h-m-p 0.0000 0.0001 186.2428 ++ 733.275653 m 0.0001 143 | 5/9
11 h-m-p 0.0031 0.4451 1.2754 ++++ 732.863153 m 0.4451 157 | 6/9
12 h-m-p 1.6000 8.0000 0.0226 CCC 732.857398 2 1.1778 173 | 6/9
13 h-m-p 1.6000 8.0000 0.0000 C 732.857398 0 1.8093 188 | 6/9
14 h-m-p 1.6000 8.0000 0.0000 --C 732.857398 0 0.0250 205
Out..
lnL = -732.857398
206 lfun, 618 eigenQcodon, 2472 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.068569 0.022229 0.047321 0.102423 0.059368 0.010977 951.428581 1.450400 0.350593 0.273627 1111.658672
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000201
np = 11
lnL0 = -755.205558
Iterating by ming2
Initial: fx= 755.205558
x= 0.06857 0.02223 0.04732 0.10242 0.05937 0.01098 951.42858 1.45040 0.35059 0.27363 951.42857
1 h-m-p 0.0000 0.0006 88.0511 +++ 751.550623 m 0.0006 17 | 1/11
2 h-m-p 0.0000 0.0001 459.4636 ++ 746.695101 m 0.0001 31 | 2/11
3 h-m-p 0.0031 0.0254 14.3729 ++ 741.093014 m 0.0254 45 | 3/11
4 h-m-p 0.0000 0.0002 1006.2304 ++ 739.805605 m 0.0002 59 | 4/11
5 h-m-p 0.0001 0.0003 50.2262 ++ 738.596349 m 0.0003 73 | 5/11
6 h-m-p 0.0001 0.0257 44.7120 ++++CYYCYYYYYC 732.400024 9 0.0241 103 | 5/11
7 h-m-p 1.6000 8.0000 0.0012 --C 732.400024 0 0.0360 119 | 5/11
8 h-m-p 0.0370 8.0000 0.0012 ----C 732.400024 0 0.0000 143 | 5/11
9 h-m-p 0.0041 2.0350 0.7991 ++++CYC 732.399921 2 1.3016 170 | 5/11
10 h-m-p 0.0004 0.0022 262.7671 -Y 732.399921 0 0.0001 191 | 5/11
11 h-m-p 1.6000 8.0000 0.0089 ---------------C 732.399921 0 0.0000 220 | 5/11
12 h-m-p 0.0008 0.3972 1.4426 ++++YC 732.399837 1 0.2898 245 | 5/11
13 h-m-p 1.2908 6.4539 0.0241 C 732.399837 0 0.5069 259 | 5/11
14 h-m-p 1.6000 8.0000 0.0001 ++ 732.399836 m 8.0000 279 | 5/11
15 h-m-p 0.0000 0.0003 3818.9753 +++ 732.398168 m 0.0003 300 | 6/11
16 h-m-p 0.0429 1.8564 16.4260 --------------.. | 6/11
17 h-m-p 0.0160 8.0000 5.5664 ---C 732.397244 0 0.0001 343 | 6/11
18 h-m-p 0.0481 8.0000 0.0072 ++++ 732.396855 m 8.0000 359 | 6/11
19 h-m-p 0.1088 8.0000 0.5320 +CYC 732.395070 2 0.8258 382 | 6/11
20 h-m-p 1.6000 8.0000 0.1174 CCC 732.394020 2 2.2706 405 | 6/11
21 h-m-p 1.6000 8.0000 0.1050 YC 732.393478 1 0.7024 425 | 6/11
22 h-m-p 1.6000 8.0000 0.0408 Y 732.393446 0 1.1106 444 | 6/11
23 h-m-p 1.6000 8.0000 0.0027 +Y 732.393438 0 7.0933 464 | 6/11
24 h-m-p 1.6000 8.0000 0.0097 ++ 732.393337 m 8.0000 483 | 6/11
25 h-m-p 0.0201 8.0000 3.8752 +CYC 732.392910 2 0.1094 506 | 6/11
26 h-m-p 1.3764 8.0000 0.3080 YC 732.392763 1 0.8794 521 | 6/11
27 h-m-p 1.1854 8.0000 0.2285 CC 732.392527 1 1.0958 542 | 6/11
28 h-m-p 0.8859 8.0000 0.2826 YCC 732.392204 2 1.8591 564 | 6/11
29 h-m-p 1.6000 8.0000 0.1678 C 732.392043 0 1.6000 583 | 6/11
30 h-m-p 0.5638 8.0000 0.4764 CC 732.391942 1 0.9872 604 | 6/11
31 h-m-p 1.5431 8.0000 0.3047 C 732.391825 0 2.1382 623 | 6/11
32 h-m-p 1.6000 8.0000 0.1981 YC 732.391752 1 2.7481 643 | 6/11
33 h-m-p 1.2588 8.0000 0.4326 C 732.391727 0 1.3188 662 | 6/11
34 h-m-p 1.3560 8.0000 0.4207 C 732.391703 0 1.3560 681 | 6/11
35 h-m-p 1.3281 8.0000 0.4296 +Y 732.391685 0 3.3878 701 | 6/11
36 h-m-p 1.6000 8.0000 0.3035 C 732.391680 0 2.2327 720 | 6/11
37 h-m-p 1.5816 8.0000 0.4284 Y 732.391677 0 3.8389 739 | 6/11
38 h-m-p 1.6000 8.0000 0.7207 Y 732.391674 0 3.2406 758 | 6/11
39 h-m-p 1.2626 8.0000 1.8497 ++ 732.391661 m 8.0000 777 | 6/11
40 h-m-p 0.7094 3.6748 20.8597 ++ 732.391583 m 3.6748 791 | 6/11
41 h-m-p -0.0000 -0.0000 1346.0571
h-m-p: -0.00000000e+00 -0.00000000e+00 1.34605706e+03 732.391583
.. | 6/11
42 h-m-p 0.0160 8.0000 0.3886 ---Y 732.391574 0 0.0001 819 | 6/11
43 h-m-p 0.0515 8.0000 0.0009 ++++ 732.391569 m 8.0000 840 | 6/11
44 h-m-p 1.1685 8.0000 0.0064 C 732.391567 0 1.0586 859 | 6/11
45 h-m-p 1.6000 8.0000 0.0002 C 732.391567 0 1.4474 878 | 6/11
46 h-m-p 1.6000 8.0000 0.0001 +Y 732.391567 0 7.0622 898 | 6/11
47 h-m-p 1.2064 8.0000 0.0008 ++ 732.391567 m 8.0000 917 | 6/11
48 h-m-p 0.0760 8.0000 0.0846 ++Y 732.391563 0 2.2366 938 | 6/11
49 h-m-p 1.6000 8.0000 0.1006 ++ 732.391529 m 8.0000 957 | 6/11
50 h-m-p 0.0035 0.1892 230.8769 +++ 732.389713 m 0.1892 977 | 7/11
51 h-m-p 0.7998 8.0000 4.0694 YC 732.389629 1 0.5259 992 | 7/11
52 h-m-p 1.6000 8.0000 0.1823 Y 732.389620 0 1.0558 1006 | 7/11
53 h-m-p 1.6000 8.0000 0.1047 C 732.389620 0 2.4106 1024 | 7/11
54 h-m-p 1.6000 8.0000 0.1378 ++ 732.389616 m 8.0000 1042 | 7/11
55 h-m-p 0.0103 0.4166 107.1679 +++ 732.389490 m 0.4166 1061 | 8/11
56 h-m-p 0.7004 8.0000 0.0122 C 732.389473 0 0.9580 1075 | 8/11
57 h-m-p 1.6000 8.0000 0.0000 Y 732.389473 0 1.1517 1092 | 8/11
58 h-m-p 1.6000 8.0000 0.0000 ---C 732.389473 0 0.0063 1112
Out..
lnL = -732.389473
1113 lfun, 4452 eigenQcodon, 20034 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -733.378390 S = -731.681877 -2.434846
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:06
did 20 / 54 patterns 0:06
did 30 / 54 patterns 0:06
did 40 / 54 patterns 0:06
did 50 / 54 patterns 0:06
did 54 / 54 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.015400 0.070825 0.048468 0.073548 0.023713 0.060702 999.000000 0.354913 1.707309
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.041405
np = 9
lnL0 = -783.047584
Iterating by ming2
Initial: fx= 783.047584
x= 0.01540 0.07083 0.04847 0.07355 0.02371 0.06070 951.42857 0.35491 1.70731
1 h-m-p 0.0000 0.0001 421.5622 ++ 767.688873 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 338.4785 +YYCCYC 759.249260 5 0.0001 36 | 1/9
3 h-m-p 0.0022 0.1542 20.4883 ------------.. | 1/9
4 h-m-p 0.0000 0.0000 364.8722 ++ 756.430684 m 0.0000 70 | 2/9
5 h-m-p 0.0000 0.0000 7258.7917 ++ 742.954256 m 0.0000 82 | 3/9
6 h-m-p 0.0033 0.4339 10.7590 ------------.. | 3/9
7 h-m-p 0.0000 0.0001 258.4176 ++ 734.539611 m 0.0001 116 | 4/9
8 h-m-p 0.0000 0.0000 14309.4592 ++ 734.013786 m 0.0000 128 | 5/9
9 h-m-p 0.0078 3.8776 2.1340 +++YYCCCC 733.116830 5 0.8202 151 | 5/9
10 h-m-p 1.6000 8.0000 0.1308 ++ 732.915753 m 8.0000 163 | 5/9
11 h-m-p 0.0737 0.3683 0.8533 +
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
+ 732.883081 m 0.3683 179
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30387, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.30362, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
12 h-m-p 0.8522 8.0000 0.0778
QuantileBeta(0.85, 2.23748, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18930, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.19869, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.21808, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20150, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.20979, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
C 732.857396 3 1.3132 200
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20151, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
13 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
+ 732.857396 m 8.0000 215
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20151, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
14 h-m-p 0.1853 8.0000 0.0001
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20165, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.20170, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
+ 732.857396 m 8.0000 231
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20193, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20168, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20180, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
15 h-m-p 1.6000 8.0000 0.0005
QuantileBeta(0.85, 2.20165, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
C 732.857396 0 0.4625 246
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20188, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
16 h-m-p 1.4263 8.0000 0.0001
QuantileBeta(0.85, 2.20170, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
C 732.857396 0 0.3004 261
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20187, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20163, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
17 h-m-p 0.8780 8.0000 0.0001
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857396 0 0.3888 276
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20187, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20174, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
18 h-m-p 0.0617 8.0000 0.0003
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20175, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.20178, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857396 0 0.5413 292
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20188, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20164, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20176, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
19 h-m-p 0.2346 8.0000 0.0007
QuantileBeta(0.85, 2.20178, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20185, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.20213, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
C 732.857396 0 0.8339 308
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20184, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
20 h-m-p 0.4093 8.0000 0.0015
QuantileBeta(0.85, 2.20193, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20220, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.20326, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
C 732.857396 0 1.5313 324
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20230, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20205, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20218, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
21 h-m-p 0.6679 8.0000 0.0034
QuantileBeta(0.85, 2.20252, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20356, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.20632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857396 0 3.8677 340
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20406, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20418, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
22 h-m-p 1.0339 8.0000 0.0128
QuantileBeta(0.85, 2.20623, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.21238, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
+ 732.857396 m 8.0000 355
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22016, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.21992, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.22004, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
23 h-m-p 0.3044 8.0000 0.3370
QuantileBeta(0.85, 2.23597, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.28377, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.47498, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.63875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857395 0 3.5907 372
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40810, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40785, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.40797, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
24 h-m-p 1.6000 8.0000 0.7057
QuantileBeta(0.85, 2.58396, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.11191, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
+ 732.857382 m 8.0000 387
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28804, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28775, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28790, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
25 h-m-p 0.0190 0.1388 296.6879
QuantileBeta(0.85, 4.16792, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.80798, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
+ 732.857290 m 0.1388 402
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.70815, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
26 h-m-p 1.6000 8.0000 1.0350
QuantileBeta(0.85, 11.36417, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 16.33223, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.00408, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857288 0 1.2521 414
QuantileBeta(0.85, 11.00408, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.00408, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.00408, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.00408, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.00408, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.00408, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.00408, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.00409, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.00408, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
27 h-m-p 0.2703 8.0000 4.7952
QuantileBeta(0.85, 12.30001, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 16.18781, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857288 0 0.4866 426
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33724, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
28 h-m-p 1.6000 8.0000 0.0073
QuantileBeta(0.85, 13.32557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.29059, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
C 732.857288 0 1.8000 438
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32378, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.32411, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
29 h-m-p 0.0386 8.0000 0.3402
QuantileBeta(0.85, 13.33723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.37658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
C 732.857288 0 0.0414 452
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33854, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.33821, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
30 h-m-p 0.0432 8.0000 0.3265
QuantileBeta(0.85, 13.35231, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.39460, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 13.56376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857288 0 0.3070 467
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43878, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43811, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.43845, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
31 h-m-p 0.3739 8.0000 0.2681
QuantileBeta(0.85, 13.53868, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.83939, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857288 0 0.6609 481
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61597, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61529, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.61563, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
32 h-m-p 0.3530 8.0000 0.5020
QuantileBeta(0.85, 13.79282, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.32437, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 16.45059, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857288 0 0.9742 496
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10505, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10436, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.10470, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
33 h-m-p 0.5478 8.0000 0.8927
QuantileBeta(0.85, 14.59377, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 16.06098, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 21.24648, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
Y 732.857288 0 1.6562 511
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58355, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58282, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.58319, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
34 h-m-p 1.2444 8.0000 1.1881
QuantileBeta(0.85, 17.06167, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 21.49713, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
+ 732.857288 m 8.0000 525
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.08785, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
35 h-m-p 1.6000 8.0000 1.5153
QuantileBeta(0.85, 27.51239, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 34.78605, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73693, 0.00500) = 1.000000e+00 2000 rounds
C 732.857288 0 1.7482 537
QuantileBeta(0.85, 27.73693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73695, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73693, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
36 h-m-p 0.2894 3.0299 9.1528
QuantileBeta(0.85, 25.08784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.07466, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.57136, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.69554, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.72659, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73435, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73629, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73677, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73691, 0.00500) = 1.000000e+00 2000 rounds
N 732.857288 0 0.0000 556
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73691, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
37 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 27.73690, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73690, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
C 732.857288 0 0.0001 574
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73742, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
38 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
N 732.857288 0 0.0000 593
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -732.857288
594 lfun, 6534 eigenQcodon, 35640 P(t)
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.73689, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:17
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.024236 0.107957 0.034477 0.108743 0.010481 0.042602 999.000000 0.900000 0.203760 1.713028 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000301
np = 11
lnL0 = -748.362452
Iterating by ming2
Initial: fx= 748.362452
x= 0.02424 0.10796 0.03448 0.10874 0.01048 0.04260 951.42857 0.90000 0.20376 1.71303 951.42857
1 h-m-p 0.0000 0.0004 130.6762 +++ 741.064891 m 0.0004 17 | 1/11
2 h-m-p 0.0001 0.0004 143.1117 +YYCYCCC 738.808224 6 0.0003 41 | 1/11
3 h-m-p 0.0001 0.0005 26.2237 ++ 738.426939 m 0.0005 55 | 2/11
4 h-m-p 0.0004 0.0028 16.8842 ++ 738.028705 m 0.0028 69 | 3/11
5 h-m-p 0.0069 0.0346 5.4524 ++ 733.610965 m 0.0346 83 | 4/11
6 h-m-p 0.0832 0.4159 0.1926 --------------.. | 4/11
7 h-m-p 0.0000 0.0000 111.0546 ++ 733.479409 m 0.0000 130 | 5/11
8 h-m-p 0.0000 0.0000 459596.6090 +YYCYCC 732.510848 5 0.0000 152 | 5/11
9 h-m-p 0.8193 4.5738 0.0386 ++ 732.510373 m 4.5738 166 | 6/11
10 h-m-p 0.0026 0.2399 7.2185 +++YYCCC 732.407123 4 0.1459 195 | 6/11
11 h-m-p 1.6000 8.0000 0.0249 ----------------.. | 6/11
12 h-m-p 0.0003 0.1340 7.4492 YYCC 732.396668 3 0.0004 246 | 6/11
13 h-m-p 0.0005 0.0023 5.3956 YYCC 732.393084 3 0.0003 264 | 6/11
14 h-m-p 1.6000 8.0000 0.0007 +YC 732.391716 1 4.4903 280 | 6/11
15 h-m-p 1.6000 8.0000 0.0001 Y 732.391707 0 0.6763 299 | 6/11
16 h-m-p 0.6383 8.0000 0.0001 +Y 732.391705 0 1.7632 319 | 6/11
17 h-m-p 1.6000 8.0000 0.0000 Y 732.391705 0 3.9035 338 | 6/11
18 h-m-p 0.8546 8.0000 0.0002 ++ 732.391705 m 8.0000 357 | 6/11
19 h-m-p 0.0326 8.0000 0.0515 +++C 732.391703 0 2.0840 379 | 6/11
20 h-m-p 1.6000 8.0000 0.0533 ++ 732.391684 m 8.0000 398 | 6/11
21 h-m-p 0.0016 0.1813 260.3963 ++++ 732.389664 m 0.1813 419 | 7/11
22 h-m-p 1.2165 8.0000 2.8863 Y 732.389654 0 0.5225 433 | 7/11
23 h-m-p 1.6000 8.0000 0.2870 C 732.389618 0 1.7136 447 | 7/11
24 h-m-p 1.0037 8.0000 0.4901 Y 732.389615 0 2.1198 465 | 7/11
25 h-m-p 0.9689 8.0000 1.0722 ++ 732.389587 m 8.0000 483 | 7/11
26 h-m-p 0.0154 0.0771 459.5607 ++ 732.389475 m 0.0771 497 | 8/11
27 h-m-p 0.6847 8.0000 1.4487
QuantileBeta(0.15, 0.00500, 3.00634) = 8.161636e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98230) = 3.752247e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
C 732.389473 0 1.0893 511
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.862011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630537e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59239) = 6.630541e-161 2000 rounds
| 8/11
28 h-m-p 1.1687 5.8433 0.6139
QuantileBeta(0.15, 0.00500, 2.87491) = 8.606684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
Y 732.389473 0 0.8115 525
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 8.164233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09433) = 7.888405e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09404) = 7.889268e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09418) = 7.888836e-161 2000 rounds
| 8/11
29 h-m-p 1.6000 8.0000 0.1806
QuantileBeta(0.15, 0.00500, 2.80522) = 8.862818e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02194) = 8.111816e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
Y 732.389473 0 0.7970 542
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.637249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95037) = 8.345426e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95009) = 8.346369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95023) = 8.345897e-161 2000 rounds
| 8/11
30 h-m-p 1.6000 8.0000 0.0064
QuantileBeta(0.15, 0.00500, 2.96047) = 8.311680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.99116) = 8.210681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
Y 732.389473 0 0.9128 559
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.617011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95621) = 8.325872e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95593) = 8.326812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95607) = 8.326342e-161 2000 rounds
| 8/11
31 h-m-p 1.6000 8.0000 0.0036
QuantileBeta(0.15, 0.00500, 2.96190) = 8.306890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95753) = 8.321470e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95644) = 8.325123e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95616) = 8.326037e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95608) = 8.326304e-161 2000 rounds
N 732.389473 0 0.0063 579
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.616933e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95623) = 8.325796e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95595) = 8.326735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
| 8/11
32 h-m-p 0.0160 8.0000 0.0118
QuantileBeta(0.15, 0.00500, 2.95628) = 8.325636e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95614) = 8.326108e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95611) = 8.326226e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95610) = 8.326256e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326263e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326265e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326265e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
Y 732.389473 0 0.0000 605
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.616933e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95623) = 8.325796e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95595) = 8.326735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
| 8/11
33 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
N 732.389473 0 0.0000 629
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.616933e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95623) = 8.325796e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95595) = 8.326735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
| 8/11
34 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
Y 732.389473 0 0.0000 651
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
Out..
lnL = -732.389473
652 lfun, 7824 eigenQcodon, 43032 P(t)
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -733.202309 S = -731.681927 -2.083690
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:28
did 20 / 54 patterns 0:28
did 30 / 54 patterns 0:28
did 40 / 54 patterns 0:28
did 50 / 54 patterns 0:28
did 54 / 54 patterns 0:28
QuantileBeta(0.15, 0.00500, 2.95609) = 8.326266e-161 2000 rounds
Time used: 0:28
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=184
NC_011896_1_WP_010907762_1_530_MLBR_RS02510 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
NC_002677_1_NP_301438_1_310_ML0513 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
NZ_AP014567_1_WP_119607903_1_562_ruvX VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA
**************************************************
NC_011896_1_WP_010907762_1_530_MLBR_RS02510 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
NC_002677_1_NP_301438_1_310_ML0513 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780 TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
NZ_AP014567_1_WP_119607903_1_562_ruvX TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI
**************************************************
NC_011896_1_WP_010907762_1_530_MLBR_RS02510 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
NC_002677_1_NP_301438_1_310_ML0513 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780 DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
NZ_AP014567_1_WP_119607903_1_562_ruvX DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA
******.*******************************************
NC_011896_1_WP_010907762_1_530_MLBR_RS02510 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
NC_002677_1_NP_301438_1_310_ML0513 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780 VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
NZ_AP014567_1_WP_119607903_1_562_ruvX VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
**********************************
>NC_011896_1_WP_010907762_1_530_MLBR_RS02510 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >NC_002677_1_NP_301438_1_310_ML0513 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780 GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGCACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG >NZ_AP014567_1_WP_119607903_1_562_ruvX GTGTTTTCGTCACAGCACCGCCTGCTCTACCAGCCAAGTGGCCCTGATCT GTCAAAAAACTTAGACCCTGAGCGGGGACGGCGGCTCGGCATCGATGTGG GTAGTGTGCGCATAGGTGTGGCTTTCAGCGACCCGGACGGCATCCTGGCT ACCCCGGTGGAGACGGTGCGCCGCTACCGTTCCGCTAAGCACTTGCGCCG ACTAGCTGAGCTCGTCGTCGAATTGCAGGTTGTCGAGGTGGTCGTCGGCT TGCCATGGACACTGACCGACCGGACCGGCTCGTCGGCAAAGGACGCCATC GACACCGCCGAGGCACTAGTACGGCGGGTTGCTCCGGTACCGGTTCGACT CGTTGATGAGCGGCTGACCACTGTCAGCGCGCAGCGTTTGCTGCGTGCTG CAGGTGTACGCGCTAAAGACCAGCGGGCGGTGATCGACCAGGCGGCGGCG GTGGTGATTCTGCAAAATTGGCTCGATCAATGCCGCGCTGCTACTCCGGC GAGGGCGGATGAGCCTACGACTGGATCGGTAGCTGGAGAAGTTATCGATG GG
>NC_011896_1_WP_010907762_1_530_MLBR_RS02510 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >NC_002677_1_NP_301438_1_310_ML0513 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780 VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG >NZ_AP014567_1_WP_119607903_1_562_ruvX VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILA TPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAI DTAEALVRRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAA VVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
#NEXUS
[ID: 1859468447]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907762_1_530_MLBR_RS02510
NC_002677_1_NP_301438_1_310_ML0513
NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555
NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960
NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780
NZ_AP014567_1_WP_119607903_1_562_ruvX
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907762_1_530_MLBR_RS02510,
2 NC_002677_1_NP_301438_1_310_ML0513,
3 NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555,
4 NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960,
5 NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780,
6 NZ_AP014567_1_WP_119607903_1_562_ruvX
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05821708,2:0.06090765,3:0.06046466,4:0.06029527,5:0.05849969,6:0.11208);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05821708,2:0.06090765,3:0.06046466,4:0.06029527,5:0.05849969,6:0.11208);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -759.31 -764.70
2 -759.24 -762.25
--------------------------------------
TOTAL -759.28 -764.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0513/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871156 0.088380 0.328458 1.439747 0.837733 1501.00 1501.00 1.000
r(A<->C){all} 0.149309 0.016849 0.000022 0.402140 0.114843 242.53 290.18 1.000
r(A<->G){all} 0.167178 0.020430 0.000006 0.449695 0.124687 284.45 293.45 1.001
r(A<->T){all} 0.150999 0.015644 0.000205 0.396451 0.120602 130.63 149.25 1.000
r(C<->G){all} 0.130760 0.014715 0.000016 0.378455 0.092014 173.78 263.62 1.003
r(C<->T){all} 0.222545 0.025538 0.000024 0.535819 0.195817 218.83 244.78 1.000
r(G<->T){all} 0.179210 0.021796 0.000068 0.468571 0.141471 194.53 195.52 1.000
pi(A){all} 0.175291 0.000261 0.145043 0.207123 0.174994 1272.69 1319.63 1.001
pi(C){all} 0.287616 0.000359 0.252462 0.326704 0.287634 1034.17 1254.96 1.000
pi(G){all} 0.338994 0.000395 0.303089 0.379160 0.339247 1233.42 1277.36 1.000
pi(T){all} 0.198100 0.000280 0.166785 0.231848 0.197840 1203.00 1280.94 1.000
alpha{1,2} 0.315244 0.140951 0.000160 1.004412 0.201657 797.93 1091.76 1.000
alpha{3} 0.404918 0.225307 0.000200 1.373809 0.240165 1286.92 1294.69 1.000
pinvar{all} 0.993789 0.000024 0.984459 0.999861 0.994988 1337.26 1373.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0513/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 184
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 3 3 3 3 3 3 | His CAT 0 0 0 0 0 0 | Arg CGT 3 3 3 3 3 3
CTC 5 5 5 5 5 5 | CCC 0 0 0 0 0 0 | CAC 2 2 2 2 2 2 | CGC 7 7 7 7 7 7
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 7 7 7 7 7 7 | CCG 5 5 5 5 5 5 | CAG 6 6 6 6 6 6 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 5 5 5 5 5 5 | ACC 5 5 5 5 5 5 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 10 10 10 10 10 10 | Asp GAT 6 6 6 6 6 6 | Gly GGT 3 3 3 3 3 3
GTC 6 6 6 6 6 6 | GCC 2 2 2 2 2 2 | GAC 8 8 8 8 8 8 | GGC 5 5 5 5 5 5
GTA 3 3 3 3 3 4 | GCA 4 4 4 4 4 3 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 10 10 10 10 10 10 | GCG 7 7 7 7 7 7 | GAG 7 7 7 7 7 7 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907762_1_530_MLBR_RS02510
position 1: T:0.10326 C:0.29348 A:0.15761 G:0.44565
position 2: T:0.28261 C:0.27717 A:0.22283 G:0.21739
position 3: T:0.20652 C:0.28804 A:0.14674 G:0.35870
Average T:0.19746 C:0.28623 A:0.17572 G:0.34058
#2: NC_002677_1_NP_301438_1_310_ML0513
position 1: T:0.10326 C:0.29348 A:0.15761 G:0.44565
position 2: T:0.28261 C:0.27717 A:0.22283 G:0.21739
position 3: T:0.20652 C:0.28804 A:0.14674 G:0.35870
Average T:0.19746 C:0.28623 A:0.17572 G:0.34058
#3: NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555
position 1: T:0.10326 C:0.29348 A:0.15761 G:0.44565
position 2: T:0.28261 C:0.27717 A:0.22283 G:0.21739
position 3: T:0.20652 C:0.28804 A:0.14674 G:0.35870
Average T:0.19746 C:0.28623 A:0.17572 G:0.34058
#4: NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960
position 1: T:0.10326 C:0.29348 A:0.15761 G:0.44565
position 2: T:0.28261 C:0.27717 A:0.22283 G:0.21739
position 3: T:0.20652 C:0.28804 A:0.14674 G:0.35870
Average T:0.19746 C:0.28623 A:0.17572 G:0.34058
#5: NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780
position 1: T:0.10326 C:0.29348 A:0.15761 G:0.44565
position 2: T:0.28261 C:0.27717 A:0.22283 G:0.21739
position 3: T:0.20652 C:0.28804 A:0.14674 G:0.35870
Average T:0.19746 C:0.28623 A:0.17572 G:0.34058
#6: NZ_AP014567_1_WP_119607903_1_562_ruvX
position 1: T:0.10326 C:0.29348 A:0.15761 G:0.44565
position 2: T:0.28804 C:0.27174 A:0.22283 G:0.21739
position 3: T:0.20652 C:0.28804 A:0.14674 G:0.35870
Average T:0.19928 C:0.28442 A:0.17572 G:0.34058
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 6 | TCC 6 | TAC 12 | TGC 6
Leu L TTA 6 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 18 | His H CAT 0 | Arg R CGT 18
CTC 30 | CCC 0 | CAC 12 | CGC 42
CTA 12 | CCA 12 | Gln Q CAA 12 | CGA 12
CTG 42 | CCG 30 | CAG 36 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 12
ATC 30 | ACC 30 | AAC 6 | AGC 12
ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 0 | ACG 12 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 60 | Asp D GAT 36 | Gly G GGT 18
GTC 36 | GCC 12 | GAC 48 | GGC 30
GTA 19 | GCA 23 | Glu E GAA 12 | GGA 18
GTG 60 | GCG 42 | GAG 42 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10326 C:0.29348 A:0.15761 G:0.44565
position 2: T:0.28351 C:0.27627 A:0.22283 G:0.21739
position 3: T:0.20652 C:0.28804 A:0.14674 G:0.35870
Average T:0.19777 C:0.28593 A:0.17572 G:0.34058
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -732.411807 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005646 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005666
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005646);
(NC_011896_1_WP_010907762_1_530_MLBR_RS02510: 0.000004, NC_002677_1_NP_301438_1_310_ML0513: 0.000004, NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555: 0.000004, NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960: 0.000004, NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780: 0.000004, NZ_AP014567_1_WP_119607903_1_562_ruvX: 0.005646);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.3 190.7 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 361.3 190.7 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 361.3 190.7 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 361.3 190.7 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 361.3 190.7 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 361.3 190.7 999.0000 0.0029 0.0000 1.0 0.0
tree length for dN: 0.0029
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -732.857398 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005518 951.428581 0.000010 0.226145
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005538
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005518);
(NC_011896_1_WP_010907762_1_530_MLBR_RS02510: 0.000004, NC_002677_1_NP_301438_1_310_ML0513: 0.000004, NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555: 0.000004, NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960: 0.000004, NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780: 0.000004, NZ_AP014567_1_WP_119607903_1_562_ruvX: 0.005518);
Detailed output identifying parameters
kappa (ts/tv) = 951.42858
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.22614 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 361.3 190.7 1.0000 0.0018 0.0018 0.7 0.4
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -732.389473 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.008173 999.000000 0.981448 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008193
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.008173);
(NC_011896_1_WP_010907762_1_530_MLBR_RS02510: 0.000004, NC_002677_1_NP_301438_1_310_ML0513: 0.000004, NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555: 0.000004, NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960: 0.000004, NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780: 0.000004, NZ_AP014567_1_WP_119607903_1_562_ruvX: 0.008173);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=3)
p: 0.98145 0.00000 0.01855
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.3 190.7 18.5334 0.0000 0.0000 0.0 0.0
7..2 0.000 361.3 190.7 18.5334 0.0000 0.0000 0.0 0.0
7..3 0.000 361.3 190.7 18.5334 0.0000 0.0000 0.0 0.0
7..4 0.000 361.3 190.7 18.5334 0.0000 0.0000 0.0 0.0
7..5 0.000 361.3 190.7 18.5334 0.0000 0.0000 0.0 0.0
7..6 0.008 361.3 190.7 18.5334 0.0040 0.0002 1.5 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907762_1_530_MLBR_RS02510)
Pr(w>1) post mean +- SE for w
107 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907762_1_530_MLBR_RS02510)
Pr(w>1) post mean +- SE for w
107 A 0.776 5.739 +- 3.459
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.104 0.106
w2: 0.048 0.062 0.075 0.087 0.098 0.108 0.118 0.126 0.134 0.141
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.006
0.008 0.006 0.005
0.009 0.008 0.007 0.006 0.005
0.011 0.010 0.009 0.008 0.007 0.006 0.005
0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.005 0.005
0.014 0.013 0.012 0.011 0.011 0.010 0.009 0.008 0.007 0.005 0.004
0.015 0.014 0.014 0.013 0.012 0.011 0.011 0.009 0.009 0.007 0.007 0.005 0.004
0.016 0.015 0.015 0.014 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.017 0.016 0.016 0.015 0.015 0.014 0.013 0.012 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.018 0.017 0.017 0.016 0.016 0.015 0.015 0.014 0.013 0.012 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -732.857288 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005518 999.000000 27.736893 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005538
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005518);
(NC_011896_1_WP_010907762_1_530_MLBR_RS02510: 0.000004, NC_002677_1_NP_301438_1_310_ML0513: 0.000004, NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555: 0.000004, NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960: 0.000004, NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780: 0.000004, NZ_AP014567_1_WP_119607903_1_562_ruvX: 0.005518);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M7 (beta):
p = 27.73689 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 361.3 190.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 361.3 190.7 1.0000 0.0018 0.0018 0.7 0.4
Time used: 0:17
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -732.389473 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.008173 999.000000 0.981447 0.005000 2.956094 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008193
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.008173);
(NC_011896_1_WP_010907762_1_530_MLBR_RS02510: 0.000004, NC_002677_1_NP_301438_1_310_ML0513: 0.000004, NZ_LVXE01000008_1_WP_010907762_1_2752_A3216_RS04555: 0.000004, NZ_LYPH01000055_1_WP_010907762_1_2079_A8144_RS09960: 0.000004, NZ_CP029543_1_WP_010907762_1_544_DIJ64_RS02780: 0.000004, NZ_AP014567_1_WP_119607903_1_562_ruvX: 0.008173);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M8 (beta&w>1):
p0 = 0.98145 p = 0.00500 q = 2.95609
(p1 = 0.01855) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09814 0.09814 0.09814 0.09814 0.09814 0.09814 0.09814 0.09814 0.09814 0.09814 0.01855
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.3 190.7 18.5344 0.0000 0.0000 0.0 0.0
7..2 0.000 361.3 190.7 18.5344 0.0000 0.0000 0.0 0.0
7..3 0.000 361.3 190.7 18.5344 0.0000 0.0000 0.0 0.0
7..4 0.000 361.3 190.7 18.5344 0.0000 0.0000 0.0 0.0
7..5 0.000 361.3 190.7 18.5344 0.0000 0.0000 0.0 0.0
7..6 0.008 361.3 190.7 18.5344 0.0040 0.0002 1.5 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907762_1_530_MLBR_RS02510)
Pr(w>1) post mean +- SE for w
107 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907762_1_530_MLBR_RS02510)
Pr(w>1) post mean +- SE for w
1 V 0.606 4.410 +- 3.759
2 F 0.606 4.413 +- 3.759
3 S 0.606 4.412 +- 3.759
4 S 0.606 4.414 +- 3.759
5 Q 0.606 4.413 +- 3.759
6 H 0.606 4.413 +- 3.759
7 R 0.606 4.413 +- 3.759
8 L 0.606 4.413 +- 3.759
9 L 0.606 4.413 +- 3.759
10 Y 0.606 4.413 +- 3.759
11 Q 0.606 4.413 +- 3.759
12 P 0.606 4.414 +- 3.759
13 S 0.606 4.413 +- 3.759
14 G 0.606 4.412 +- 3.759
15 P 0.606 4.413 +- 3.759
16 D 0.606 4.413 +- 3.759
17 L 0.606 4.413 +- 3.759
18 S 0.606 4.414 +- 3.759
19 K 0.606 4.414 +- 3.759
20 N 0.606 4.412 +- 3.759
21 L 0.607 4.415 +- 3.759
22 D 0.606 4.412 +- 3.759
23 P 0.606 4.413 +- 3.759
24 E 0.606 4.411 +- 3.759
25 R 0.606 4.413 +- 3.759
26 G 0.606 4.414 +- 3.759
27 R 0.606 4.413 +- 3.759
28 R 0.606 4.413 +- 3.759
29 L 0.606 4.413 +- 3.759
30 G 0.606 4.412 +- 3.759
31 I 0.606 4.411 +- 3.759
32 D 0.606 4.413 +- 3.759
33 V 0.606 4.410 +- 3.759
34 G 0.606 4.413 +- 3.759
35 S 0.606 4.413 +- 3.759
36 V 0.606 4.410 +- 3.759
37 R 0.606 4.413 +- 3.759
38 I 0.606 4.412 +- 3.759
39 G 0.606 4.413 +- 3.759
40 V 0.606 4.410 +- 3.759
41 A 0.606 4.412 +- 3.759
42 F 0.606 4.413 +- 3.759
43 S 0.606 4.412 +- 3.759
44 D 0.606 4.412 +- 3.759
45 P 0.606 4.412 +- 3.759
46 D 0.606 4.412 +- 3.759
47 G 0.606 4.412 +- 3.759
48 I 0.606 4.411 +- 3.759
49 L 0.606 4.413 +- 3.759
50 A 0.606 4.412 +- 3.759
51 T 0.606 4.411 +- 3.759
52 P 0.606 4.412 +- 3.759
53 V 0.606 4.410 +- 3.759
54 E 0.606 4.411 +- 3.759
55 T 0.606 4.410 +- 3.759
56 V 0.606 4.410 +- 3.759
57 R 0.606 4.413 +- 3.759
58 R 0.606 4.413 +- 3.759
59 Y 0.606 4.413 +- 3.759
60 R 0.606 4.414 +- 3.759
61 S 0.606 4.413 +- 3.759
62 A 0.606 4.412 +- 3.759
63 K 0.606 4.411 +- 3.759
64 H 0.606 4.413 +- 3.759
65 L 0.607 4.415 +- 3.759
66 R 0.606 4.413 +- 3.759
67 R 0.607 4.415 +- 3.759
68 L 0.607 4.415 +- 3.759
69 A 0.606 4.412 +- 3.759
70 E 0.606 4.411 +- 3.759
71 L 0.606 4.413 +- 3.759
72 V 0.606 4.411 +- 3.759
73 V 0.606 4.411 +- 3.759
74 E 0.606 4.414 +- 3.759
75 L 0.607 4.415 +- 3.759
76 Q 0.606 4.413 +- 3.759
77 V 0.606 4.412 +- 3.759
78 V 0.606 4.411 +- 3.759
79 E 0.606 4.411 +- 3.759
80 V 0.606 4.410 +- 3.759
81 V 0.606 4.411 +- 3.759
82 V 0.606 4.411 +- 3.759
83 G 0.606 4.412 +- 3.759
84 L 0.607 4.415 +- 3.759
85 P 0.606 4.414 +- 3.759
86 W 0.606 4.414 +- 3.759
87 T 0.606 4.413 +- 3.759
88 L 0.606 4.413 +- 3.759
89 T 0.606 4.411 +- 3.759
90 D 0.606 4.412 +- 3.759
91 R 0.606 4.413 +- 3.759
92 T 0.606 4.411 +- 3.759
93 G 0.606 4.412 +- 3.759
94 S 0.606 4.412 +- 3.759
95 S 0.606 4.412 +- 3.759
96 A 0.606 4.413 +- 3.759
97 K 0.606 4.411 +- 3.759
98 D 0.606 4.412 +- 3.759
99 A 0.606 4.411 +- 3.759
100 I 0.606 4.411 +- 3.759
101 D 0.606 4.412 +- 3.759
102 T 0.606 4.411 +- 3.759
103 A 0.606 4.411 +- 3.759
104 E 0.606 4.411 +- 3.759
105 A 0.606 4.413 +- 3.759
106 L 0.607 4.415 +- 3.759
107 A 0.908 6.472 +- 3.080
108 R 0.606 4.413 +- 3.759
109 R 0.606 4.413 +- 3.759
110 V 0.606 4.412 +- 3.759
111 A 0.606 4.412 +- 3.759
112 P 0.606 4.412 +- 3.759
113 V 0.606 4.413 +- 3.759
114 P 0.606 4.412 +- 3.759
115 V 0.606 4.412 +- 3.759
116 R 0.607 4.415 +- 3.759
117 L 0.606 4.413 +- 3.759
118 V 0.606 4.412 +- 3.759
119 D 0.606 4.413 +- 3.759
120 E 0.606 4.411 +- 3.759
121 R 0.606 4.413 +- 3.759
122 L 0.606 4.413 +- 3.759
123 T 0.606 4.411 +- 3.759
124 T 0.606 4.412 +- 3.759
125 V 0.606 4.411 +- 3.759
126 S 0.606 4.412 +- 3.759
127 A 0.606 4.410 +- 3.759
128 Q 0.606 4.413 +- 3.759
129 R 0.606 4.414 +- 3.759
130 L 0.607 4.415 +- 3.759
131 L 0.606 4.413 +- 3.759
132 R 0.606 4.414 +- 3.759
133 A 0.606 4.412 +- 3.759
134 A 0.606 4.413 +- 3.759
135 G 0.606 4.413 +- 3.759
136 V 0.606 4.413 +- 3.759
137 R 0.606 4.413 +- 3.759
138 A 0.606 4.412 +- 3.759
139 K 0.606 4.414 +- 3.759
140 D 0.606 4.412 +- 3.759
141 Q 0.606 4.413 +- 3.759
142 R 0.606 4.413 +- 3.759
143 A 0.606 4.410 +- 3.759
144 V 0.606 4.410 +- 3.759
145 I 0.606 4.411 +- 3.759
146 D 0.606 4.412 +- 3.759
147 Q 0.606 4.413 +- 3.759
148 A 0.606 4.410 +- 3.759
149 A 0.606 4.410 +- 3.759
150 A 0.606 4.410 +- 3.759
151 V 0.606 4.410 +- 3.759
152 V 0.606 4.410 +- 3.759
153 I 0.606 4.412 +- 3.759
154 L 0.606 4.413 +- 3.759
155 Q 0.607 4.415 +- 3.759
156 N 0.606 4.413 +- 3.759
157 W 0.606 4.414 +- 3.759
158 L 0.606 4.413 +- 3.759
159 D 0.606 4.413 +- 3.759
160 Q 0.607 4.415 +- 3.759
161 C 0.606 4.413 +- 3.759
162 R 0.606 4.413 +- 3.759
163 A 0.606 4.412 +- 3.759
164 A 0.606 4.412 +- 3.759
165 T 0.606 4.412 +- 3.759
166 P 0.606 4.412 +- 3.759
167 A 0.606 4.410 +- 3.759
168 R 0.606 4.411 +- 3.759
169 A 0.606 4.410 +- 3.759
170 D 0.606 4.413 +- 3.759
171 E 0.606 4.411 +- 3.759
172 P 0.606 4.413 +- 3.759
173 T 0.606 4.410 +- 3.759
174 T 0.606 4.412 +- 3.759
175 G 0.606 4.414 +- 3.759
176 S 0.606 4.412 +- 3.759
177 V 0.606 4.413 +- 3.759
178 A 0.606 4.412 +- 3.759
179 G 0.606 4.414 +- 3.759
180 E 0.606 4.414 +- 3.759
181 V 0.606 4.412 +- 3.759
182 I 0.606 4.411 +- 3.759
183 D 0.606 4.413 +- 3.759
184 G 0.606 4.411 +- 3.759
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.149 0.142 0.133 0.124 0.113 0.100 0.086 0.070 0.052 0.032
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.040 0.058 0.073 0.087 0.100 0.111 0.121 0.129 0.137 0.144
Time used: 0:28
Model 1: NearlyNeutral -732.857398 Model 2: PositiveSelection -732.389473 Model 0: one-ratio -732.411807 Model 7: beta -732.857288 Model 8: beta&w>1 -732.389473 Model 0 vs 1 0.8911820000000716 Model 2 vs 1 0.9358500000000731 Model 8 vs 7 0.9356300000001738
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
