--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 17:51:56 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0514/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0514/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0514/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0514/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1722.41 -1725.69 2 -1722.43 -1725.29 -------------------------------------- TOTAL -1722.42 -1725.51 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0514/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0514/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0514/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896855 0.092097 0.369673 1.492645 0.859751 1501.00 1501.00 1.000 r(A<->C){all} 0.160639 0.019357 0.000058 0.431635 0.123334 226.18 275.61 1.000 r(A<->G){all} 0.166931 0.020023 0.000083 0.458913 0.129469 226.29 243.59 1.000 r(A<->T){all} 0.156736 0.017026 0.000053 0.417835 0.122048 138.00 160.67 1.000 r(C<->G){all} 0.183154 0.023067 0.000124 0.485617 0.145785 119.70 151.70 1.000 r(C<->T){all} 0.161968 0.018927 0.000005 0.435517 0.128011 214.80 226.69 1.000 r(G<->T){all} 0.170571 0.021147 0.000071 0.467225 0.128896 148.01 185.87 1.000 pi(A){all} 0.182844 0.000122 0.161682 0.204698 0.182638 1137.71 1193.43 1.001 pi(C){all} 0.297729 0.000171 0.272566 0.323332 0.297780 1437.15 1459.55 1.000 pi(G){all} 0.308567 0.000169 0.283806 0.334080 0.308715 1436.86 1451.00 1.002 pi(T){all} 0.210860 0.000126 0.189249 0.232926 0.210581 1170.92 1268.85 1.000 alpha{1,2} 0.436881 0.248229 0.000220 1.406744 0.273626 1100.98 1300.99 1.000 alpha{3} 0.472345 0.244466 0.000297 1.476511 0.312186 1120.35 1219.77 1.000 pinvar{all} 0.998848 0.000002 0.996175 0.999999 0.999281 1292.83 1308.74 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1665.61536 Model 2: PositiveSelection -1665.61536 Model 0: one-ratio -1665.615547 Model 7: beta -1665.615372 Model 8: beta&w>1 -1665.615502 Model 0 vs 1 3.7400000019260915E-4 Model 2 vs 1 0.0 Model 8 vs 7 2.600000002530578E-4
>C1 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C2 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C3 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C4 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C5 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C6 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=421 C1 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C2 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C3 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C4 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C5 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C6 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG ************************************************** C1 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C2 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C3 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C4 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C5 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C6 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV ************************************************** C1 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C2 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C3 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C4 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C5 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C6 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ************************************************** C1 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C2 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C3 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C4 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C5 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C6 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH ************************************************** C1 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C2 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C3 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C4 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C5 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C6 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV ************************************************** C1 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C2 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C3 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C4 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C5 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C6 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ************************************************** C1 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C2 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C3 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C4 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C5 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C6 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP ************************************************** C1 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C2 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C3 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C4 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C5 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C6 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD ************************************************** C1 YQQHLTNIELAKHNGVLDSVR C2 YQQHLTNIELAKHNGVLDSVR C3 YQQHLTNIELAKHNGVLDSVR C4 YQQHLTNIELAKHNGVLDSVR C5 YQQHLTNIELAKHNGVLDSVR C6 YQQHLTNIELAKHNGVLDSVR ********************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12630] Library Relaxation: Multi_proc [96] Relaxation Summary: [12630]--->[12630] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.539 Mb, Max= 31.005 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C2 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C3 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C4 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C5 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG C6 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG ************************************************** C1 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C2 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C3 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C4 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C5 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV C6 LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV ************************************************** C1 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C2 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C3 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C4 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C5 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL C6 IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ************************************************** C1 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C2 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C3 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C4 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C5 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH C6 ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH ************************************************** C1 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C2 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C3 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C4 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C5 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV C6 CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV ************************************************** C1 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C2 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C3 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C4 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C5 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE C6 DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ************************************************** C1 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C2 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C3 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C4 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C5 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP C6 ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP ************************************************** C1 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C2 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C3 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C4 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C5 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD C6 WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD ************************************************** C1 YQQHLTNIELAKHNGVLDSVR C2 YQQHLTNIELAKHNGVLDSVR C3 YQQHLTNIELAKHNGVLDSVR C4 YQQHLTNIELAKHNGVLDSVR C5 YQQHLTNIELAKHNGVLDSVR C6 YQQHLTNIELAKHNGVLDSVR ********************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG C2 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG C3 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG C4 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG C5 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG C6 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG ************************************************** C1 GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG C2 GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG C3 GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG C4 GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG C5 GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG C6 GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG ************************************************** C1 CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC C2 CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC C3 CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC C4 CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC C5 CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC C6 CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC ************************************************** C1 CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG C2 CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG C3 CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG C4 CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG C5 CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG C6 CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG ************************************************** C1 GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG C2 GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG C3 GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG C4 GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG C5 GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG C6 GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG ************************************************** C1 GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG C2 GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG C3 GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG C4 GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG C5 GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG C6 GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG ************************************************** C1 ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT C2 ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT C3 ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT C4 ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT C5 ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT C6 ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT ************************************************** C1 CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT C2 CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT C3 CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT C4 CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT C5 CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT C6 CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT ************************************************** C1 TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT C2 TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT C3 TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT C4 TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT C5 TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT C6 TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT ************************************************** C1 GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA C2 GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA C3 GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA C4 GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA C5 GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA C6 GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA ************************************************** C1 ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT C2 ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT C3 ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT C4 ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT C5 ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT C6 ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT ************************************************** C1 TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT C2 TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT C3 TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT C4 TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT C5 TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT C6 TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT ************************************************** C1 TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC C2 TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC C3 TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC C4 TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC C5 TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC C6 TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC ************************************************** C1 CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA C2 CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA C3 CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA C4 CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA C5 CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA C6 CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA ************************************************** C1 ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC C2 ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC C3 ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC C4 ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC C5 ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC C6 ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC ************************************************** C1 GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG C2 GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG C3 GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG C4 GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG C5 GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG C6 GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG ************************************************** C1 TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG C2 TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG C3 TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG C4 TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG C5 TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG C6 TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG ************************************************** C1 GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG C2 GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG C3 GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG C4 GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG C5 GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG C6 GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG ************************************************** C1 GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT C2 GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT C3 GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT C4 GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT C5 GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT C6 GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT ************************************************** C1 GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG C2 GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG C3 GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG C4 GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG C5 GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG C6 GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG ************************************************** C1 ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG C2 ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG C3 ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG C4 ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG C5 ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG C6 ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG ************************************************** C1 TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC C2 TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC C3 TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC C4 TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC C5 TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC C6 TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC ************************************************** C1 CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC C2 CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC C3 CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC C4 CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC C5 CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC C6 CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC ************************************************** C1 TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT C2 TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT C3 TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT C4 TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT C5 TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT C6 TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT ************************************************** C1 TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT C2 TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT C3 TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT C4 TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT C5 TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT C6 TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT ************************************************** C1 TGACAGCGTGCGC C2 TGACAGCGTGCGC C3 TGACAGCGTGCGC C4 TGACAGCGTGCGC C5 TGACAGCGTGCGC C6 TGACAGCGTGCGC ************* >C1 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT TGACAGCGTGCGC >C2 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT TGACAGCGTGCGC >C3 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT TGACAGCGTGCGC >C4 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT TGACAGCGTGCGC >C5 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT TGACAGCGTGCGC >C6 ATGGGTGATTCCTATTTAGCACGCCACCGTCTCGCACCCGAGGCGGCCGG GTTGGGCCGCCACCAGATGAGCAGCGGGGACCGGGATGGGCGCCGTCTGG CCAAGAGCGGATATCGTTGTCGACGCTTCGCCGACAAAATAGTATTTGGC CTGCTAGTCGTGGTCGTCGTCTTGGCCACCTTTGTCGGCTTGCGGCTGTG GCACACGCTGTTCGGGTCTGCTGACGGTTACACGGATTACGCGGGAGCCG GCAAGCACGACATCATGATTCAGATTCATGCCGGTGATTCGACCACCGTG ATCGGTGAGACGCTGCGCAACCAGGGGGTGGTCGCCTCGGTCCGGGCATT CGTCGATGCCTCGCATGGCAACGCCGCGATTTCGTCGATCCAGCCGGGTT TCTACCGGATGCGCACCGAAATCCCGGCCGCTGCTGCGGCAGCGCGGCTT GCTGATCCGGAGAACCGGGTGGGGAAGCTGGTTATCCCGGAAGGTCGTCA ACTTGATGATGCCACCGACATGACAACTGGCAAGGTGAATCCTGGAATAT TTTCGCTGATCTCCCGTGCCACCTGTGTGGATCTCGACGGCAACCGGCAT TGTGTTTCACTGAACGACCTCCGCGCGGCGACGAGAAGAACCTCGTTAGC CAAGCTGTCGGTGCCGGCTTGGGCGACTGAATCGGTGATTGAGTTGGGCA ACGACCATCGCCGGATCGAGGGACTCATTGCGCCGGGGACCTTCAATGTC GACCCATCGGCCTCAGCCGATAGCATCATGGCCAATTTGATCAGCACCAG TGCCGTGGGGTACACGGATTCCGGTTTGGTGGACACCGCGCGCTCCCTTG GCTTGTCACCCTACGCCATCCTTGTGGTGGCATCGCTGGTGCAGCAGGAG GCCAGCCCGCAGGACTTCCCGAAGGTGGCGCGCGTCATATACAACCGCCT GTATGAACATCGCACGTTGGAGTTTGACTCGACCGTGAACTATCCGTTGG ACCGCCGCGAGGTGGCTACCAGTGACGCCGATCGTGGCCTGTGGACGCCG TGGAACACCTACGTCTCGCCAGGATTGCCGGCCACTGCGATCTGTTCTCC CGGCATCGATGCGTTGTACGCTGCCGAGCATCCCGAGCCCGGTGACTGGC TGTACTTCGTCACCGTTGATACCCAGGGGACAACTCTGTTCACCAGGGAT TATCAGCAGCATTTAACCAATATCGAACTCGCGAAGCACAACGGTGTCCT TGACAGCGTGCGC >C1 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C2 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C3 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C4 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C5 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR >C6 MGDSYLARHRLAPEAAGLGRHQMSSGDRDGRRLAKSGYRCRRFADKIVFG LLVVVVVLATFVGLRLWHTLFGSADGYTDYAGAGKHDIMIQIHAGDSTTV IGETLRNQGVVASVRAFVDASHGNAAISSIQPGFYRMRTEIPAAAAAARL ADPENRVGKLVIPEGRQLDDATDMTTGKVNPGIFSLISRATCVDLDGNRH CVSLNDLRAATRRTSLAKLSVPAWATESVIELGNDHRRIEGLIAPGTFNV DPSASADSIMANLISTSAVGYTDSGLVDTARSLGLSPYAILVVASLVQQE ASPQDFPKVARVIYNRLYEHRTLEFDSTVNYPLDRREVATSDADRGLWTP WNTYVSPGLPATAICSPGIDALYAAEHPEPGDWLYFVTVDTQGTTLFTRD YQQHLTNIELAKHNGVLDSVR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0514/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1263 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579801835 Setting output file names to "/data/4res/ML0514/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1550443288 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 1050230441 Seed = 81836623 Swapseed = 1579801835 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2826.654547 -- -24.965149 Chain 2 -- -2826.654547 -- -24.965149 Chain 3 -- -2826.654547 -- -24.965149 Chain 4 -- -2826.654385 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2826.654547 -- -24.965149 Chain 2 -- -2826.654117 -- -24.965149 Chain 3 -- -2826.654547 -- -24.965149 Chain 4 -- -2826.654385 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2826.655] (-2826.655) (-2826.655) (-2826.654) * [-2826.655] (-2826.654) (-2826.655) (-2826.654) 500 -- (-1755.932) [-1736.722] (-1752.451) (-1759.238) * [-1735.929] (-1764.838) (-1753.381) (-1728.653) -- 0:00:00 1000 -- [-1733.288] (-1737.523) (-1731.636) (-1729.119) * (-1737.197) [-1729.250] (-1728.294) (-1728.325) -- 0:00:00 1500 -- (-1730.301) [-1734.265] (-1729.010) (-1731.967) * [-1726.485] (-1730.288) (-1730.415) (-1729.541) -- 0:00:00 2000 -- (-1731.638) (-1728.801) (-1726.664) [-1730.347] * (-1738.588) (-1734.237) [-1726.125] (-1732.712) -- 0:00:00 2500 -- (-1730.921) [-1729.626] (-1728.345) (-1733.119) * (-1733.705) (-1732.130) (-1728.486) [-1730.390] -- 0:00:00 3000 -- (-1726.990) [-1733.148] (-1732.801) (-1733.823) * (-1734.374) (-1738.030) [-1733.624] (-1727.692) -- 0:00:00 3500 -- [-1731.472] (-1735.009) (-1731.905) (-1735.549) * (-1730.838) (-1731.746) [-1730.259] (-1726.092) -- 0:00:00 4000 -- (-1730.024) (-1732.894) [-1737.107] (-1731.306) * (-1733.759) (-1732.037) (-1737.621) [-1734.639] -- 0:00:00 4500 -- [-1733.934] (-1738.545) (-1728.458) (-1731.721) * (-1729.073) (-1740.252) (-1733.838) [-1730.658] -- 0:00:00 5000 -- (-1735.016) (-1742.608) (-1741.958) [-1732.174] * [-1731.728] (-1736.408) (-1736.555) (-1739.358) -- 0:00:00 Average standard deviation of split frequencies: 0.112239 5500 -- (-1736.545) (-1727.428) [-1728.990] (-1733.638) * (-1728.856) (-1732.284) (-1733.858) [-1731.515] -- 0:00:00 6000 -- [-1727.690] (-1737.777) (-1729.996) (-1730.518) * (-1732.812) (-1733.673) [-1733.761] (-1728.037) -- 0:00:00 6500 -- (-1729.958) (-1739.705) [-1731.070] (-1731.193) * (-1735.820) [-1732.410] (-1739.480) (-1731.759) -- 0:00:00 7000 -- (-1728.712) (-1732.640) [-1731.861] (-1733.742) * (-1728.770) (-1733.023) [-1729.590] (-1737.596) -- 0:00:00 7500 -- (-1737.112) [-1734.155] (-1733.954) (-1729.387) * (-1732.786) (-1733.584) [-1726.502] (-1732.118) -- 0:02:12 8000 -- (-1731.470) (-1731.005) [-1730.324] (-1736.601) * (-1730.898) [-1730.568] (-1732.215) (-1737.081) -- 0:02:04 8500 -- (-1733.231) (-1736.663) (-1732.513) [-1725.855] * [-1731.228] (-1736.729) (-1732.102) (-1735.771) -- 0:01:56 9000 -- (-1728.669) [-1729.920] (-1729.514) (-1729.167) * (-1728.661) (-1729.897) [-1731.531] (-1733.933) -- 0:01:50 9500 -- (-1734.388) (-1736.709) [-1730.814] (-1734.623) * (-1732.276) (-1732.232) [-1732.343] (-1729.946) -- 0:01:44 10000 -- [-1731.693] (-1726.914) (-1730.886) (-1733.224) * (-1728.201) (-1732.977) [-1732.593] (-1730.315) -- 0:01:39 Average standard deviation of split frequencies: 0.085933 10500 -- (-1733.189) (-1734.770) (-1726.209) [-1728.428] * (-1735.976) (-1733.774) [-1736.466] (-1725.235) -- 0:01:34 11000 -- (-1731.519) (-1734.817) [-1741.915] (-1729.909) * (-1731.988) (-1731.534) [-1739.989] (-1728.983) -- 0:01:29 11500 -- [-1734.718] (-1735.581) (-1729.943) (-1733.135) * (-1735.939) (-1732.525) (-1730.265) [-1733.959] -- 0:01:25 12000 -- (-1730.881) [-1734.266] (-1726.727) (-1732.109) * (-1733.974) [-1733.370] (-1734.401) (-1728.559) -- 0:01:22 12500 -- (-1729.106) (-1727.692) (-1740.562) [-1735.533] * [-1730.349] (-1726.302) (-1725.313) (-1729.561) -- 0:01:19 13000 -- (-1735.096) [-1726.805] (-1741.994) (-1731.269) * (-1733.199) (-1728.569) [-1726.534] (-1736.108) -- 0:01:15 13500 -- [-1727.617] (-1739.637) (-1736.219) (-1731.129) * [-1738.517] (-1727.512) (-1725.856) (-1737.424) -- 0:01:13 14000 -- (-1732.799) (-1731.508) (-1732.028) [-1728.399] * [-1730.067] (-1734.056) (-1724.754) (-1728.392) -- 0:01:10 14500 -- (-1735.879) (-1735.134) [-1728.891] (-1735.747) * (-1733.967) (-1734.427) (-1723.776) [-1730.511] -- 0:01:07 15000 -- (-1736.773) (-1743.941) (-1733.836) [-1729.057] * [-1726.667] (-1732.654) (-1728.598) (-1731.565) -- 0:01:05 Average standard deviation of split frequencies: 0.055652 15500 -- (-1739.566) (-1739.562) (-1733.532) [-1730.246] * (-1733.209) (-1738.417) [-1726.251] (-1733.670) -- 0:01:03 16000 -- (-1738.746) [-1741.275] (-1737.999) (-1725.771) * [-1737.491] (-1730.091) (-1727.076) (-1728.829) -- 0:01:01 16500 -- (-1738.839) [-1724.661] (-1737.015) (-1738.554) * (-1736.288) (-1731.700) (-1728.147) [-1737.260] -- 0:00:59 17000 -- (-1732.080) (-1727.098) (-1739.710) [-1733.203] * (-1733.638) (-1738.439) [-1723.511] (-1736.999) -- 0:00:57 17500 -- (-1728.318) [-1725.215] (-1744.704) (-1736.648) * [-1725.979] (-1734.465) (-1723.203) (-1733.277) -- 0:00:56 18000 -- (-1737.564) (-1721.550) (-1733.908) [-1735.395] * (-1727.372) (-1754.390) (-1723.144) [-1726.051] -- 0:00:54 18500 -- [-1734.158] (-1723.254) (-1743.050) (-1731.467) * (-1738.475) (-1724.826) (-1722.849) [-1729.286] -- 0:00:53 19000 -- (-1731.441) [-1724.138] (-1736.003) (-1733.287) * (-1730.300) (-1725.451) (-1722.358) [-1726.173] -- 0:00:51 19500 -- (-1736.749) [-1723.299] (-1736.530) (-1736.658) * [-1728.847] (-1725.761) (-1721.830) (-1732.263) -- 0:00:50 20000 -- (-1734.516) (-1724.310) (-1728.809) [-1734.045] * (-1732.414) (-1728.158) [-1721.247] (-1728.455) -- 0:00:49 Average standard deviation of split frequencies: 0.048471 20500 -- (-1728.605) (-1724.673) (-1731.341) [-1728.005] * (-1727.883) (-1727.041) (-1725.485) [-1730.395] -- 0:00:47 21000 -- [-1734.019] (-1725.846) (-1740.294) (-1736.520) * (-1734.278) (-1723.107) (-1723.743) [-1729.568] -- 0:00:46 21500 -- [-1731.391] (-1724.353) (-1735.966) (-1734.068) * (-1731.264) (-1722.942) (-1721.359) [-1735.765] -- 0:00:45 22000 -- (-1738.912) (-1725.474) (-1738.115) [-1729.610] * [-1730.688] (-1723.138) (-1723.216) (-1730.143) -- 0:00:44 22500 -- (-1733.292) (-1723.263) [-1731.762] (-1736.199) * [-1733.352] (-1723.225) (-1723.531) (-1732.921) -- 0:01:26 23000 -- [-1730.143] (-1722.862) (-1741.716) (-1739.217) * [-1733.693] (-1728.037) (-1724.744) (-1742.715) -- 0:01:24 23500 -- (-1734.181) (-1727.861) [-1730.108] (-1734.499) * [-1732.414] (-1725.390) (-1725.274) (-1736.106) -- 0:01:23 24000 -- (-1732.360) (-1725.909) (-1732.331) [-1732.340] * [-1727.294] (-1722.514) (-1724.177) (-1737.534) -- 0:01:21 24500 -- (-1735.159) [-1723.297] (-1739.214) (-1731.035) * (-1742.649) (-1725.215) [-1723.028] (-1731.725) -- 0:01:19 25000 -- (-1729.342) (-1725.612) (-1737.906) [-1724.923] * (-1736.277) (-1725.974) (-1721.843) [-1728.660] -- 0:01:18 Average standard deviation of split frequencies: 0.041701 25500 -- (-1732.905) [-1723.588] (-1732.078) (-1734.634) * (-1731.182) [-1723.674] (-1724.925) (-1733.163) -- 0:01:16 26000 -- (-1740.365) (-1724.431) (-1741.059) [-1728.864] * (-1730.977) (-1725.142) [-1723.924] (-1732.648) -- 0:01:14 26500 -- (-1731.205) (-1725.695) [-1729.277] (-1735.002) * (-1736.307) (-1727.232) [-1722.210] (-1738.006) -- 0:01:13 27000 -- (-1728.821) (-1725.228) (-1731.611) [-1730.336] * (-1731.859) (-1724.296) (-1724.939) [-1727.373] -- 0:01:12 27500 -- (-1737.626) (-1720.886) [-1731.709] (-1731.194) * [-1734.485] (-1722.298) (-1723.101) (-1731.239) -- 0:01:10 28000 -- (-1732.341) (-1722.843) (-1732.664) [-1727.943] * (-1737.274) (-1722.707) (-1723.464) [-1727.202] -- 0:01:09 28500 -- (-1729.790) [-1721.790] (-1737.318) (-1731.237) * (-1732.219) [-1723.262] (-1722.627) (-1734.738) -- 0:01:08 29000 -- [-1731.883] (-1725.411) (-1736.279) (-1746.594) * (-1730.317) (-1723.261) (-1721.370) [-1728.878] -- 0:01:06 29500 -- (-1731.526) [-1725.887] (-1735.244) (-1734.193) * (-1732.836) (-1722.883) [-1722.978] (-1730.260) -- 0:01:05 30000 -- [-1729.429] (-1725.980) (-1740.395) (-1736.170) * [-1732.477] (-1728.146) (-1721.142) (-1731.481) -- 0:01:04 Average standard deviation of split frequencies: 0.046848 30500 -- (-1737.736) (-1724.723) [-1733.632] (-1732.681) * (-1737.981) [-1724.362] (-1722.244) (-1731.001) -- 0:01:03 31000 -- (-1735.618) (-1721.785) [-1730.861] (-1731.516) * [-1735.971] (-1722.446) (-1721.945) (-1731.180) -- 0:01:02 31500 -- (-1730.277) (-1723.020) [-1737.405] (-1730.505) * (-1730.269) (-1721.159) (-1725.713) [-1727.492] -- 0:01:01 32000 -- (-1730.189) (-1723.090) (-1732.869) [-1732.046] * [-1733.301] (-1721.254) (-1724.701) (-1732.771) -- 0:01:00 32500 -- [-1724.120] (-1724.407) (-1734.173) (-1732.233) * [-1730.295] (-1722.245) (-1724.190) (-1729.400) -- 0:00:59 33000 -- (-1735.149) [-1723.324] (-1735.538) (-1732.219) * (-1731.804) (-1721.041) (-1722.083) [-1729.686] -- 0:00:58 33500 -- (-1741.969) (-1724.355) (-1731.286) [-1729.171] * [-1733.091] (-1721.963) (-1723.135) (-1731.617) -- 0:00:57 34000 -- (-1736.751) [-1722.869] (-1731.687) (-1737.631) * (-1736.490) (-1722.785) [-1722.884] (-1729.701) -- 0:00:56 34500 -- (-1740.656) [-1724.227] (-1731.642) (-1727.516) * [-1727.885] (-1724.895) (-1724.788) (-1731.722) -- 0:00:55 35000 -- (-1727.650) (-1728.484) [-1726.859] (-1735.728) * (-1727.939) [-1722.446] (-1723.787) (-1737.821) -- 0:00:55 Average standard deviation of split frequencies: 0.038037 35500 -- [-1725.491] (-1722.891) (-1725.250) (-1730.518) * (-1728.496) (-1721.297) [-1723.459] (-1748.395) -- 0:00:54 36000 -- (-1725.047) (-1724.565) [-1721.538] (-1734.102) * (-1729.731) (-1721.301) (-1721.436) [-1721.907] -- 0:00:53 36500 -- (-1725.795) (-1722.682) (-1722.241) [-1733.358] * [-1735.192] (-1723.907) (-1722.992) (-1721.831) -- 0:00:52 37000 -- (-1721.864) [-1724.904] (-1722.552) (-1739.557) * (-1742.354) (-1722.833) [-1723.047] (-1721.816) -- 0:00:52 37500 -- (-1721.690) (-1723.417) (-1725.076) [-1733.134] * (-1735.739) [-1721.713] (-1723.095) (-1724.603) -- 0:01:17 38000 -- (-1724.054) (-1723.416) (-1723.679) [-1730.712] * (-1730.411) [-1723.824] (-1723.490) (-1727.357) -- 0:01:15 38500 -- (-1723.487) [-1721.750] (-1722.277) (-1730.868) * (-1724.867) (-1724.254) [-1727.482] (-1724.116) -- 0:01:14 39000 -- (-1722.782) [-1722.858] (-1722.387) (-1736.678) * (-1731.488) (-1723.026) [-1727.361] (-1724.124) -- 0:01:13 39500 -- (-1723.467) (-1725.817) [-1723.150] (-1729.348) * [-1729.797] (-1722.792) (-1725.251) (-1724.526) -- 0:01:12 40000 -- [-1724.274] (-1721.180) (-1721.655) (-1728.994) * (-1732.185) (-1722.299) (-1724.468) [-1723.831] -- 0:01:12 Average standard deviation of split frequencies: 0.038253 40500 -- (-1720.996) (-1721.396) (-1722.447) [-1727.166] * [-1727.331] (-1722.559) (-1722.325) (-1723.731) -- 0:01:11 41000 -- (-1720.811) (-1721.496) [-1721.252] (-1746.939) * (-1731.977) (-1724.490) (-1722.029) [-1722.605] -- 0:01:10 41500 -- [-1720.811] (-1721.312) (-1722.334) (-1741.062) * (-1732.794) (-1723.068) (-1724.355) [-1722.545] -- 0:01:09 42000 -- [-1723.593] (-1721.451) (-1721.756) (-1729.875) * [-1732.157] (-1722.287) (-1722.006) (-1724.470) -- 0:01:08 42500 -- (-1722.291) (-1723.954) (-1721.836) [-1728.567] * (-1731.769) [-1722.062] (-1725.918) (-1723.356) -- 0:01:07 43000 -- (-1722.161) (-1722.953) (-1722.761) [-1733.979] * [-1733.429] (-1722.262) (-1722.444) (-1723.752) -- 0:01:06 43500 -- (-1721.855) (-1723.265) [-1722.581] (-1732.880) * (-1739.714) (-1722.030) (-1723.043) [-1723.054] -- 0:01:05 44000 -- (-1722.268) (-1722.685) (-1722.421) [-1727.253] * [-1731.754] (-1722.702) (-1724.367) (-1723.270) -- 0:01:05 44500 -- [-1722.126] (-1722.367) (-1722.998) (-1729.601) * [-1727.209] (-1723.163) (-1722.316) (-1726.274) -- 0:01:04 45000 -- (-1726.824) [-1725.001] (-1723.290) (-1745.674) * (-1739.622) (-1725.294) (-1722.264) [-1725.624] -- 0:01:03 Average standard deviation of split frequencies: 0.033863 45500 -- [-1726.831] (-1722.722) (-1721.969) (-1736.049) * (-1732.569) (-1722.811) (-1721.480) [-1722.899] -- 0:01:02 46000 -- (-1730.185) (-1722.561) [-1722.315] (-1736.801) * (-1732.260) (-1723.871) (-1722.398) [-1723.898] -- 0:01:02 46500 -- [-1722.160] (-1723.191) (-1722.040) (-1738.795) * [-1732.029] (-1723.272) (-1722.699) (-1729.639) -- 0:01:01 47000 -- (-1723.445) (-1724.832) (-1722.262) [-1728.116] * (-1730.606) (-1727.012) (-1722.778) [-1723.873] -- 0:01:00 47500 -- (-1723.588) [-1725.232] (-1725.466) (-1729.182) * (-1729.182) (-1731.609) (-1723.493) [-1724.477] -- 0:01:00 48000 -- [-1723.328] (-1723.850) (-1724.210) (-1735.862) * (-1738.918) (-1724.455) [-1722.113] (-1724.203) -- 0:00:59 48500 -- [-1722.021] (-1724.244) (-1723.432) (-1735.666) * (-1734.725) (-1725.585) (-1722.034) [-1723.699] -- 0:00:58 49000 -- (-1723.952) (-1723.547) [-1722.758] (-1736.007) * (-1730.654) (-1723.614) [-1722.193] (-1723.295) -- 0:00:58 49500 -- (-1723.939) [-1724.048] (-1721.790) (-1732.987) * [-1726.284] (-1723.843) (-1721.682) (-1725.907) -- 0:00:57 50000 -- (-1722.578) (-1723.260) (-1721.880) [-1727.581] * (-1730.018) (-1722.482) [-1721.505] (-1724.875) -- 0:00:57 Average standard deviation of split frequencies: 0.029241 50500 -- (-1721.040) (-1723.795) [-1722.682] (-1732.028) * (-1728.532) (-1723.863) [-1721.069] (-1726.301) -- 0:00:56 51000 -- (-1724.049) [-1723.946] (-1723.062) (-1733.597) * (-1735.136) [-1722.030] (-1722.266) (-1723.976) -- 0:00:55 51500 -- [-1723.998] (-1723.392) (-1722.043) (-1732.886) * (-1732.383) (-1721.455) [-1722.077] (-1723.653) -- 0:00:55 52000 -- (-1723.791) (-1725.124) [-1722.979] (-1748.183) * (-1732.641) (-1725.435) (-1721.486) [-1723.660] -- 0:00:54 52500 -- (-1721.364) [-1725.103] (-1725.909) (-1729.369) * (-1734.725) (-1727.867) (-1723.607) [-1725.556] -- 0:00:54 53000 -- [-1721.453] (-1726.520) (-1723.748) (-1734.399) * [-1730.846] (-1727.209) (-1723.606) (-1723.880) -- 0:01:11 53500 -- (-1722.199) [-1722.551] (-1726.578) (-1734.115) * (-1734.392) (-1723.527) (-1721.507) [-1723.759] -- 0:01:10 54000 -- (-1722.786) [-1721.438] (-1724.371) (-1736.063) * (-1729.801) (-1721.791) [-1721.810] (-1724.159) -- 0:01:10 54500 -- (-1721.547) (-1723.080) (-1723.616) [-1733.731] * (-1738.347) (-1721.803) [-1722.550] (-1723.328) -- 0:01:09 55000 -- (-1724.561) (-1725.468) [-1722.721] (-1737.100) * (-1726.637) (-1723.602) [-1722.504] (-1724.566) -- 0:01:08 Average standard deviation of split frequencies: 0.030465 55500 -- (-1721.913) (-1723.413) [-1721.852] (-1727.802) * [-1723.561] (-1722.738) (-1722.627) (-1722.454) -- 0:01:08 56000 -- (-1722.694) (-1726.215) [-1723.495] (-1731.956) * (-1724.791) [-1723.373] (-1721.111) (-1722.461) -- 0:01:07 56500 -- (-1721.044) (-1724.534) (-1726.552) [-1729.805] * (-1721.874) (-1721.950) [-1723.261] (-1723.961) -- 0:01:06 57000 -- (-1721.312) [-1722.849] (-1725.067) (-1733.994) * [-1722.339] (-1722.642) (-1724.966) (-1723.533) -- 0:01:06 57500 -- (-1721.294) (-1722.601) [-1723.759] (-1740.218) * [-1723.824] (-1724.683) (-1722.508) (-1722.992) -- 0:01:05 58000 -- (-1721.385) (-1721.846) [-1722.428] (-1731.771) * (-1722.376) [-1724.851] (-1727.355) (-1723.727) -- 0:01:04 58500 -- (-1722.382) (-1723.236) (-1725.269) [-1729.547] * (-1722.936) [-1723.415] (-1722.215) (-1722.908) -- 0:01:04 59000 -- [-1721.551] (-1728.579) (-1721.964) (-1726.202) * (-1722.971) [-1724.217] (-1721.812) (-1724.499) -- 0:01:03 59500 -- (-1721.725) (-1726.555) (-1722.159) [-1740.891] * (-1723.703) [-1721.846] (-1723.851) (-1721.666) -- 0:01:03 60000 -- [-1726.880] (-1724.622) (-1723.948) (-1735.610) * [-1721.558] (-1721.980) (-1726.438) (-1725.355) -- 0:01:02 Average standard deviation of split frequencies: 0.023720 60500 -- (-1725.714) (-1722.201) (-1722.133) [-1734.622] * (-1729.298) [-1722.129] (-1721.712) (-1723.094) -- 0:01:02 61000 -- (-1724.859) [-1723.122] (-1721.052) (-1759.328) * (-1722.340) (-1724.445) [-1721.595] (-1722.318) -- 0:01:01 61500 -- (-1723.273) (-1726.375) (-1723.946) [-1729.759] * (-1722.603) [-1726.435] (-1722.529) (-1720.821) -- 0:01:01 62000 -- [-1723.293] (-1721.878) (-1721.569) (-1723.018) * [-1722.603] (-1726.669) (-1722.659) (-1721.367) -- 0:01:00 62500 -- [-1722.650] (-1721.714) (-1722.378) (-1723.596) * (-1723.623) (-1725.856) [-1722.974] (-1722.700) -- 0:01:00 63000 -- (-1723.298) (-1723.198) [-1722.657] (-1723.887) * (-1724.533) [-1725.377] (-1724.413) (-1720.845) -- 0:00:59 63500 -- (-1722.000) (-1726.787) [-1724.727] (-1723.297) * (-1723.293) [-1727.006] (-1723.001) (-1722.998) -- 0:00:58 64000 -- (-1723.780) (-1721.263) [-1726.078] (-1724.232) * [-1722.452] (-1726.847) (-1724.767) (-1724.051) -- 0:00:58 64500 -- (-1728.642) (-1721.367) (-1722.756) [-1724.170] * (-1722.162) [-1723.151] (-1724.146) (-1723.742) -- 0:00:58 65000 -- (-1729.532) [-1722.724] (-1722.727) (-1723.380) * (-1722.220) [-1722.172] (-1723.893) (-1725.350) -- 0:00:57 Average standard deviation of split frequencies: 0.022856 65500 -- (-1722.898) (-1722.767) (-1722.669) [-1721.694] * (-1722.202) [-1725.671] (-1724.079) (-1725.576) -- 0:00:57 66000 -- (-1724.551) [-1722.560] (-1727.487) (-1722.889) * (-1726.029) (-1723.944) [-1723.501] (-1723.789) -- 0:00:56 66500 -- [-1723.080] (-1722.752) (-1726.479) (-1721.577) * (-1725.130) (-1721.446) (-1724.316) [-1722.671] -- 0:00:56 67000 -- (-1724.924) (-1722.326) [-1722.468] (-1721.568) * (-1722.682) [-1721.570] (-1723.192) (-1724.344) -- 0:00:55 67500 -- (-1722.128) (-1722.219) [-1721.589] (-1721.564) * [-1722.849] (-1724.768) (-1722.503) (-1721.130) -- 0:00:55 68000 -- (-1722.277) [-1721.940] (-1722.054) (-1728.732) * (-1723.013) (-1722.858) [-1721.745] (-1722.474) -- 0:00:54 68500 -- (-1722.545) [-1721.964] (-1722.628) (-1722.537) * (-1721.899) (-1725.274) [-1721.825] (-1721.126) -- 0:01:07 69000 -- (-1722.064) (-1722.571) [-1722.751] (-1722.324) * (-1725.880) (-1722.134) [-1723.350] (-1721.235) -- 0:01:07 69500 -- [-1726.125] (-1723.297) (-1721.737) (-1721.563) * (-1722.371) (-1722.617) [-1721.483] (-1723.465) -- 0:01:06 70000 -- (-1725.498) (-1723.112) (-1722.617) [-1722.088] * (-1724.090) (-1722.062) (-1727.327) [-1721.796] -- 0:01:06 Average standard deviation of split frequencies: 0.020364 70500 -- (-1728.617) (-1724.193) [-1725.755] (-1721.406) * (-1724.778) (-1721.704) (-1725.967) [-1723.329] -- 0:01:05 71000 -- [-1727.713] (-1721.947) (-1723.436) (-1722.309) * (-1727.094) (-1723.062) [-1724.910] (-1727.150) -- 0:01:05 71500 -- (-1726.822) [-1722.085] (-1723.728) (-1725.084) * (-1724.039) (-1723.150) [-1724.712] (-1722.802) -- 0:01:04 72000 -- (-1729.306) [-1721.619] (-1722.289) (-1722.362) * [-1723.347] (-1722.554) (-1726.762) (-1722.891) -- 0:01:04 72500 -- (-1724.899) [-1722.799] (-1721.637) (-1722.047) * (-1723.748) (-1722.766) [-1726.640] (-1723.777) -- 0:01:03 73000 -- (-1727.952) (-1724.994) [-1723.332] (-1722.088) * (-1722.526) (-1724.326) (-1723.473) [-1723.515] -- 0:01:03 73500 -- [-1726.846] (-1723.209) (-1724.015) (-1721.678) * (-1724.017) [-1722.571] (-1724.842) (-1723.232) -- 0:01:03 74000 -- (-1724.535) (-1724.016) [-1725.197] (-1723.632) * (-1723.030) [-1722.625] (-1722.969) (-1722.429) -- 0:01:02 74500 -- (-1722.505) (-1723.816) (-1723.225) [-1724.339] * [-1722.950] (-1723.569) (-1724.499) (-1723.194) -- 0:01:02 75000 -- [-1722.084] (-1721.444) (-1722.937) (-1722.282) * (-1723.502) (-1724.913) (-1724.193) [-1721.470] -- 0:01:01 Average standard deviation of split frequencies: 0.017629 75500 -- (-1721.455) (-1722.016) (-1723.218) [-1722.672] * (-1724.655) [-1722.519] (-1724.749) (-1722.047) -- 0:01:01 76000 -- (-1724.107) (-1724.035) (-1721.762) [-1722.496] * (-1723.459) (-1723.656) (-1724.759) [-1724.460] -- 0:01:00 76500 -- [-1724.862] (-1724.034) (-1721.641) (-1722.506) * (-1721.940) (-1721.983) (-1722.914) [-1724.595] -- 0:01:00 77000 -- (-1723.655) [-1722.493] (-1722.147) (-1723.110) * (-1722.217) [-1721.266] (-1722.951) (-1726.908) -- 0:00:59 77500 -- (-1727.562) (-1722.059) [-1720.824] (-1722.362) * (-1724.167) (-1723.350) (-1722.252) [-1724.121] -- 0:00:59 78000 -- (-1723.245) (-1721.931) (-1722.078) [-1721.695] * [-1723.012] (-1722.053) (-1723.874) (-1724.687) -- 0:00:59 78500 -- (-1722.083) [-1721.931] (-1722.004) (-1721.797) * (-1724.482) [-1722.691] (-1726.503) (-1724.262) -- 0:00:58 79000 -- (-1721.994) (-1721.332) (-1721.693) [-1722.783] * (-1726.720) [-1722.172] (-1723.260) (-1724.695) -- 0:00:58 79500 -- (-1722.869) [-1721.183] (-1723.673) (-1723.100) * (-1728.346) [-1723.071] (-1724.026) (-1722.278) -- 0:00:57 80000 -- [-1722.422] (-1721.330) (-1721.615) (-1723.274) * [-1725.202] (-1727.113) (-1722.301) (-1722.241) -- 0:00:57 Average standard deviation of split frequencies: 0.020778 80500 -- (-1721.848) [-1721.132] (-1723.555) (-1722.959) * (-1723.067) (-1722.296) (-1722.208) [-1721.840] -- 0:00:57 81000 -- (-1722.469) (-1722.227) [-1722.443] (-1723.265) * (-1726.538) (-1724.326) [-1725.171] (-1722.061) -- 0:00:56 81500 -- (-1721.716) (-1721.837) [-1723.465] (-1722.429) * (-1722.016) [-1724.382] (-1722.051) (-1722.308) -- 0:00:56 82000 -- (-1721.435) [-1721.813] (-1730.175) (-1721.747) * (-1722.026) (-1726.900) (-1722.043) [-1722.048] -- 0:00:55 82500 -- (-1722.641) [-1722.248] (-1734.168) (-1721.747) * (-1721.972) (-1726.622) (-1722.563) [-1721.834] -- 0:00:55 83000 -- (-1724.991) [-1724.351] (-1725.441) (-1721.449) * (-1727.081) (-1727.121) (-1722.739) [-1722.037] -- 0:00:55 83500 -- [-1722.989] (-1722.675) (-1729.406) (-1724.316) * (-1721.625) (-1723.630) [-1722.376] (-1721.511) -- 0:00:54 84000 -- (-1721.915) (-1722.882) (-1727.255) [-1724.502] * (-1723.319) [-1723.801] (-1723.001) (-1724.700) -- 0:01:05 84500 -- (-1721.876) [-1721.122] (-1725.826) (-1721.890) * (-1722.129) (-1725.191) [-1722.814] (-1722.561) -- 0:01:05 85000 -- (-1720.926) (-1724.116) [-1725.386] (-1722.235) * (-1721.405) [-1722.753] (-1722.633) (-1722.890) -- 0:01:04 Average standard deviation of split frequencies: 0.019041 85500 -- [-1720.923] (-1724.390) (-1733.246) (-1725.173) * [-1722.098] (-1722.704) (-1726.391) (-1723.508) -- 0:01:04 86000 -- (-1722.478) (-1725.647) [-1728.446] (-1724.056) * [-1721.550] (-1724.251) (-1726.186) (-1722.678) -- 0:01:03 86500 -- [-1723.605] (-1726.862) (-1726.274) (-1721.123) * (-1723.552) (-1722.163) (-1724.565) [-1725.007] -- 0:01:03 87000 -- (-1724.090) (-1724.060) (-1726.465) [-1723.279] * (-1722.529) [-1722.399] (-1725.611) (-1722.872) -- 0:01:02 87500 -- (-1721.483) (-1724.252) (-1727.164) [-1721.795] * (-1721.851) (-1725.482) (-1723.809) [-1721.700] -- 0:01:02 88000 -- [-1721.953] (-1723.043) (-1724.852) (-1722.154) * (-1725.309) (-1725.572) [-1724.460] (-1721.781) -- 0:01:02 88500 -- (-1725.117) (-1721.991) (-1723.053) [-1721.533] * (-1725.636) (-1728.190) [-1723.271] (-1725.309) -- 0:01:01 89000 -- (-1724.541) (-1722.427) (-1724.445) [-1722.413] * (-1725.735) (-1726.493) (-1723.380) [-1726.023] -- 0:01:01 89500 -- [-1723.491] (-1725.229) (-1723.704) (-1722.552) * (-1723.941) [-1724.019] (-1722.909) (-1726.195) -- 0:01:01 90000 -- (-1725.135) (-1725.643) [-1722.680] (-1721.829) * [-1721.995] (-1725.721) (-1722.527) (-1724.051) -- 0:01:00 Average standard deviation of split frequencies: 0.017418 90500 -- (-1724.324) [-1725.113] (-1721.690) (-1721.816) * (-1722.807) (-1721.708) (-1724.161) [-1723.698] -- 0:01:00 91000 -- (-1725.206) (-1721.573) [-1723.795] (-1722.920) * (-1722.857) [-1722.585] (-1723.331) (-1722.514) -- 0:00:59 91500 -- (-1724.176) (-1722.402) (-1724.641) [-1723.272] * (-1726.485) (-1725.827) [-1725.128] (-1722.478) -- 0:00:59 92000 -- (-1725.213) [-1722.333] (-1722.392) (-1722.812) * (-1722.608) (-1723.524) (-1722.605) [-1722.977] -- 0:00:59 92500 -- (-1724.884) (-1722.607) (-1722.549) [-1723.239] * (-1722.060) (-1723.167) (-1723.152) [-1726.577] -- 0:00:58 93000 -- (-1724.412) [-1725.100] (-1723.987) (-1725.951) * (-1722.692) (-1724.188) [-1723.678] (-1721.617) -- 0:00:58 93500 -- (-1722.008) (-1722.583) [-1721.126] (-1722.650) * (-1721.606) (-1724.468) [-1723.476] (-1725.443) -- 0:00:58 94000 -- [-1721.971] (-1721.647) (-1722.128) (-1723.409) * [-1721.724] (-1722.609) (-1722.123) (-1724.218) -- 0:00:57 94500 -- (-1721.971) (-1723.172) (-1722.759) [-1726.545] * (-1721.428) (-1723.064) [-1727.294] (-1723.217) -- 0:00:57 95000 -- (-1724.238) (-1722.757) (-1723.220) [-1722.512] * (-1726.051) (-1722.665) (-1722.483) [-1721.983] -- 0:00:57 Average standard deviation of split frequencies: 0.016282 95500 -- (-1722.986) [-1722.665] (-1724.101) (-1722.478) * (-1727.345) [-1722.291] (-1722.185) (-1725.599) -- 0:00:56 96000 -- [-1722.981] (-1721.931) (-1724.108) (-1730.170) * (-1727.822) (-1721.597) [-1722.840] (-1721.762) -- 0:00:56 96500 -- (-1724.441) (-1726.014) [-1723.302] (-1732.574) * (-1723.885) (-1724.100) (-1726.624) [-1724.665] -- 0:00:56 97000 -- (-1723.675) (-1724.052) [-1722.202] (-1724.067) * (-1723.838) [-1724.238] (-1722.527) (-1723.582) -- 0:00:55 97500 -- (-1725.937) [-1723.441] (-1724.999) (-1725.300) * [-1724.223] (-1722.281) (-1723.039) (-1723.180) -- 0:00:55 98000 -- (-1720.990) [-1723.971] (-1722.943) (-1723.631) * (-1724.843) (-1722.577) (-1721.382) [-1721.934] -- 0:00:55 98500 -- (-1725.760) (-1725.669) [-1722.799] (-1723.602) * (-1724.527) (-1722.777) (-1722.200) [-1723.282] -- 0:00:54 99000 -- (-1724.998) [-1721.557] (-1723.291) (-1723.137) * (-1725.338) [-1721.472] (-1723.893) (-1722.206) -- 0:00:54 99500 -- (-1722.773) (-1724.561) [-1723.329] (-1727.808) * (-1723.991) (-1723.675) [-1722.855] (-1721.661) -- 0:01:03 100000 -- (-1722.962) [-1723.222] (-1724.091) (-1724.104) * [-1724.533] (-1721.858) (-1722.742) (-1724.994) -- 0:01:02 Average standard deviation of split frequencies: 0.014569 100500 -- (-1721.389) (-1723.825) [-1722.886] (-1725.244) * (-1723.957) (-1721.409) (-1721.591) [-1723.317] -- 0:01:02 101000 -- [-1721.457] (-1722.661) (-1723.454) (-1723.516) * (-1723.512) (-1725.719) [-1721.418] (-1723.109) -- 0:01:02 101500 -- (-1722.391) (-1721.126) (-1724.636) [-1725.208] * (-1724.700) [-1722.544] (-1723.293) (-1721.168) -- 0:01:01 102000 -- (-1722.612) [-1723.008] (-1722.491) (-1727.580) * [-1723.250] (-1724.207) (-1721.449) (-1721.364) -- 0:01:01 102500 -- [-1723.089] (-1722.101) (-1722.197) (-1725.882) * (-1722.909) (-1725.445) [-1722.722] (-1721.056) -- 0:01:01 103000 -- (-1724.010) [-1721.804] (-1722.556) (-1723.288) * [-1723.374] (-1723.250) (-1722.739) (-1727.474) -- 0:01:00 103500 -- (-1724.987) (-1723.376) [-1725.025] (-1721.537) * (-1720.990) (-1723.956) [-1725.202] (-1724.850) -- 0:01:00 104000 -- (-1724.998) (-1723.779) [-1722.799] (-1723.952) * (-1722.089) (-1722.695) (-1723.068) [-1723.893] -- 0:01:00 104500 -- (-1723.433) [-1724.661] (-1721.612) (-1723.380) * (-1726.013) (-1721.658) [-1723.096] (-1724.589) -- 0:00:59 105000 -- (-1724.448) (-1724.061) [-1721.685] (-1723.576) * (-1729.485) (-1724.532) (-1721.799) [-1727.081] -- 0:00:59 Average standard deviation of split frequencies: 0.014231 105500 -- (-1723.233) (-1726.788) (-1725.493) [-1723.229] * (-1726.128) (-1723.904) (-1721.815) [-1724.604] -- 0:00:59 106000 -- (-1723.386) (-1729.922) (-1721.431) [-1723.240] * (-1724.225) (-1722.986) (-1724.158) [-1723.947] -- 0:00:59 106500 -- [-1722.032] (-1728.207) (-1721.122) (-1723.754) * (-1723.669) (-1724.016) (-1724.632) [-1724.216] -- 0:00:58 107000 -- (-1723.223) [-1722.759] (-1721.122) (-1722.825) * (-1734.089) [-1722.924] (-1722.361) (-1721.261) -- 0:00:58 107500 -- (-1722.984) (-1721.521) (-1721.708) [-1721.798] * (-1726.151) (-1722.638) [-1723.124] (-1722.814) -- 0:00:58 108000 -- (-1721.366) (-1724.549) [-1721.691] (-1723.500) * (-1729.505) [-1722.488] (-1721.666) (-1721.390) -- 0:00:57 108500 -- (-1721.216) (-1725.841) (-1722.906) [-1721.460] * (-1722.582) (-1726.107) [-1721.667] (-1721.547) -- 0:00:57 109000 -- (-1721.215) (-1722.484) (-1723.355) [-1721.784] * (-1722.366) (-1725.010) (-1726.757) [-1721.330] -- 0:00:57 109500 -- [-1721.204] (-1721.741) (-1723.362) (-1721.713) * (-1722.599) (-1723.949) (-1722.984) [-1721.442] -- 0:00:56 110000 -- [-1721.673] (-1721.930) (-1723.299) (-1721.715) * (-1722.887) (-1722.630) (-1723.772) [-1723.374] -- 0:00:56 Average standard deviation of split frequencies: 0.015010 110500 -- [-1722.405] (-1721.464) (-1722.253) (-1725.750) * [-1723.280] (-1723.080) (-1722.251) (-1726.076) -- 0:00:56 111000 -- (-1724.100) [-1721.532] (-1722.696) (-1723.160) * (-1723.307) (-1722.023) [-1722.003] (-1723.417) -- 0:00:56 111500 -- (-1727.840) (-1722.679) [-1722.647] (-1723.447) * (-1724.855) (-1722.048) [-1722.986] (-1729.373) -- 0:00:55 112000 -- (-1723.874) (-1723.576) [-1722.147] (-1723.959) * [-1724.064] (-1721.761) (-1723.094) (-1723.498) -- 0:00:55 112500 -- (-1726.588) (-1724.222) (-1724.368) [-1728.170] * (-1725.134) (-1722.343) [-1723.350] (-1722.332) -- 0:00:55 113000 -- [-1725.235] (-1722.154) (-1724.151) (-1724.326) * (-1727.442) (-1724.562) (-1724.709) [-1723.029] -- 0:00:54 113500 -- (-1722.618) (-1725.246) (-1727.076) [-1722.768] * (-1723.690) [-1724.046] (-1726.293) (-1725.091) -- 0:00:54 114000 -- [-1721.139] (-1722.751) (-1723.602) (-1722.022) * [-1723.294] (-1722.665) (-1726.880) (-1725.727) -- 0:00:54 114500 -- [-1722.218] (-1722.689) (-1723.338) (-1722.811) * (-1723.668) [-1722.417] (-1733.204) (-1725.246) -- 0:00:54 115000 -- (-1721.910) (-1724.622) (-1722.879) [-1723.148] * (-1723.669) (-1722.337) [-1729.790] (-1730.734) -- 0:00:53 Average standard deviation of split frequencies: 0.015443 115500 -- [-1722.893] (-1726.370) (-1723.275) (-1722.543) * [-1724.417] (-1724.970) (-1725.273) (-1726.587) -- 0:01:01 116000 -- (-1722.175) [-1724.163] (-1724.989) (-1724.488) * (-1723.239) (-1724.253) [-1724.240] (-1725.382) -- 0:01:00 116500 -- (-1722.296) [-1723.350] (-1724.530) (-1722.515) * (-1724.665) [-1722.066] (-1724.784) (-1720.894) -- 0:01:00 117000 -- (-1722.385) (-1723.207) (-1725.861) [-1724.343] * (-1724.592) (-1722.055) (-1724.436) [-1724.012] -- 0:01:00 117500 -- (-1722.217) (-1723.585) (-1725.945) [-1724.320] * (-1724.033) (-1721.151) [-1724.884] (-1723.562) -- 0:01:00 118000 -- [-1723.477] (-1723.251) (-1724.152) (-1723.268) * (-1724.422) (-1724.173) [-1723.087] (-1723.679) -- 0:00:59 118500 -- (-1723.251) [-1726.677] (-1725.033) (-1726.714) * (-1725.166) (-1721.853) [-1723.428] (-1726.760) -- 0:00:59 119000 -- (-1726.226) (-1723.269) [-1721.679] (-1724.455) * (-1723.485) (-1721.929) (-1722.984) [-1728.264] -- 0:00:59 119500 -- (-1724.052) (-1722.277) [-1721.031] (-1721.041) * (-1725.848) (-1722.053) [-1723.395] (-1727.163) -- 0:00:58 120000 -- (-1723.999) (-1722.742) [-1722.476] (-1721.297) * [-1725.081] (-1721.618) (-1724.586) (-1722.524) -- 0:00:58 Average standard deviation of split frequencies: 0.014599 120500 -- (-1724.162) (-1723.810) [-1721.869] (-1721.030) * [-1722.568] (-1721.429) (-1723.234) (-1723.164) -- 0:00:58 121000 -- [-1724.714] (-1722.080) (-1721.385) (-1722.913) * (-1722.259) [-1722.121] (-1723.226) (-1723.518) -- 0:00:58 121500 -- (-1725.637) [-1723.388] (-1723.140) (-1728.077) * [-1721.986] (-1725.054) (-1723.332) (-1724.064) -- 0:00:57 122000 -- (-1724.598) [-1723.397] (-1721.252) (-1722.963) * (-1722.149) [-1723.498] (-1723.090) (-1724.344) -- 0:00:57 122500 -- (-1724.342) (-1722.778) (-1722.702) [-1721.583] * (-1723.139) (-1721.109) [-1721.164] (-1722.523) -- 0:00:57 123000 -- (-1727.650) (-1723.159) [-1722.155] (-1723.046) * [-1723.517] (-1721.154) (-1722.941) (-1724.019) -- 0:00:57 123500 -- (-1722.707) (-1724.354) [-1724.462] (-1727.887) * (-1724.437) (-1725.206) [-1721.695] (-1724.685) -- 0:00:56 124000 -- (-1723.527) (-1724.729) (-1724.058) [-1725.899] * (-1722.816) (-1722.850) (-1727.866) [-1724.129] -- 0:00:56 124500 -- [-1724.019] (-1725.084) (-1725.455) (-1722.912) * (-1722.256) (-1721.513) (-1723.639) [-1723.415] -- 0:00:56 125000 -- (-1723.246) (-1724.159) (-1724.482) [-1723.146] * (-1721.227) (-1722.820) (-1723.221) [-1722.627] -- 0:00:56 Average standard deviation of split frequencies: 0.018894 125500 -- (-1729.884) [-1724.452] (-1727.366) (-1723.298) * (-1722.964) (-1722.914) [-1721.797] (-1723.635) -- 0:00:55 126000 -- (-1725.591) [-1724.644] (-1724.853) (-1721.519) * (-1721.674) (-1721.030) [-1722.427] (-1723.725) -- 0:00:55 126500 -- (-1725.591) (-1725.843) [-1723.045] (-1721.519) * (-1722.201) [-1722.094] (-1722.051) (-1721.916) -- 0:00:55 127000 -- (-1724.284) (-1724.506) [-1722.638] (-1721.452) * [-1724.650] (-1721.349) (-1722.636) (-1723.507) -- 0:00:54 127500 -- (-1725.680) (-1722.647) (-1725.457) [-1723.534] * (-1725.211) [-1725.699] (-1722.638) (-1724.236) -- 0:00:54 128000 -- (-1727.649) [-1721.996] (-1725.569) (-1721.102) * [-1724.173] (-1722.292) (-1725.464) (-1724.315) -- 0:00:54 128500 -- (-1732.937) (-1727.175) (-1734.308) [-1721.226] * (-1723.621) (-1724.714) (-1721.836) [-1723.364] -- 0:00:54 129000 -- [-1726.182] (-1724.773) (-1728.601) (-1724.169) * (-1723.301) (-1723.392) (-1722.269) [-1722.768] -- 0:00:54 129500 -- (-1727.972) [-1725.311] (-1724.532) (-1724.496) * (-1723.225) [-1723.394] (-1724.430) (-1723.461) -- 0:00:53 130000 -- (-1733.058) (-1721.590) [-1723.816] (-1724.851) * (-1723.834) (-1721.977) [-1721.596] (-1724.999) -- 0:00:53 Average standard deviation of split frequencies: 0.017036 130500 -- (-1724.462) (-1721.650) (-1722.306) [-1725.155] * [-1722.851] (-1724.290) (-1721.991) (-1722.516) -- 0:00:53 131000 -- (-1724.229) (-1721.445) (-1722.298) [-1724.003] * (-1722.705) (-1724.246) [-1721.857] (-1723.771) -- 0:00:59 131500 -- (-1724.239) [-1721.552] (-1726.554) (-1725.145) * (-1727.000) [-1722.186] (-1721.492) (-1721.645) -- 0:00:59 132000 -- [-1722.946] (-1724.049) (-1726.738) (-1724.567) * (-1722.767) [-1723.127] (-1723.947) (-1722.050) -- 0:00:59 132500 -- (-1722.527) [-1722.419] (-1722.623) (-1724.434) * (-1726.065) (-1723.450) (-1724.685) [-1722.526] -- 0:00:58 133000 -- (-1723.598) (-1721.537) (-1722.712) [-1722.630] * (-1723.567) [-1723.573] (-1725.982) (-1721.844) -- 0:00:58 133500 -- (-1722.223) (-1722.332) (-1726.978) [-1722.593] * (-1722.493) [-1724.623] (-1725.415) (-1723.932) -- 0:00:58 134000 -- (-1725.406) [-1722.601] (-1727.872) (-1725.153) * (-1722.671) (-1727.837) (-1723.484) [-1722.063] -- 0:00:58 134500 -- (-1723.206) (-1722.363) [-1721.123] (-1722.636) * (-1722.600) (-1722.526) (-1725.906) [-1722.717] -- 0:00:57 135000 -- (-1722.745) (-1722.472) [-1721.824] (-1723.328) * (-1722.952) (-1721.834) [-1721.530] (-1722.322) -- 0:00:57 Average standard deviation of split frequencies: 0.016946 135500 -- (-1722.554) (-1723.372) [-1722.495] (-1720.976) * (-1723.621) [-1723.096] (-1722.919) (-1724.189) -- 0:00:57 136000 -- [-1722.249] (-1723.237) (-1722.544) (-1721.511) * [-1722.236] (-1726.223) (-1720.839) (-1723.460) -- 0:00:57 136500 -- (-1721.637) [-1723.901] (-1723.294) (-1723.726) * (-1723.612) (-1725.456) (-1723.919) [-1722.217] -- 0:00:56 137000 -- (-1721.997) (-1721.900) [-1721.199] (-1721.139) * (-1722.126) (-1722.113) [-1722.913] (-1722.780) -- 0:00:56 137500 -- [-1721.091] (-1726.936) (-1721.581) (-1722.283) * (-1722.070) (-1722.113) [-1722.001] (-1726.875) -- 0:00:56 138000 -- (-1721.830) [-1723.828] (-1723.893) (-1727.888) * (-1724.779) (-1721.007) [-1724.412] (-1721.798) -- 0:00:56 138500 -- (-1722.168) (-1721.904) [-1721.213] (-1721.747) * [-1722.522] (-1726.937) (-1721.333) (-1725.537) -- 0:00:55 139000 -- (-1722.632) [-1721.716] (-1722.148) (-1723.045) * (-1721.318) (-1724.723) (-1721.202) [-1723.743] -- 0:00:55 139500 -- (-1721.748) [-1722.523] (-1721.694) (-1726.799) * [-1722.691] (-1723.530) (-1724.393) (-1726.900) -- 0:00:55 140000 -- (-1723.785) (-1721.959) [-1721.136] (-1724.533) * (-1724.683) (-1722.666) [-1721.998] (-1725.504) -- 0:00:55 Average standard deviation of split frequencies: 0.017285 140500 -- (-1724.011) [-1722.271] (-1721.626) (-1722.186) * (-1722.980) (-1722.666) (-1721.896) [-1730.603] -- 0:00:55 141000 -- (-1723.145) [-1722.647] (-1721.626) (-1725.728) * [-1725.570] (-1721.100) (-1722.004) (-1724.587) -- 0:00:54 141500 -- (-1721.816) (-1721.408) [-1722.184] (-1725.177) * [-1721.443] (-1721.372) (-1721.330) (-1722.946) -- 0:00:54 142000 -- (-1721.467) [-1722.300] (-1722.060) (-1722.554) * (-1726.104) (-1721.510) [-1721.599] (-1722.457) -- 0:00:54 142500 -- (-1721.348) (-1722.016) (-1723.973) [-1721.326] * [-1726.206] (-1721.346) (-1722.627) (-1726.810) -- 0:00:54 143000 -- (-1728.734) (-1723.428) [-1722.580] (-1722.058) * [-1725.029] (-1720.944) (-1723.018) (-1725.197) -- 0:00:53 143500 -- (-1723.594) (-1725.717) (-1723.422) [-1723.739] * (-1723.779) [-1721.487] (-1721.571) (-1723.822) -- 0:00:53 144000 -- [-1722.202] (-1728.749) (-1723.986) (-1723.298) * [-1723.923] (-1722.712) (-1722.129) (-1721.382) -- 0:00:53 144500 -- (-1724.267) (-1728.376) [-1722.259] (-1723.487) * (-1724.670) [-1722.374] (-1721.970) (-1721.866) -- 0:00:53 145000 -- (-1725.218) (-1726.918) [-1722.895] (-1721.185) * [-1722.168] (-1722.187) (-1722.795) (-1722.632) -- 0:00:53 Average standard deviation of split frequencies: 0.015634 145500 -- (-1724.015) [-1724.281] (-1724.574) (-1721.212) * (-1721.059) [-1722.303] (-1721.887) (-1724.119) -- 0:00:52 146000 -- [-1723.647] (-1721.245) (-1723.993) (-1723.519) * (-1721.657) (-1724.276) (-1722.292) [-1723.077] -- 0:00:52 146500 -- (-1728.151) (-1721.840) [-1722.761] (-1722.844) * (-1721.234) (-1723.573) [-1722.927] (-1721.395) -- 0:00:52 147000 -- [-1724.601] (-1723.606) (-1726.420) (-1721.844) * (-1721.197) (-1722.493) (-1725.058) [-1724.212] -- 0:00:58 147500 -- (-1724.577) (-1721.708) [-1723.296] (-1722.973) * [-1727.026] (-1721.289) (-1721.726) (-1723.531) -- 0:00:57 148000 -- (-1723.376) (-1723.599) [-1723.246] (-1723.247) * (-1723.784) (-1721.900) (-1726.410) [-1723.380] -- 0:00:57 148500 -- (-1722.188) (-1726.512) (-1724.634) [-1721.488] * (-1723.438) (-1721.754) [-1723.192] (-1721.980) -- 0:00:57 149000 -- (-1722.406) (-1726.460) [-1724.644] (-1727.257) * (-1724.223) (-1721.702) [-1730.930] (-1726.319) -- 0:00:57 149500 -- (-1721.651) (-1722.401) [-1722.475] (-1722.228) * (-1723.202) (-1723.728) [-1723.640] (-1725.571) -- 0:00:56 150000 -- [-1722.965] (-1722.926) (-1722.274) (-1723.494) * (-1724.877) (-1723.198) [-1723.200] (-1723.733) -- 0:00:56 Average standard deviation of split frequencies: 0.015809 150500 -- [-1724.805] (-1721.912) (-1721.015) (-1723.317) * (-1723.012) [-1721.487] (-1722.641) (-1723.536) -- 0:00:56 151000 -- (-1722.222) (-1721.679) (-1721.825) [-1723.018] * (-1721.659) (-1722.145) [-1722.661] (-1722.254) -- 0:00:56 151500 -- (-1721.513) (-1722.918) [-1722.592] (-1725.078) * (-1723.235) (-1722.781) (-1724.311) [-1721.814] -- 0:00:56 152000 -- (-1721.392) (-1722.187) (-1722.569) [-1721.023] * (-1724.079) (-1722.048) [-1721.724] (-1722.956) -- 0:00:55 152500 -- (-1723.071) [-1725.173] (-1722.506) (-1722.383) * [-1722.910] (-1722.048) (-1721.691) (-1723.159) -- 0:00:55 153000 -- (-1722.918) [-1725.173] (-1721.555) (-1726.924) * (-1723.049) (-1723.793) (-1721.937) [-1722.679] -- 0:00:55 153500 -- (-1723.514) [-1724.407] (-1721.511) (-1727.017) * (-1724.836) (-1722.526) [-1722.827] (-1723.005) -- 0:00:55 154000 -- [-1722.098] (-1726.480) (-1721.546) (-1730.110) * (-1726.844) (-1722.033) (-1722.963) [-1720.937] -- 0:00:54 154500 -- (-1722.834) (-1727.761) [-1722.439] (-1724.284) * [-1721.540] (-1723.518) (-1723.958) (-1723.094) -- 0:00:54 155000 -- [-1723.459] (-1724.504) (-1723.341) (-1723.513) * (-1722.116) (-1721.879) (-1723.798) [-1721.407] -- 0:00:54 Average standard deviation of split frequencies: 0.015109 155500 -- (-1725.512) (-1724.220) [-1725.510] (-1723.510) * (-1722.146) (-1726.733) (-1725.949) [-1721.367] -- 0:00:54 156000 -- (-1724.377) (-1724.174) (-1729.317) [-1722.214] * (-1725.028) (-1726.723) [-1724.981] (-1721.751) -- 0:00:54 156500 -- [-1721.926] (-1723.280) (-1730.486) (-1727.578) * (-1723.481) (-1730.215) (-1723.788) [-1724.799] -- 0:00:53 157000 -- (-1721.251) [-1725.693] (-1724.990) (-1728.698) * [-1722.418] (-1722.799) (-1724.050) (-1729.504) -- 0:00:53 157500 -- (-1721.357) (-1724.061) [-1724.206] (-1729.162) * (-1723.604) (-1721.281) [-1725.704] (-1724.700) -- 0:00:53 158000 -- (-1721.626) (-1724.375) [-1722.325] (-1721.856) * (-1728.366) [-1722.633] (-1721.775) (-1722.925) -- 0:00:53 158500 -- (-1721.976) (-1726.420) (-1722.333) [-1725.667] * (-1728.677) [-1721.233] (-1723.265) (-1723.684) -- 0:00:53 159000 -- (-1721.192) [-1723.506] (-1722.679) (-1722.583) * (-1726.832) (-1722.199) (-1723.226) [-1723.533] -- 0:00:52 159500 -- [-1721.543] (-1727.270) (-1722.650) (-1721.758) * (-1723.621) (-1724.534) (-1723.555) [-1723.574] -- 0:00:52 160000 -- [-1724.641] (-1724.026) (-1722.494) (-1721.935) * (-1721.753) [-1723.333] (-1726.132) (-1724.605) -- 0:00:52 Average standard deviation of split frequencies: 0.016789 160500 -- (-1721.780) (-1721.918) (-1722.667) [-1723.326] * [-1721.675] (-1726.460) (-1726.150) (-1721.853) -- 0:00:52 161000 -- (-1723.423) (-1721.949) [-1721.382] (-1722.443) * (-1723.283) (-1726.423) [-1731.536] (-1722.242) -- 0:00:52 161500 -- (-1723.775) (-1721.960) [-1721.690] (-1724.229) * (-1724.105) (-1722.191) (-1728.802) [-1722.263] -- 0:00:51 162000 -- (-1723.814) (-1722.487) [-1724.972] (-1721.386) * [-1721.685] (-1722.641) (-1724.422) (-1725.087) -- 0:00:51 162500 -- (-1723.670) [-1722.764] (-1721.028) (-1721.468) * [-1721.885] (-1727.790) (-1722.102) (-1727.600) -- 0:00:56 163000 -- (-1722.328) (-1722.578) (-1726.857) [-1721.542] * (-1724.783) (-1726.510) [-1722.306] (-1724.042) -- 0:00:56 163500 -- [-1722.216] (-1721.714) (-1727.716) (-1722.350) * (-1725.059) (-1723.087) [-1722.611] (-1722.493) -- 0:00:56 164000 -- (-1726.855) [-1723.025] (-1724.101) (-1723.799) * (-1723.497) (-1721.315) (-1722.641) [-1722.727] -- 0:00:56 164500 -- (-1722.880) (-1722.638) [-1723.845] (-1721.392) * (-1722.759) (-1724.621) (-1723.016) [-1722.727] -- 0:00:55 165000 -- (-1722.340) [-1721.695] (-1723.349) (-1724.234) * (-1723.929) [-1721.083] (-1722.676) (-1725.959) -- 0:00:55 Average standard deviation of split frequencies: 0.018301 165500 -- [-1722.977] (-1722.941) (-1721.204) (-1727.275) * (-1722.541) (-1724.265) [-1723.509] (-1724.639) -- 0:00:55 166000 -- (-1721.122) [-1723.123] (-1721.219) (-1723.179) * [-1722.135] (-1723.121) (-1722.368) (-1723.399) -- 0:00:55 166500 -- [-1722.421] (-1722.622) (-1722.590) (-1722.595) * (-1723.190) (-1726.223) [-1722.589] (-1724.000) -- 0:00:55 167000 -- (-1722.867) [-1722.962] (-1723.362) (-1721.472) * (-1724.862) (-1724.327) (-1722.991) [-1723.999] -- 0:00:54 167500 -- [-1728.601] (-1724.132) (-1725.269) (-1723.311) * (-1721.601) (-1727.626) [-1721.570] (-1725.388) -- 0:00:54 168000 -- (-1727.243) (-1722.557) [-1722.764] (-1722.230) * (-1721.746) [-1722.920] (-1721.806) (-1725.126) -- 0:00:54 168500 -- [-1722.242] (-1722.157) (-1723.761) (-1723.338) * (-1723.408) [-1723.475] (-1721.554) (-1725.131) -- 0:00:54 169000 -- (-1723.350) (-1722.608) [-1722.125] (-1722.088) * (-1722.391) (-1723.422) (-1721.885) [-1725.454] -- 0:00:54 169500 -- (-1722.851) (-1722.110) [-1722.240] (-1722.123) * (-1723.766) (-1722.269) [-1722.863] (-1724.358) -- 0:00:53 170000 -- [-1723.319] (-1722.231) (-1722.237) (-1723.562) * (-1722.809) (-1724.205) [-1723.031] (-1724.971) -- 0:00:53 Average standard deviation of split frequencies: 0.019916 170500 -- (-1723.448) [-1723.486] (-1722.232) (-1725.396) * (-1724.450) (-1721.634) [-1722.606] (-1724.932) -- 0:00:53 171000 -- (-1722.406) (-1723.395) (-1721.658) [-1723.910] * [-1724.691] (-1724.765) (-1721.912) (-1724.101) -- 0:00:53 171500 -- (-1723.077) [-1723.529] (-1723.526) (-1723.844) * (-1724.374) (-1721.041) [-1722.716] (-1723.574) -- 0:00:53 172000 -- (-1722.602) [-1722.610] (-1722.798) (-1723.014) * (-1724.936) (-1723.495) [-1722.434] (-1725.093) -- 0:00:52 172500 -- (-1721.850) [-1722.458] (-1723.319) (-1721.367) * (-1725.322) (-1721.894) (-1721.832) [-1723.218] -- 0:00:52 173000 -- (-1721.014) [-1721.791] (-1723.560) (-1722.998) * (-1721.489) [-1721.153] (-1721.320) (-1723.293) -- 0:00:52 173500 -- (-1722.654) [-1721.715] (-1723.804) (-1724.262) * (-1721.022) (-1723.124) [-1723.043] (-1722.065) -- 0:00:52 174000 -- (-1724.385) (-1722.588) [-1723.385] (-1723.755) * (-1721.588) [-1722.130] (-1722.086) (-1723.106) -- 0:00:52 174500 -- (-1723.070) (-1722.747) [-1722.281] (-1721.774) * [-1722.185] (-1724.443) (-1725.611) (-1721.227) -- 0:00:52 175000 -- [-1721.350] (-1726.999) (-1722.531) (-1722.163) * (-1722.378) [-1722.363] (-1724.527) (-1721.336) -- 0:00:51 Average standard deviation of split frequencies: 0.019642 175500 -- (-1722.493) [-1721.058] (-1724.204) (-1722.573) * (-1722.800) (-1723.052) [-1724.216] (-1724.889) -- 0:00:51 176000 -- (-1725.458) (-1722.187) (-1722.553) [-1723.194] * [-1724.458] (-1722.473) (-1721.768) (-1724.117) -- 0:00:51 176500 -- (-1721.446) (-1721.936) [-1721.855] (-1723.086) * (-1722.787) (-1723.185) [-1721.694] (-1721.653) -- 0:00:51 177000 -- (-1726.606) (-1723.464) (-1721.918) [-1722.635] * [-1721.814] (-1726.270) (-1722.940) (-1722.832) -- 0:00:51 177500 -- [-1723.856] (-1723.914) (-1724.385) (-1722.078) * (-1722.290) (-1725.848) [-1722.729] (-1722.636) -- 0:00:50 178000 -- [-1726.379] (-1726.030) (-1723.235) (-1723.773) * (-1722.190) (-1725.709) (-1725.547) [-1722.412] -- 0:00:55 178500 -- (-1726.093) (-1724.440) [-1726.471] (-1724.603) * [-1723.701] (-1727.569) (-1727.187) (-1723.650) -- 0:00:55 179000 -- (-1725.052) (-1725.946) [-1723.686] (-1724.386) * [-1722.922] (-1722.987) (-1724.309) (-1722.759) -- 0:00:55 179500 -- (-1724.585) (-1722.585) [-1722.948] (-1724.293) * (-1722.367) (-1723.877) [-1725.238] (-1725.349) -- 0:00:54 180000 -- (-1722.899) [-1722.229] (-1722.467) (-1725.043) * [-1722.564] (-1727.007) (-1724.859) (-1725.739) -- 0:00:54 Average standard deviation of split frequencies: 0.019913 180500 -- (-1723.078) [-1724.177] (-1721.539) (-1727.154) * (-1725.173) (-1726.030) [-1723.937] (-1726.902) -- 0:00:54 181000 -- (-1722.930) (-1722.684) [-1722.021] (-1723.049) * (-1722.056) [-1723.149] (-1723.852) (-1727.253) -- 0:00:54 181500 -- (-1724.313) [-1722.774] (-1722.648) (-1723.135) * (-1721.211) [-1725.611] (-1728.901) (-1729.025) -- 0:00:54 182000 -- [-1724.395] (-1725.437) (-1721.945) (-1723.232) * (-1721.304) (-1723.045) (-1725.956) [-1726.213] -- 0:00:53 182500 -- [-1725.466] (-1721.704) (-1725.699) (-1725.811) * (-1723.715) (-1726.330) (-1725.660) [-1725.616] -- 0:00:53 183000 -- (-1722.741) (-1722.218) (-1725.028) [-1728.905] * [-1722.146] (-1727.146) (-1722.238) (-1723.985) -- 0:00:53 183500 -- (-1722.746) (-1724.126) [-1727.283] (-1724.021) * (-1722.140) (-1724.062) (-1722.263) [-1721.376] -- 0:00:53 184000 -- (-1724.347) (-1722.446) (-1725.890) [-1722.104] * (-1721.693) (-1723.716) [-1722.339] (-1720.791) -- 0:00:53 184500 -- (-1726.030) [-1722.193] (-1723.101) (-1722.360) * (-1722.343) [-1722.590] (-1722.777) (-1721.153) -- 0:00:53 185000 -- (-1725.118) (-1722.199) [-1723.128] (-1722.398) * (-1723.437) (-1723.558) (-1722.039) [-1721.134] -- 0:00:52 Average standard deviation of split frequencies: 0.018141 185500 -- (-1722.671) (-1721.743) (-1721.677) [-1722.759] * [-1721.880] (-1722.976) (-1722.340) (-1720.836) -- 0:00:52 186000 -- (-1722.501) [-1723.160] (-1721.328) (-1722.956) * [-1722.146] (-1722.592) (-1722.446) (-1720.834) -- 0:00:52 186500 -- [-1723.143] (-1723.601) (-1722.678) (-1722.047) * [-1721.589] (-1722.645) (-1721.741) (-1721.090) -- 0:00:52 187000 -- (-1725.040) (-1724.324) [-1725.696] (-1723.986) * (-1728.999) (-1725.534) (-1722.164) [-1722.003] -- 0:00:52 187500 -- (-1727.175) (-1722.654) (-1729.166) [-1724.356] * (-1723.435) (-1724.493) (-1721.911) [-1721.442] -- 0:00:52 188000 -- [-1728.186] (-1721.774) (-1722.631) (-1730.601) * [-1723.856] (-1724.775) (-1723.587) (-1722.021) -- 0:00:51 188500 -- (-1728.066) (-1721.917) (-1726.368) [-1727.694] * (-1725.735) (-1723.049) [-1722.668] (-1721.621) -- 0:00:51 189000 -- (-1725.166) (-1722.180) [-1723.553] (-1723.758) * [-1723.892] (-1723.514) (-1725.326) (-1723.137) -- 0:00:51 189500 -- (-1727.001) [-1724.216] (-1725.983) (-1722.525) * (-1723.578) (-1722.949) [-1727.292] (-1723.296) -- 0:00:51 190000 -- [-1724.984] (-1724.659) (-1724.474) (-1721.402) * (-1722.551) [-1721.851] (-1726.398) (-1723.096) -- 0:00:51 Average standard deviation of split frequencies: 0.018218 190500 -- (-1730.100) (-1725.844) [-1725.763] (-1721.002) * (-1723.222) [-1721.243] (-1725.462) (-1724.165) -- 0:00:50 191000 -- (-1724.148) (-1723.384) [-1723.504] (-1723.445) * (-1722.448) (-1721.243) (-1725.263) [-1722.765] -- 0:00:50 191500 -- (-1722.943) (-1728.717) (-1722.732) [-1725.266] * (-1724.172) [-1721.062] (-1724.278) (-1722.859) -- 0:00:50 192000 -- (-1722.359) [-1724.630] (-1724.570) (-1721.053) * (-1724.182) (-1721.535) [-1724.514] (-1725.257) -- 0:00:50 192500 -- (-1721.819) [-1721.970] (-1727.960) (-1720.986) * [-1723.675] (-1721.535) (-1722.399) (-1728.240) -- 0:00:50 193000 -- [-1721.760] (-1726.776) (-1727.292) (-1720.868) * (-1727.375) (-1721.029) (-1723.243) [-1722.803] -- 0:00:50 193500 -- (-1723.278) (-1727.125) [-1722.759] (-1721.072) * (-1728.739) (-1722.729) (-1722.943) [-1723.441] -- 0:00:54 194000 -- (-1722.274) (-1722.454) (-1722.294) [-1724.526] * (-1721.584) (-1722.388) (-1722.551) [-1726.635] -- 0:00:54 194500 -- [-1726.372] (-1724.017) (-1727.274) (-1721.785) * (-1721.677) (-1722.739) (-1722.722) [-1724.308] -- 0:00:53 195000 -- (-1725.753) [-1724.800] (-1725.059) (-1722.301) * (-1721.371) [-1723.681] (-1725.984) (-1724.438) -- 0:00:53 Average standard deviation of split frequencies: 0.017076 195500 -- (-1725.433) (-1727.894) [-1723.828] (-1723.059) * (-1721.101) (-1721.656) [-1722.798] (-1724.781) -- 0:00:53 196000 -- (-1729.078) (-1728.097) (-1724.607) [-1723.116] * (-1723.107) [-1722.221] (-1724.606) (-1725.202) -- 0:00:53 196500 -- (-1722.732) [-1727.492] (-1727.089) (-1726.432) * [-1723.617] (-1722.638) (-1725.666) (-1723.664) -- 0:00:53 197000 -- (-1722.386) (-1723.030) [-1729.719] (-1727.606) * (-1722.227) (-1722.621) [-1723.655] (-1722.702) -- 0:00:52 197500 -- (-1725.027) [-1721.787] (-1729.320) (-1724.163) * [-1728.486] (-1722.949) (-1722.981) (-1722.104) -- 0:00:52 198000 -- (-1722.464) (-1723.220) (-1728.895) [-1724.472] * [-1727.370] (-1722.804) (-1723.252) (-1723.059) -- 0:00:52 198500 -- [-1724.944] (-1721.768) (-1723.712) (-1723.263) * [-1721.286] (-1723.051) (-1721.464) (-1722.802) -- 0:00:52 199000 -- (-1721.972) [-1723.153] (-1726.091) (-1722.885) * (-1722.039) (-1723.370) (-1722.504) [-1721.403] -- 0:00:52 199500 -- (-1722.284) [-1724.118] (-1722.883) (-1721.706) * (-1721.096) (-1726.108) [-1721.991] (-1722.812) -- 0:00:52 200000 -- [-1725.361] (-1724.584) (-1722.883) (-1721.821) * (-1721.932) (-1722.356) (-1725.558) [-1723.696] -- 0:00:51 Average standard deviation of split frequencies: 0.016721 200500 -- (-1725.479) (-1722.855) (-1722.994) [-1721.866] * (-1722.537) (-1724.373) [-1723.236] (-1722.440) -- 0:00:51 201000 -- (-1724.595) (-1725.426) [-1722.746] (-1721.899) * (-1723.689) (-1722.814) [-1723.304] (-1721.030) -- 0:00:51 201500 -- (-1726.937) [-1725.069] (-1722.695) (-1724.219) * (-1722.271) [-1723.137] (-1721.888) (-1722.911) -- 0:00:51 202000 -- (-1723.697) (-1724.359) (-1723.607) [-1723.073] * (-1725.468) (-1724.093) (-1722.237) [-1721.124] -- 0:00:51 202500 -- (-1722.824) (-1725.056) [-1722.751] (-1724.067) * (-1724.241) [-1722.732] (-1723.496) (-1721.051) -- 0:00:51 203000 -- (-1722.463) (-1726.232) [-1725.308] (-1723.645) * (-1725.064) (-1722.237) [-1724.621] (-1721.859) -- 0:00:51 203500 -- [-1721.658] (-1725.507) (-1727.699) (-1722.326) * (-1724.109) (-1721.785) [-1723.200] (-1723.477) -- 0:00:50 204000 -- (-1721.659) (-1726.825) (-1723.195) [-1724.069] * (-1725.634) [-1724.318] (-1722.469) (-1724.720) -- 0:00:50 204500 -- (-1723.948) (-1725.477) (-1722.261) [-1722.348] * (-1723.300) [-1724.411] (-1722.639) (-1724.804) -- 0:00:50 205000 -- (-1726.661) (-1724.586) (-1721.867) [-1722.648] * [-1721.443] (-1723.138) (-1725.097) (-1723.578) -- 0:00:50 Average standard deviation of split frequencies: 0.015764 205500 -- [-1722.791] (-1726.010) (-1721.958) (-1722.538) * (-1722.111) (-1723.697) (-1724.705) [-1724.304] -- 0:00:50 206000 -- (-1722.149) (-1725.610) (-1723.264) [-1724.224] * (-1723.407) [-1722.508] (-1722.328) (-1722.642) -- 0:00:50 206500 -- (-1722.171) (-1721.650) [-1724.551] (-1723.304) * (-1724.690) (-1722.406) (-1725.170) [-1723.507] -- 0:00:49 207000 -- (-1722.763) (-1724.289) [-1725.904] (-1724.379) * (-1723.079) (-1722.304) (-1723.612) [-1723.115] -- 0:00:49 207500 -- (-1722.083) [-1724.189] (-1725.878) (-1722.651) * (-1724.385) (-1725.260) (-1722.989) [-1723.461] -- 0:00:49 208000 -- (-1722.661) (-1727.022) [-1722.059] (-1721.864) * (-1723.311) (-1721.713) (-1725.768) [-1724.621] -- 0:00:49 208500 -- (-1723.676) [-1722.824] (-1726.875) (-1725.558) * (-1722.139) (-1721.825) (-1723.819) [-1722.759] -- 0:00:49 209000 -- (-1722.967) [-1724.141] (-1726.884) (-1726.432) * (-1724.671) [-1722.541] (-1721.855) (-1722.187) -- 0:00:52 209500 -- [-1721.671] (-1723.494) (-1722.362) (-1722.147) * (-1722.861) (-1721.634) [-1721.592] (-1722.664) -- 0:00:52 210000 -- [-1722.188] (-1725.909) (-1721.880) (-1721.832) * [-1722.457] (-1722.637) (-1722.290) (-1722.914) -- 0:00:52 Average standard deviation of split frequencies: 0.013426 210500 -- (-1722.957) (-1722.059) [-1721.973] (-1723.799) * (-1722.567) [-1725.750] (-1724.500) (-1721.846) -- 0:00:52 211000 -- (-1722.786) [-1722.572] (-1722.311) (-1724.084) * (-1729.193) (-1722.380) [-1725.715] (-1722.640) -- 0:00:52 211500 -- (-1721.567) [-1722.573] (-1723.258) (-1723.374) * (-1733.486) [-1722.338] (-1723.081) (-1722.861) -- 0:00:52 212000 -- (-1722.027) [-1722.460] (-1723.023) (-1722.793) * (-1721.358) (-1721.934) [-1721.458] (-1721.702) -- 0:00:52 212500 -- (-1727.632) (-1722.569) (-1725.960) [-1725.647] * (-1722.971) (-1725.084) (-1722.774) [-1723.504] -- 0:00:51 213000 -- [-1724.393] (-1725.931) (-1722.163) (-1722.931) * (-1721.377) (-1721.024) [-1723.888] (-1723.541) -- 0:00:51 213500 -- (-1721.265) [-1721.961] (-1722.550) (-1722.324) * (-1723.072) [-1723.817] (-1724.711) (-1724.158) -- 0:00:51 214000 -- (-1721.300) (-1727.400) (-1722.451) [-1720.885] * (-1721.746) (-1728.757) (-1723.696) [-1721.251] -- 0:00:51 214500 -- (-1722.372) (-1722.488) (-1722.673) [-1723.288] * [-1722.102] (-1722.239) (-1726.118) (-1723.924) -- 0:00:51 215000 -- (-1721.830) [-1723.414] (-1723.731) (-1721.561) * [-1722.120] (-1724.347) (-1723.593) (-1723.028) -- 0:00:51 Average standard deviation of split frequencies: 0.015791 215500 -- [-1721.452] (-1725.686) (-1722.945) (-1721.624) * (-1723.251) (-1722.034) (-1720.852) [-1721.959] -- 0:00:50 216000 -- [-1725.006] (-1725.490) (-1723.548) (-1721.844) * (-1724.071) (-1723.129) [-1721.312] (-1721.579) -- 0:00:50 216500 -- [-1722.713] (-1721.918) (-1722.059) (-1722.301) * (-1722.847) (-1723.018) [-1723.488] (-1727.651) -- 0:00:50 217000 -- (-1722.543) [-1721.392] (-1723.386) (-1721.995) * [-1722.054] (-1722.297) (-1723.746) (-1723.592) -- 0:00:50 217500 -- (-1723.500) (-1721.702) (-1727.209) [-1721.651] * (-1723.626) (-1724.460) (-1725.278) [-1725.676] -- 0:00:50 218000 -- (-1722.790) (-1725.386) [-1728.809] (-1721.036) * (-1723.947) [-1722.175] (-1722.014) (-1728.639) -- 0:00:50 218500 -- (-1724.523) (-1724.423) (-1725.124) [-1721.582] * [-1721.039] (-1722.278) (-1721.980) (-1722.959) -- 0:00:50 219000 -- (-1723.872) (-1726.579) (-1724.389) [-1721.716] * (-1721.852) (-1722.041) (-1723.456) [-1721.941] -- 0:00:49 219500 -- [-1720.958] (-1726.415) (-1725.704) (-1726.490) * (-1725.301) (-1722.172) (-1724.533) [-1721.912] -- 0:00:49 220000 -- (-1721.096) [-1728.689] (-1724.784) (-1725.223) * (-1726.177) (-1723.258) [-1722.787] (-1723.786) -- 0:00:49 Average standard deviation of split frequencies: 0.013767 220500 -- [-1721.662] (-1721.528) (-1722.254) (-1724.136) * (-1724.398) (-1722.631) (-1723.107) [-1723.582] -- 0:00:49 221000 -- (-1722.596) [-1721.161] (-1722.384) (-1722.356) * (-1722.826) [-1721.697] (-1725.735) (-1722.508) -- 0:00:49 221500 -- (-1723.643) [-1721.825] (-1724.588) (-1722.400) * [-1722.277] (-1722.091) (-1726.091) (-1724.522) -- 0:00:49 222000 -- (-1723.161) [-1721.537] (-1724.195) (-1726.818) * (-1723.000) (-1725.468) (-1726.957) [-1723.897] -- 0:00:49 222500 -- [-1722.980] (-1722.607) (-1724.861) (-1727.303) * (-1723.818) (-1724.634) (-1724.277) [-1722.725] -- 0:00:48 223000 -- (-1723.290) [-1721.720] (-1724.514) (-1722.992) * [-1722.784] (-1725.892) (-1727.787) (-1722.176) -- 0:00:48 223500 -- (-1723.152) [-1722.067] (-1723.570) (-1724.248) * (-1723.404) [-1721.564] (-1722.122) (-1722.106) -- 0:00:48 224000 -- (-1721.387) (-1721.023) (-1728.635) [-1723.422] * (-1722.877) (-1721.716) (-1722.284) [-1721.615] -- 0:00:48 224500 -- (-1721.769) (-1723.100) [-1723.074] (-1723.334) * (-1726.839) [-1722.156] (-1722.854) (-1724.931) -- 0:00:48 225000 -- [-1723.074] (-1721.615) (-1724.365) (-1724.129) * (-1723.224) [-1722.019] (-1726.313) (-1725.248) -- 0:00:51 Average standard deviation of split frequencies: 0.012631 225500 -- (-1721.329) (-1722.078) (-1723.134) [-1722.109] * (-1724.387) (-1724.235) (-1726.053) [-1723.166] -- 0:00:51 226000 -- (-1722.658) (-1720.851) [-1724.346] (-1722.760) * (-1727.104) (-1723.224) (-1725.902) [-1722.081] -- 0:00:51 226500 -- (-1723.828) (-1721.431) (-1721.082) [-1721.413] * (-1722.876) [-1723.547] (-1722.257) (-1724.397) -- 0:00:51 227000 -- (-1721.273) (-1725.798) [-1721.618] (-1721.187) * (-1723.825) (-1724.136) (-1721.021) [-1727.048] -- 0:00:51 227500 -- (-1721.790) (-1726.041) [-1722.668] (-1721.474) * (-1723.204) (-1723.072) [-1721.663] (-1724.928) -- 0:00:50 228000 -- (-1721.852) [-1723.988] (-1722.698) (-1721.411) * (-1723.589) (-1722.923) (-1723.231) [-1722.321] -- 0:00:50 228500 -- (-1722.708) [-1722.685] (-1723.785) (-1721.497) * (-1723.705) (-1722.464) [-1724.109] (-1728.000) -- 0:00:50 229000 -- (-1722.211) (-1722.263) (-1724.013) [-1721.400] * (-1723.074) [-1723.431] (-1723.290) (-1725.199) -- 0:00:50 229500 -- [-1722.404] (-1721.195) (-1723.401) (-1725.278) * (-1723.380) [-1723.752] (-1724.516) (-1726.990) -- 0:00:50 230000 -- (-1722.966) (-1722.298) (-1723.895) [-1725.597] * (-1725.837) (-1726.554) [-1724.208] (-1731.609) -- 0:00:50 Average standard deviation of split frequencies: 0.014419 230500 -- [-1727.130] (-1722.457) (-1721.783) (-1728.533) * (-1724.266) (-1720.869) (-1721.622) [-1724.101] -- 0:00:50 231000 -- [-1724.178] (-1725.031) (-1722.683) (-1723.374) * (-1723.469) (-1723.223) (-1721.709) [-1724.078] -- 0:00:49 231500 -- (-1723.926) (-1724.621) (-1725.974) [-1721.709] * (-1722.914) [-1724.498] (-1721.705) (-1725.028) -- 0:00:49 232000 -- (-1723.167) (-1722.594) [-1726.146] (-1722.885) * (-1726.791) (-1722.989) [-1721.706] (-1727.729) -- 0:00:49 232500 -- (-1722.285) [-1723.057] (-1723.819) (-1722.893) * (-1726.197) [-1721.857] (-1723.194) (-1727.668) -- 0:00:49 233000 -- [-1722.287] (-1725.388) (-1723.029) (-1721.496) * (-1729.447) (-1720.848) [-1724.916] (-1723.156) -- 0:00:49 233500 -- (-1722.965) (-1722.316) [-1723.387] (-1721.533) * [-1722.772] (-1722.156) (-1722.710) (-1725.569) -- 0:00:49 234000 -- (-1721.924) (-1724.254) [-1723.130] (-1721.272) * (-1721.714) (-1722.223) [-1726.309] (-1726.615) -- 0:00:49 234500 -- [-1723.086] (-1724.757) (-1722.969) (-1721.301) * (-1724.624) (-1722.876) [-1723.024] (-1725.851) -- 0:00:48 235000 -- [-1722.822] (-1724.254) (-1722.025) (-1720.945) * (-1723.342) (-1721.733) (-1721.254) [-1722.193] -- 0:00:48 Average standard deviation of split frequencies: 0.014315 235500 -- (-1725.031) [-1723.383] (-1721.205) (-1720.995) * (-1723.049) [-1724.373] (-1721.598) (-1723.839) -- 0:00:48 236000 -- (-1724.121) (-1724.647) (-1721.785) [-1722.933] * (-1722.951) (-1724.025) (-1722.492) [-1723.420] -- 0:00:48 236500 -- (-1722.506) (-1723.302) [-1722.185] (-1725.138) * (-1726.051) (-1722.831) (-1724.307) [-1723.699] -- 0:00:48 237000 -- [-1722.324] (-1723.302) (-1721.218) (-1725.106) * (-1728.631) [-1724.389] (-1723.271) (-1725.708) -- 0:00:48 237500 -- (-1724.891) [-1722.693] (-1721.387) (-1725.966) * (-1725.728) (-1722.697) [-1722.877] (-1722.348) -- 0:00:48 238000 -- (-1724.062) (-1722.626) (-1721.994) [-1722.282] * (-1728.533) (-1724.040) [-1722.834] (-1724.638) -- 0:00:48 238500 -- (-1723.464) [-1723.974] (-1722.524) (-1722.850) * [-1728.373] (-1723.864) (-1720.934) (-1723.039) -- 0:00:47 239000 -- (-1722.210) (-1726.616) (-1721.673) [-1724.463] * (-1722.551) (-1722.170) (-1721.900) [-1723.072] -- 0:00:47 239500 -- (-1722.447) (-1722.821) [-1723.546] (-1723.652) * (-1723.816) (-1727.830) (-1720.915) [-1723.584] -- 0:00:47 240000 -- (-1728.746) [-1723.310] (-1724.325) (-1724.169) * (-1722.834) (-1724.090) [-1721.482] (-1722.428) -- 0:00:47 Average standard deviation of split frequencies: 0.011644 240500 -- (-1721.902) (-1723.397) [-1721.897] (-1723.696) * (-1722.739) (-1726.125) [-1721.709] (-1725.657) -- 0:00:50 241000 -- (-1723.650) (-1723.176) (-1721.982) [-1722.423] * (-1722.892) [-1721.129] (-1725.519) (-1721.756) -- 0:00:50 241500 -- [-1721.373] (-1724.957) (-1723.240) (-1727.118) * (-1723.997) (-1722.903) (-1728.491) [-1722.779] -- 0:00:50 242000 -- (-1721.591) (-1724.195) [-1724.957] (-1724.575) * (-1726.233) (-1721.956) (-1730.323) [-1723.910] -- 0:00:50 242500 -- [-1721.677] (-1726.460) (-1724.907) (-1726.862) * (-1724.744) (-1723.705) (-1727.327) [-1724.281] -- 0:00:49 243000 -- [-1721.814] (-1724.439) (-1722.825) (-1721.445) * (-1726.506) (-1724.422) (-1724.285) [-1724.372] -- 0:00:49 243500 -- (-1721.834) (-1725.360) (-1729.419) [-1722.693] * (-1723.246) (-1727.312) (-1722.043) [-1722.022] -- 0:00:49 244000 -- [-1721.709] (-1725.388) (-1723.793) (-1721.084) * (-1722.405) (-1726.215) (-1721.967) [-1722.983] -- 0:00:49 244500 -- (-1724.019) (-1727.214) (-1724.452) [-1721.100] * (-1723.443) (-1723.908) (-1722.929) [-1722.266] -- 0:00:49 245000 -- (-1724.073) (-1721.435) [-1722.011] (-1721.620) * (-1724.821) (-1724.976) [-1723.400] (-1724.157) -- 0:00:49 Average standard deviation of split frequencies: 0.012743 245500 -- [-1721.158] (-1721.635) (-1720.966) (-1721.668) * (-1727.825) [-1722.316] (-1725.912) (-1723.751) -- 0:00:49 246000 -- [-1722.550] (-1724.131) (-1720.970) (-1722.731) * (-1727.228) [-1723.627] (-1725.299) (-1729.582) -- 0:00:49 246500 -- (-1722.685) [-1721.468] (-1723.842) (-1724.574) * (-1726.026) (-1727.376) [-1722.378] (-1721.838) -- 0:00:48 247000 -- (-1721.499) (-1721.468) [-1722.758] (-1723.210) * (-1726.529) (-1728.662) [-1723.536] (-1723.214) -- 0:00:48 247500 -- (-1721.965) (-1721.280) (-1723.368) [-1724.737] * (-1722.547) (-1721.365) [-1722.641] (-1722.650) -- 0:00:48 248000 -- (-1727.437) (-1721.280) (-1722.706) [-1725.892] * (-1723.711) (-1721.366) (-1721.191) [-1722.704] -- 0:00:48 248500 -- [-1726.993] (-1721.769) (-1721.913) (-1726.422) * (-1724.494) (-1721.760) (-1722.393) [-1721.885] -- 0:00:48 249000 -- [-1724.890] (-1722.030) (-1722.428) (-1724.444) * (-1725.449) [-1725.807] (-1722.225) (-1721.097) -- 0:00:48 249500 -- (-1721.689) (-1723.352) (-1721.775) [-1725.124] * (-1722.425) (-1722.536) (-1723.410) [-1723.101] -- 0:00:48 250000 -- (-1721.479) (-1724.937) [-1721.796] (-1726.652) * (-1723.439) (-1722.828) [-1724.705] (-1721.590) -- 0:00:48 Average standard deviation of split frequencies: 0.012642 250500 -- [-1721.560] (-1723.362) (-1721.829) (-1722.841) * (-1722.806) (-1723.698) (-1727.012) [-1721.709] -- 0:00:47 251000 -- [-1721.058] (-1723.171) (-1721.997) (-1722.967) * (-1721.929) (-1721.674) (-1721.828) [-1725.374] -- 0:00:47 251500 -- (-1720.991) (-1724.687) [-1723.270] (-1722.967) * (-1723.444) [-1721.549] (-1721.828) (-1722.941) -- 0:00:47 252000 -- (-1722.388) (-1723.589) (-1721.904) [-1722.038] * (-1721.772) (-1721.111) (-1725.078) [-1723.208] -- 0:00:47 252500 -- (-1721.521) (-1723.034) [-1721.318] (-1722.488) * (-1724.063) (-1725.400) [-1722.254] (-1722.828) -- 0:00:47 253000 -- (-1726.078) (-1721.316) (-1721.791) [-1721.101] * (-1722.939) [-1725.904] (-1726.655) (-1722.735) -- 0:00:47 253500 -- (-1723.064) (-1724.756) [-1724.152] (-1724.569) * (-1721.487) [-1723.295] (-1726.067) (-1721.418) -- 0:00:47 254000 -- (-1723.792) (-1725.703) [-1722.096] (-1721.064) * (-1725.812) [-1721.767] (-1724.696) (-1722.069) -- 0:00:46 254500 -- (-1725.906) (-1723.871) [-1723.191] (-1720.988) * (-1722.288) (-1721.664) [-1725.043] (-1723.397) -- 0:00:46 255000 -- (-1725.732) (-1723.659) (-1722.569) [-1721.666] * [-1722.439] (-1721.967) (-1721.978) (-1722.427) -- 0:00:46 Average standard deviation of split frequencies: 0.013401 255500 -- (-1723.378) (-1725.257) [-1722.387] (-1721.787) * (-1721.870) (-1722.392) (-1721.461) [-1723.207] -- 0:00:46 256000 -- (-1725.903) [-1728.445] (-1723.173) (-1722.538) * [-1722.008] (-1722.383) (-1724.382) (-1722.817) -- 0:00:46 256500 -- (-1722.541) (-1726.515) [-1722.759] (-1721.360) * (-1722.007) [-1721.258] (-1722.767) (-1722.122) -- 0:00:49 257000 -- (-1721.926) (-1729.357) [-1721.348] (-1722.254) * (-1723.225) (-1722.876) (-1722.643) [-1724.655] -- 0:00:49 257500 -- (-1722.947) [-1724.800] (-1721.129) (-1721.390) * (-1724.929) (-1722.900) [-1721.743] (-1723.443) -- 0:00:49 258000 -- (-1721.115) (-1725.953) (-1722.774) [-1721.355] * [-1724.707] (-1724.640) (-1723.112) (-1722.847) -- 0:00:48 258500 -- [-1721.603] (-1729.128) (-1722.694) (-1721.867) * (-1723.674) [-1725.123] (-1722.150) (-1723.109) -- 0:00:48 259000 -- (-1721.438) (-1724.350) [-1723.769] (-1722.586) * (-1727.522) (-1723.629) [-1722.745] (-1721.959) -- 0:00:48 259500 -- (-1723.874) [-1723.743] (-1721.934) (-1722.540) * (-1723.665) [-1724.111] (-1722.101) (-1722.256) -- 0:00:48 260000 -- [-1721.429] (-1725.403) (-1723.016) (-1725.319) * (-1723.266) (-1723.834) (-1723.155) [-1723.806] -- 0:00:48 Average standard deviation of split frequencies: 0.015319 260500 -- (-1723.356) (-1722.204) (-1727.171) [-1724.222] * [-1723.909] (-1723.158) (-1725.046) (-1722.884) -- 0:00:48 261000 -- (-1722.529) (-1722.227) [-1725.202] (-1724.700) * (-1721.639) (-1723.354) [-1722.167] (-1721.600) -- 0:00:48 261500 -- (-1723.096) (-1722.554) [-1722.410] (-1724.331) * (-1722.097) (-1725.912) (-1722.914) [-1722.319] -- 0:00:48 262000 -- (-1722.341) [-1721.883] (-1723.408) (-1723.751) * (-1726.484) (-1724.418) [-1721.682] (-1721.911) -- 0:00:47 262500 -- [-1723.103] (-1722.747) (-1721.882) (-1725.643) * (-1723.554) (-1723.226) [-1722.083] (-1721.399) -- 0:00:47 263000 -- (-1725.382) (-1721.627) (-1722.583) [-1721.537] * (-1727.950) [-1723.265] (-1724.658) (-1721.404) -- 0:00:47 263500 -- [-1721.773] (-1723.490) (-1723.127) (-1721.140) * (-1725.543) (-1723.877) (-1723.861) [-1721.355] -- 0:00:47 264000 -- [-1722.190] (-1724.327) (-1726.938) (-1723.465) * [-1725.962] (-1725.781) (-1723.736) (-1720.955) -- 0:00:47 264500 -- (-1723.000) [-1724.340] (-1722.461) (-1722.330) * (-1726.647) (-1726.939) (-1724.825) [-1721.395] -- 0:00:47 265000 -- (-1722.387) (-1725.253) [-1722.421] (-1722.590) * (-1726.446) (-1727.143) (-1725.254) [-1721.305] -- 0:00:47 Average standard deviation of split frequencies: 0.014551 265500 -- [-1722.216] (-1727.092) (-1722.588) (-1723.003) * (-1722.219) (-1725.838) [-1725.711] (-1724.071) -- 0:00:47 266000 -- (-1724.908) (-1730.006) [-1723.034] (-1722.514) * [-1722.418] (-1726.503) (-1723.144) (-1722.129) -- 0:00:46 266500 -- (-1723.782) (-1730.290) (-1725.504) [-1723.028] * [-1721.122] (-1722.274) (-1724.401) (-1721.350) -- 0:00:46 267000 -- (-1723.593) (-1726.381) (-1724.100) [-1722.695] * (-1722.524) [-1722.796] (-1721.587) (-1722.316) -- 0:00:46 267500 -- [-1722.247] (-1727.721) (-1728.465) (-1723.273) * (-1722.249) [-1723.035] (-1721.896) (-1722.352) -- 0:00:46 268000 -- (-1722.762) (-1727.780) (-1725.899) [-1723.779] * [-1722.922] (-1722.786) (-1726.844) (-1722.281) -- 0:00:46 268500 -- (-1725.468) [-1722.905] (-1723.766) (-1725.924) * (-1724.711) (-1723.920) [-1725.309] (-1722.327) -- 0:00:46 269000 -- [-1726.225] (-1722.438) (-1723.253) (-1721.420) * (-1723.225) [-1722.162] (-1722.783) (-1722.329) -- 0:00:46 269500 -- (-1724.865) (-1723.403) [-1725.627] (-1722.794) * (-1724.861) (-1722.421) [-1723.348] (-1722.316) -- 0:00:46 270000 -- (-1722.350) (-1725.576) (-1729.088) [-1723.296] * [-1723.938] (-1724.532) (-1723.666) (-1728.045) -- 0:00:45 Average standard deviation of split frequencies: 0.014320 270500 -- [-1723.166] (-1723.936) (-1722.603) (-1722.978) * (-1726.795) [-1724.220] (-1721.761) (-1731.961) -- 0:00:45 271000 -- (-1722.217) [-1721.943] (-1723.693) (-1724.709) * (-1724.742) [-1724.970] (-1721.857) (-1727.250) -- 0:00:45 271500 -- (-1722.893) (-1721.626) [-1721.464] (-1725.192) * (-1721.794) [-1722.178] (-1725.356) (-1723.431) -- 0:00:45 272000 -- (-1723.697) (-1724.245) (-1721.168) [-1724.381] * [-1723.439] (-1722.686) (-1728.349) (-1723.856) -- 0:00:48 272500 -- (-1728.633) (-1725.096) (-1721.065) [-1724.446] * (-1725.066) (-1722.704) (-1723.677) [-1724.469] -- 0:00:48 273000 -- [-1723.720] (-1724.129) (-1721.078) (-1724.017) * [-1721.882] (-1722.431) (-1725.516) (-1727.061) -- 0:00:47 273500 -- (-1722.895) [-1722.678] (-1721.982) (-1722.852) * (-1722.545) (-1721.915) (-1723.799) [-1722.341] -- 0:00:47 274000 -- (-1721.643) (-1722.703) (-1721.979) [-1722.518] * (-1721.597) (-1722.820) (-1728.425) [-1721.115] -- 0:00:47 274500 -- (-1723.281) (-1722.861) [-1722.820] (-1722.592) * (-1723.498) (-1721.663) [-1727.229] (-1721.122) -- 0:00:47 275000 -- (-1722.681) [-1722.539] (-1724.102) (-1722.542) * (-1723.069) (-1722.094) [-1723.160] (-1721.122) -- 0:00:47 Average standard deviation of split frequencies: 0.013214 275500 -- [-1723.525] (-1722.141) (-1724.952) (-1723.327) * (-1722.963) (-1723.498) [-1721.974] (-1723.717) -- 0:00:47 276000 -- [-1723.219] (-1721.579) (-1724.906) (-1722.915) * (-1725.685) [-1721.135] (-1722.651) (-1722.392) -- 0:00:47 276500 -- (-1723.563) (-1722.108) (-1722.930) [-1723.269] * (-1723.405) [-1722.395] (-1725.562) (-1723.122) -- 0:00:47 277000 -- (-1721.442) (-1722.219) (-1723.543) [-1723.786] * (-1723.021) (-1724.426) (-1724.040) [-1722.973] -- 0:00:46 277500 -- (-1723.988) [-1721.768] (-1725.086) (-1724.031) * (-1723.667) [-1726.206] (-1722.791) (-1723.650) -- 0:00:46 278000 -- (-1722.995) (-1723.977) (-1722.378) [-1728.845] * (-1725.294) (-1723.683) (-1723.735) [-1721.847] -- 0:00:46 278500 -- (-1721.139) (-1725.774) (-1723.058) [-1729.342] * [-1725.370] (-1723.179) (-1721.012) (-1725.795) -- 0:00:46 279000 -- [-1721.778] (-1723.364) (-1722.584) (-1728.353) * [-1724.662] (-1723.568) (-1725.250) (-1722.594) -- 0:00:46 279500 -- (-1722.568) (-1723.826) [-1725.361] (-1721.940) * (-1725.110) [-1725.850] (-1722.867) (-1724.620) -- 0:00:46 280000 -- (-1721.412) (-1722.461) [-1726.858] (-1721.976) * [-1721.601] (-1723.609) (-1721.420) (-1724.361) -- 0:00:46 Average standard deviation of split frequencies: 0.013530 280500 -- (-1721.725) (-1724.295) [-1725.867] (-1725.456) * (-1722.525) (-1722.324) (-1721.391) [-1722.366] -- 0:00:46 281000 -- (-1722.029) [-1724.728] (-1723.938) (-1722.201) * (-1723.206) (-1721.993) (-1722.243) [-1721.992] -- 0:00:46 281500 -- (-1721.390) (-1726.294) [-1723.346] (-1721.427) * (-1722.396) (-1723.342) [-1722.552] (-1722.105) -- 0:00:45 282000 -- [-1722.822] (-1724.350) (-1721.968) (-1720.959) * (-1721.772) (-1723.282) [-1723.336] (-1724.410) -- 0:00:45 282500 -- (-1722.685) (-1726.911) (-1722.313) [-1721.542] * [-1721.968] (-1722.125) (-1723.380) (-1721.882) -- 0:00:45 283000 -- [-1722.524] (-1725.388) (-1723.136) (-1721.613) * (-1722.319) (-1724.705) [-1725.873] (-1725.069) -- 0:00:45 283500 -- (-1724.474) (-1723.799) (-1723.950) [-1721.810] * (-1722.483) (-1723.373) [-1722.567] (-1724.879) -- 0:00:45 284000 -- (-1723.014) [-1722.572] (-1725.937) (-1721.041) * [-1726.236] (-1725.788) (-1723.545) (-1722.757) -- 0:00:45 284500 -- (-1728.598) (-1723.968) (-1724.519) [-1721.020] * (-1723.477) (-1726.884) [-1722.985] (-1722.154) -- 0:00:45 285000 -- (-1725.560) (-1723.338) (-1725.374) [-1721.053] * [-1721.289] (-1726.402) (-1723.877) (-1722.558) -- 0:00:45 Average standard deviation of split frequencies: 0.012454 285500 -- (-1723.862) (-1724.852) [-1723.832] (-1722.783) * (-1721.289) (-1722.647) [-1722.464] (-1722.358) -- 0:00:45 286000 -- (-1722.069) (-1724.688) (-1724.431) [-1721.563] * (-1721.935) (-1724.970) (-1723.377) [-1723.987] -- 0:00:44 286500 -- [-1729.387] (-1723.548) (-1725.696) (-1721.814) * (-1721.311) (-1723.554) (-1722.032) [-1723.722] -- 0:00:44 287000 -- (-1728.256) (-1722.208) (-1730.769) [-1722.258] * (-1722.268) (-1724.667) [-1721.612] (-1722.488) -- 0:00:44 287500 -- (-1725.761) (-1723.200) [-1727.110] (-1721.862) * (-1722.373) (-1726.131) (-1721.611) [-1723.067] -- 0:00:44 288000 -- (-1722.794) (-1724.805) [-1727.221] (-1723.789) * (-1724.907) (-1727.978) (-1721.643) [-1722.487] -- 0:00:46 288500 -- (-1722.578) [-1721.222] (-1725.556) (-1723.978) * (-1722.953) (-1728.750) [-1722.778] (-1726.836) -- 0:00:46 289000 -- (-1723.307) [-1722.000] (-1726.177) (-1723.303) * (-1725.069) (-1727.353) [-1723.900] (-1726.675) -- 0:00:46 289500 -- [-1722.834] (-1725.596) (-1726.369) (-1722.888) * (-1722.992) (-1723.505) (-1724.566) [-1723.708] -- 0:00:46 290000 -- (-1728.741) (-1723.021) (-1722.376) [-1722.524] * [-1722.592] (-1725.842) (-1723.160) (-1724.694) -- 0:00:46 Average standard deviation of split frequencies: 0.012073 290500 -- (-1727.221) [-1724.425] (-1721.742) (-1722.581) * (-1721.056) (-1723.829) (-1723.385) [-1723.273] -- 0:00:46 291000 -- (-1722.085) (-1727.471) [-1722.125] (-1724.096) * [-1724.527] (-1725.355) (-1722.619) (-1725.428) -- 0:00:46 291500 -- (-1722.123) (-1722.783) [-1723.609] (-1723.714) * (-1726.335) [-1721.551] (-1723.439) (-1722.535) -- 0:00:46 292000 -- (-1721.914) (-1723.301) (-1723.258) [-1724.127] * (-1723.664) [-1724.593] (-1724.534) (-1724.118) -- 0:00:46 292500 -- [-1721.837] (-1727.341) (-1724.191) (-1725.976) * (-1723.931) [-1724.884] (-1722.890) (-1722.147) -- 0:00:45 293000 -- (-1722.432) (-1724.474) [-1723.561] (-1722.367) * (-1723.458) (-1723.364) (-1723.212) [-1722.328] -- 0:00:45 293500 -- (-1721.669) [-1723.048] (-1727.165) (-1722.133) * (-1723.773) [-1724.303] (-1730.191) (-1724.737) -- 0:00:45 294000 -- [-1723.330] (-1722.762) (-1728.085) (-1724.821) * (-1723.495) (-1722.289) [-1727.590] (-1723.510) -- 0:00:45 294500 -- (-1722.799) [-1721.323] (-1723.308) (-1725.242) * (-1724.443) [-1724.963] (-1726.655) (-1724.460) -- 0:00:45 295000 -- [-1722.799] (-1721.260) (-1723.160) (-1729.350) * (-1727.048) [-1723.426] (-1721.474) (-1730.251) -- 0:00:45 Average standard deviation of split frequencies: 0.012070 295500 -- (-1723.420) (-1726.545) (-1723.309) [-1723.109] * [-1723.608] (-1722.007) (-1721.954) (-1726.094) -- 0:00:45 296000 -- (-1722.361) [-1722.294] (-1724.072) (-1722.866) * (-1721.843) (-1720.797) (-1722.325) [-1724.324] -- 0:00:45 296500 -- (-1722.140) (-1722.914) (-1722.101) [-1723.725] * [-1721.820] (-1724.724) (-1720.908) (-1725.706) -- 0:00:45 297000 -- (-1722.628) (-1723.869) [-1722.417] (-1724.237) * (-1723.020) (-1721.343) (-1721.444) [-1721.916] -- 0:00:44 297500 -- (-1727.079) [-1722.486] (-1722.313) (-1723.150) * (-1724.393) (-1722.319) [-1721.767] (-1722.360) -- 0:00:44 298000 -- (-1726.828) (-1722.030) (-1721.466) [-1722.333] * [-1723.004] (-1722.236) (-1723.441) (-1723.590) -- 0:00:44 298500 -- (-1725.467) (-1721.813) [-1721.149] (-1722.347) * (-1721.906) [-1722.915] (-1724.894) (-1722.633) -- 0:00:44 299000 -- [-1726.938] (-1723.591) (-1724.261) (-1722.646) * (-1723.319) (-1725.126) [-1724.223] (-1722.537) -- 0:00:44 299500 -- [-1724.580] (-1721.933) (-1721.511) (-1723.036) * (-1724.838) [-1722.596] (-1722.253) (-1721.500) -- 0:00:44 300000 -- [-1724.334] (-1722.769) (-1721.457) (-1722.702) * (-1722.462) (-1723.222) [-1722.802] (-1721.661) -- 0:00:44 Average standard deviation of split frequencies: 0.011718 300500 -- (-1721.630) [-1723.163] (-1722.152) (-1722.366) * [-1721.680] (-1723.184) (-1725.267) (-1723.553) -- 0:00:44 301000 -- (-1721.870) (-1724.528) (-1722.233) [-1722.550] * [-1724.498] (-1722.217) (-1723.083) (-1724.457) -- 0:00:44 301500 -- [-1721.533] (-1722.035) (-1723.727) (-1721.497) * [-1724.082] (-1722.072) (-1723.502) (-1723.083) -- 0:00:44 302000 -- [-1721.643] (-1723.400) (-1721.496) (-1721.218) * (-1728.268) (-1723.087) (-1723.671) [-1727.724] -- 0:00:43 302500 -- (-1722.146) [-1723.188] (-1722.943) (-1724.895) * (-1724.564) (-1727.283) [-1721.456] (-1728.669) -- 0:00:43 303000 -- (-1721.529) [-1723.268] (-1722.904) (-1726.333) * (-1723.716) (-1728.330) [-1722.587] (-1722.296) -- 0:00:43 303500 -- (-1721.086) (-1725.813) (-1722.227) [-1723.630] * [-1721.838] (-1725.228) (-1724.465) (-1724.303) -- 0:00:45 304000 -- (-1721.170) (-1730.075) (-1722.123) [-1723.879] * (-1723.172) (-1721.920) (-1721.753) [-1721.839] -- 0:00:45 304500 -- [-1721.164] (-1730.030) (-1725.498) (-1722.081) * (-1723.172) (-1726.622) [-1722.592] (-1722.872) -- 0:00:45 305000 -- (-1721.834) (-1727.168) (-1723.673) [-1722.336] * (-1723.183) [-1722.986] (-1724.058) (-1722.936) -- 0:00:45 Average standard deviation of split frequencies: 0.011270 305500 -- (-1721.229) (-1721.478) (-1724.248) [-1723.754] * (-1724.144) (-1723.915) [-1723.082] (-1720.903) -- 0:00:45 306000 -- (-1721.230) (-1722.387) [-1721.427] (-1723.703) * (-1723.200) (-1726.121) (-1722.104) [-1722.113] -- 0:00:45 306500 -- [-1721.230] (-1721.204) (-1721.336) (-1725.207) * (-1726.754) (-1724.480) [-1721.627] (-1726.641) -- 0:00:45 307000 -- (-1722.634) (-1722.590) (-1725.745) [-1722.579] * [-1725.848] (-1722.561) (-1723.703) (-1726.090) -- 0:00:45 307500 -- [-1722.064] (-1722.490) (-1723.800) (-1721.874) * (-1725.966) (-1722.338) (-1721.275) [-1724.831] -- 0:00:45 308000 -- (-1721.286) (-1722.118) [-1722.052] (-1723.158) * (-1724.523) [-1723.907] (-1724.077) (-1722.314) -- 0:00:44 308500 -- (-1726.160) (-1723.749) [-1723.275] (-1723.367) * [-1724.805] (-1722.914) (-1721.982) (-1724.195) -- 0:00:44 309000 -- (-1725.422) [-1721.973] (-1722.282) (-1722.468) * (-1721.296) [-1724.169] (-1721.956) (-1723.404) -- 0:00:44 309500 -- (-1722.669) [-1723.434] (-1722.226) (-1722.085) * (-1721.923) (-1722.982) [-1721.316] (-1721.071) -- 0:00:44 310000 -- [-1722.843] (-1722.805) (-1723.321) (-1722.947) * (-1722.770) (-1724.747) (-1724.166) [-1721.132] -- 0:00:44 Average standard deviation of split frequencies: 0.010222 310500 -- (-1724.005) (-1721.555) (-1721.784) [-1723.539] * [-1721.669] (-1723.803) (-1726.077) (-1721.172) -- 0:00:44 311000 -- [-1722.779] (-1722.497) (-1723.082) (-1724.095) * (-1723.002) (-1723.093) [-1721.883] (-1721.566) -- 0:00:44 311500 -- (-1721.249) [-1722.043] (-1722.836) (-1724.095) * [-1725.925] (-1725.667) (-1722.007) (-1721.777) -- 0:00:44 312000 -- [-1723.052] (-1720.862) (-1724.150) (-1724.853) * (-1722.460) [-1725.482] (-1722.118) (-1721.817) -- 0:00:44 312500 -- [-1723.451] (-1720.939) (-1724.342) (-1721.802) * (-1724.768) (-1721.806) [-1721.707] (-1721.274) -- 0:00:44 313000 -- [-1722.574] (-1723.307) (-1723.852) (-1723.699) * (-1722.032) (-1722.883) (-1723.369) [-1725.335] -- 0:00:43 313500 -- (-1722.069) [-1722.707] (-1723.852) (-1722.404) * (-1721.807) (-1723.876) [-1724.292] (-1724.629) -- 0:00:43 314000 -- (-1722.643) (-1721.667) [-1723.792] (-1722.882) * (-1722.351) (-1722.606) [-1723.768] (-1725.155) -- 0:00:43 314500 -- (-1723.035) (-1724.133) [-1724.305] (-1724.457) * (-1721.316) (-1722.643) (-1724.180) [-1721.809] -- 0:00:43 315000 -- (-1722.568) (-1721.508) (-1722.559) [-1727.690] * (-1724.559) (-1722.177) (-1725.158) [-1720.995] -- 0:00:43 Average standard deviation of split frequencies: 0.010857 315500 -- (-1723.895) [-1721.936] (-1725.595) (-1729.168) * (-1724.630) (-1722.191) [-1724.055] (-1720.995) -- 0:00:43 316000 -- [-1724.532] (-1721.458) (-1723.811) (-1722.187) * (-1724.008) (-1723.686) (-1722.843) [-1723.299] -- 0:00:43 316500 -- (-1724.374) (-1722.381) (-1721.512) [-1722.274] * (-1722.539) (-1721.403) (-1725.547) [-1722.744] -- 0:00:43 317000 -- (-1724.066) (-1724.100) (-1723.388) [-1721.361] * (-1723.134) (-1721.437) [-1722.204] (-1724.535) -- 0:00:43 317500 -- (-1722.721) [-1722.762] (-1724.513) (-1721.536) * (-1726.056) (-1721.549) [-1721.884] (-1725.923) -- 0:00:42 318000 -- (-1723.555) (-1724.148) (-1723.257) [-1721.778] * (-1723.008) [-1721.677] (-1721.838) (-1727.766) -- 0:00:42 318500 -- (-1722.423) [-1723.615] (-1723.366) (-1721.771) * (-1722.196) (-1722.722) [-1723.544] (-1723.933) -- 0:00:42 319000 -- (-1721.770) (-1724.516) (-1722.042) [-1723.888] * (-1730.298) (-1721.458) (-1723.514) [-1723.667] -- 0:00:42 319500 -- (-1722.063) (-1723.541) (-1723.373) [-1724.076] * (-1724.350) [-1723.282] (-1721.759) (-1723.513) -- 0:00:44 320000 -- (-1722.296) (-1722.222) [-1724.212] (-1725.222) * [-1723.775] (-1723.492) (-1722.174) (-1723.468) -- 0:00:44 Average standard deviation of split frequencies: 0.011761 320500 -- [-1723.504] (-1722.041) (-1722.145) (-1724.489) * [-1724.871] (-1723.987) (-1723.890) (-1722.773) -- 0:00:44 321000 -- (-1723.664) (-1722.837) [-1722.780] (-1722.935) * [-1726.368] (-1722.091) (-1725.670) (-1723.196) -- 0:00:44 321500 -- (-1724.649) (-1723.826) [-1722.272] (-1721.974) * (-1724.050) [-1721.944] (-1723.204) (-1724.689) -- 0:00:44 322000 -- (-1723.929) (-1724.188) (-1729.215) [-1721.924] * (-1726.477) (-1723.578) (-1724.141) [-1723.341] -- 0:00:44 322500 -- (-1726.342) (-1724.240) (-1726.002) [-1722.189] * (-1723.581) (-1727.165) [-1721.090] (-1723.233) -- 0:00:44 323000 -- (-1722.636) (-1721.697) [-1722.627] (-1722.779) * (-1723.268) [-1723.536] (-1723.646) (-1728.759) -- 0:00:44 323500 -- [-1722.162] (-1725.806) (-1724.125) (-1722.439) * (-1722.546) (-1724.710) [-1721.918] (-1721.730) -- 0:00:43 324000 -- (-1723.235) (-1722.943) (-1728.325) [-1723.419] * (-1721.747) (-1725.997) (-1721.487) [-1722.302] -- 0:00:43 324500 -- (-1722.145) (-1723.425) [-1723.050] (-1721.585) * (-1723.085) (-1722.952) [-1725.513] (-1722.171) -- 0:00:43 325000 -- [-1721.108] (-1721.974) (-1722.035) (-1721.508) * (-1722.947) (-1723.651) (-1721.419) [-1724.748] -- 0:00:43 Average standard deviation of split frequencies: 0.011416 325500 -- [-1721.160] (-1722.275) (-1722.005) (-1723.075) * [-1724.774] (-1726.582) (-1724.482) (-1723.182) -- 0:00:43 326000 -- (-1723.095) (-1727.604) [-1723.542] (-1721.498) * (-1723.759) (-1727.357) [-1725.139] (-1725.201) -- 0:00:43 326500 -- [-1721.586] (-1723.536) (-1723.939) (-1721.568) * (-1726.285) (-1725.549) [-1729.297] (-1724.369) -- 0:00:43 327000 -- (-1726.059) (-1724.396) (-1725.691) [-1721.016] * (-1721.678) (-1723.550) [-1722.154] (-1726.181) -- 0:00:43 327500 -- [-1725.501] (-1723.222) (-1724.680) (-1723.898) * (-1723.117) [-1722.444] (-1722.367) (-1724.518) -- 0:00:43 328000 -- (-1721.437) [-1723.447] (-1723.569) (-1721.542) * [-1721.081] (-1727.920) (-1722.925) (-1726.384) -- 0:00:43 328500 -- (-1721.437) (-1721.750) [-1721.791] (-1721.010) * (-1721.970) [-1726.381] (-1721.942) (-1728.589) -- 0:00:42 329000 -- (-1721.350) [-1721.974] (-1724.796) (-1723.618) * (-1723.526) (-1722.723) [-1721.801] (-1727.206) -- 0:00:42 329500 -- (-1721.350) (-1722.296) [-1724.550] (-1722.218) * (-1720.867) [-1724.538] (-1725.633) (-1726.276) -- 0:00:42 330000 -- (-1722.382) (-1721.872) [-1725.392] (-1721.284) * (-1720.894) (-1722.474) (-1726.249) [-1721.086] -- 0:00:42 Average standard deviation of split frequencies: 0.011740 330500 -- (-1725.978) (-1721.508) (-1725.434) [-1721.919] * (-1721.738) [-1723.057] (-1726.249) (-1721.574) -- 0:00:42 331000 -- (-1727.260) (-1721.508) [-1724.858] (-1721.486) * [-1721.558] (-1722.142) (-1727.562) (-1721.049) -- 0:00:42 331500 -- [-1726.129] (-1725.522) (-1726.626) (-1722.824) * [-1724.730] (-1724.387) (-1727.510) (-1725.991) -- 0:00:42 332000 -- [-1722.339] (-1725.789) (-1728.678) (-1722.123) * (-1724.969) (-1725.417) (-1723.852) [-1724.058] -- 0:00:42 332500 -- (-1721.691) [-1722.458] (-1725.930) (-1722.392) * [-1725.202] (-1723.309) (-1722.819) (-1725.058) -- 0:00:42 333000 -- (-1721.253) [-1722.820] (-1724.774) (-1720.894) * (-1723.800) (-1724.447) (-1724.038) [-1722.852] -- 0:00:42 333500 -- (-1721.505) (-1721.855) [-1724.034] (-1730.632) * [-1723.954] (-1725.505) (-1725.667) (-1723.760) -- 0:00:41 334000 -- (-1721.395) (-1723.147) [-1721.314] (-1726.702) * (-1725.154) (-1723.583) (-1724.527) [-1723.176] -- 0:00:41 334500 -- (-1725.063) (-1722.331) (-1726.163) [-1722.141] * (-1722.698) [-1722.785] (-1724.719) (-1723.651) -- 0:00:41 335000 -- (-1723.743) (-1724.467) [-1722.504] (-1726.028) * (-1725.877) (-1725.713) [-1722.990] (-1721.340) -- 0:00:41 Average standard deviation of split frequencies: 0.011750 335500 -- (-1725.347) (-1722.803) [-1721.925] (-1726.387) * [-1725.657] (-1726.196) (-1724.344) (-1722.197) -- 0:00:43 336000 -- [-1722.914] (-1723.019) (-1724.004) (-1728.884) * (-1724.249) [-1723.741] (-1722.420) (-1724.939) -- 0:00:43 336500 -- (-1721.844) (-1722.940) (-1724.248) [-1728.263] * (-1723.526) (-1726.302) (-1725.798) [-1721.616] -- 0:00:43 337000 -- [-1721.891] (-1722.953) (-1724.379) (-1726.195) * (-1723.464) (-1725.109) (-1727.455) [-1722.296] -- 0:00:43 337500 -- (-1722.346) [-1723.080] (-1726.488) (-1724.962) * (-1722.414) [-1721.486] (-1727.659) (-1722.296) -- 0:00:43 338000 -- [-1724.707] (-1724.325) (-1721.927) (-1721.807) * (-1722.514) (-1726.850) (-1722.900) [-1721.929] -- 0:00:43 338500 -- [-1722.252] (-1721.520) (-1722.352) (-1721.664) * (-1721.797) (-1727.076) (-1725.592) [-1723.195] -- 0:00:42 339000 -- [-1721.741] (-1722.598) (-1723.868) (-1725.500) * [-1722.461] (-1727.399) (-1723.441) (-1722.756) -- 0:00:42 339500 -- (-1724.354) (-1722.195) [-1722.818] (-1722.784) * (-1721.964) (-1724.639) (-1724.754) [-1723.775] -- 0:00:42 340000 -- (-1725.027) (-1722.169) (-1721.756) [-1723.542] * (-1722.139) (-1725.122) [-1724.161] (-1721.854) -- 0:00:42 Average standard deviation of split frequencies: 0.011762 340500 -- (-1722.614) (-1727.002) [-1727.594] (-1723.870) * (-1721.996) (-1724.851) [-1723.881] (-1722.205) -- 0:00:42 341000 -- (-1723.443) (-1729.213) [-1724.914] (-1726.576) * (-1723.330) [-1722.299] (-1723.768) (-1721.552) -- 0:00:42 341500 -- (-1723.278) (-1724.699) (-1722.927) [-1724.060] * [-1723.842] (-1722.839) (-1723.053) (-1721.144) -- 0:00:42 342000 -- (-1723.269) (-1725.141) [-1723.703] (-1722.125) * [-1721.746] (-1721.734) (-1722.252) (-1721.349) -- 0:00:42 342500 -- (-1723.293) [-1722.341] (-1724.609) (-1723.383) * [-1721.550] (-1722.382) (-1724.055) (-1721.671) -- 0:00:42 343000 -- (-1723.125) [-1721.843] (-1723.990) (-1722.893) * [-1725.238] (-1723.516) (-1723.579) (-1721.380) -- 0:00:42 343500 -- (-1723.570) (-1723.054) [-1721.994] (-1721.458) * [-1724.457] (-1727.509) (-1723.324) (-1722.711) -- 0:00:42 344000 -- (-1724.160) (-1722.103) [-1722.272] (-1722.321) * (-1724.752) (-1726.803) (-1721.032) [-1723.185] -- 0:00:41 344500 -- (-1722.626) (-1724.927) (-1723.333) [-1722.669] * (-1722.903) (-1725.734) (-1721.080) [-1722.749] -- 0:00:41 345000 -- (-1722.118) (-1725.511) (-1720.921) [-1724.428] * (-1726.435) [-1725.720] (-1721.826) (-1722.916) -- 0:00:41 Average standard deviation of split frequencies: 0.011656 345500 -- (-1722.852) [-1724.116] (-1723.578) (-1725.137) * (-1723.361) (-1726.273) (-1722.088) [-1724.213] -- 0:00:41 346000 -- (-1723.636) (-1725.006) [-1726.248] (-1726.822) * (-1722.435) (-1722.983) (-1724.243) [-1724.548] -- 0:00:41 346500 -- (-1723.637) (-1722.782) (-1724.081) [-1727.622] * [-1722.207] (-1722.425) (-1722.660) (-1724.969) -- 0:00:41 347000 -- [-1722.354] (-1722.735) (-1726.336) (-1721.666) * (-1724.482) (-1723.158) [-1722.230] (-1723.332) -- 0:00:41 347500 -- (-1722.739) (-1722.735) [-1722.435] (-1722.151) * (-1723.809) (-1722.173) [-1722.816] (-1722.872) -- 0:00:41 348000 -- (-1722.444) (-1727.175) (-1724.089) [-1722.272] * (-1725.068) (-1722.119) [-1722.148] (-1722.007) -- 0:00:41 348500 -- [-1723.963] (-1722.810) (-1724.143) (-1723.491) * (-1721.329) [-1721.541] (-1725.107) (-1722.330) -- 0:00:41 349000 -- (-1725.146) (-1721.760) (-1722.381) [-1724.501] * (-1721.235) [-1721.477] (-1726.591) (-1723.588) -- 0:00:41 349500 -- (-1725.129) [-1724.810] (-1721.975) (-1723.223) * (-1725.654) (-1724.239) [-1724.843] (-1723.480) -- 0:00:40 350000 -- (-1725.092) (-1723.760) [-1722.040] (-1721.716) * (-1726.613) (-1725.904) [-1726.732] (-1723.352) -- 0:00:42 Average standard deviation of split frequencies: 0.011308 350500 -- (-1725.226) (-1723.462) [-1722.939] (-1720.880) * (-1723.395) (-1725.717) [-1722.769] (-1721.918) -- 0:00:42 351000 -- (-1725.080) (-1725.753) [-1723.715] (-1721.800) * (-1721.549) [-1724.042] (-1723.093) (-1723.452) -- 0:00:42 351500 -- (-1721.345) (-1723.266) (-1722.985) [-1721.294] * (-1724.080) (-1724.042) (-1723.199) [-1723.473] -- 0:00:42 352000 -- (-1726.812) [-1723.066] (-1722.013) (-1721.288) * (-1726.115) (-1722.392) [-1722.206] (-1722.652) -- 0:00:42 352500 -- (-1726.298) (-1723.680) (-1722.116) [-1721.186] * (-1721.588) (-1730.744) (-1722.750) [-1724.740] -- 0:00:42 353000 -- (-1725.786) (-1723.358) (-1722.296) [-1721.127] * (-1723.296) (-1726.103) [-1726.566] (-1722.165) -- 0:00:42 353500 -- [-1722.454] (-1728.011) (-1723.686) (-1721.815) * [-1722.924] (-1723.143) (-1722.640) (-1722.125) -- 0:00:42 354000 -- (-1723.445) (-1723.056) [-1724.207] (-1721.795) * (-1722.644) (-1722.382) (-1722.667) [-1725.319] -- 0:00:41 354500 -- [-1721.868] (-1722.868) (-1724.952) (-1724.609) * (-1721.952) (-1722.438) (-1724.840) [-1721.910] -- 0:00:41 355000 -- (-1722.819) [-1723.492] (-1721.453) (-1725.499) * (-1723.874) (-1722.232) (-1721.382) [-1723.530] -- 0:00:41 Average standard deviation of split frequencies: 0.009446 355500 -- (-1722.914) [-1723.504] (-1721.437) (-1725.592) * (-1721.567) (-1724.785) [-1725.499] (-1722.120) -- 0:00:41 356000 -- (-1724.752) (-1725.715) [-1721.324] (-1722.396) * [-1721.298] (-1721.040) (-1724.038) (-1723.688) -- 0:00:41 356500 -- (-1725.229) [-1721.882] (-1723.293) (-1724.524) * (-1721.415) [-1721.395] (-1722.689) (-1722.421) -- 0:00:41 357000 -- [-1724.893] (-1723.488) (-1723.036) (-1721.890) * [-1723.630] (-1727.314) (-1721.475) (-1725.683) -- 0:00:41 357500 -- (-1726.015) (-1723.213) [-1721.805] (-1721.892) * (-1722.427) [-1726.541] (-1722.812) (-1724.659) -- 0:00:41 358000 -- (-1725.031) (-1722.309) (-1722.891) [-1721.880] * (-1722.253) [-1725.354] (-1726.172) (-1727.333) -- 0:00:41 358500 -- [-1724.460] (-1722.394) (-1722.985) (-1721.070) * (-1724.266) (-1725.511) [-1722.116] (-1723.911) -- 0:00:41 359000 -- [-1722.717] (-1722.272) (-1722.471) (-1723.623) * (-1726.313) (-1722.491) [-1720.863] (-1723.397) -- 0:00:41 359500 -- [-1722.502] (-1722.160) (-1722.411) (-1723.106) * [-1722.324] (-1722.543) (-1720.875) (-1723.409) -- 0:00:40 360000 -- (-1726.449) [-1722.593] (-1725.456) (-1722.938) * [-1723.106] (-1722.519) (-1721.084) (-1723.000) -- 0:00:40 Average standard deviation of split frequencies: 0.009672 360500 -- (-1726.518) (-1723.040) (-1724.719) [-1723.825] * [-1726.064] (-1723.041) (-1721.594) (-1723.489) -- 0:00:40 361000 -- (-1725.972) (-1722.870) (-1730.845) [-1722.807] * (-1721.925) (-1723.024) (-1722.544) [-1724.490] -- 0:00:40 361500 -- [-1723.102] (-1725.030) (-1723.211) (-1724.183) * (-1721.080) (-1721.525) (-1721.120) [-1723.054] -- 0:00:40 362000 -- (-1724.231) (-1722.438) (-1720.916) [-1721.960] * [-1721.137] (-1722.657) (-1723.835) (-1724.211) -- 0:00:40 362500 -- (-1722.214) [-1723.439] (-1723.034) (-1721.344) * [-1721.208] (-1721.275) (-1724.473) (-1730.805) -- 0:00:40 363000 -- (-1724.897) (-1722.362) [-1724.814] (-1722.261) * (-1721.472) (-1722.185) [-1725.334] (-1732.637) -- 0:00:40 363500 -- (-1724.897) [-1723.768] (-1723.388) (-1721.788) * (-1724.722) [-1725.485] (-1723.288) (-1725.337) -- 0:00:40 364000 -- [-1724.668] (-1722.499) (-1724.714) (-1721.545) * [-1721.951] (-1724.472) (-1724.495) (-1723.867) -- 0:00:40 364500 -- (-1726.139) (-1723.478) [-1724.885] (-1723.109) * (-1721.663) (-1726.103) [-1721.267] (-1724.683) -- 0:00:40 365000 -- (-1722.321) (-1723.059) [-1724.598] (-1722.161) * [-1724.206] (-1726.430) (-1722.382) (-1722.384) -- 0:00:40 Average standard deviation of split frequencies: 0.008758 365500 -- (-1722.794) [-1722.854] (-1721.796) (-1720.890) * (-1722.164) (-1726.770) (-1723.389) [-1722.767] -- 0:00:41 366000 -- (-1723.093) [-1723.815] (-1721.817) (-1724.062) * (-1723.216) (-1725.236) (-1722.299) [-1722.779] -- 0:00:41 366500 -- (-1722.974) [-1727.054] (-1723.722) (-1722.456) * (-1721.897) [-1724.248] (-1723.427) (-1729.678) -- 0:00:41 367000 -- [-1722.864] (-1726.725) (-1726.282) (-1724.843) * (-1721.608) (-1727.576) (-1721.925) [-1724.406] -- 0:00:41 367500 -- (-1723.037) (-1726.624) (-1724.292) [-1722.162] * [-1722.711] (-1724.707) (-1725.534) (-1727.371) -- 0:00:41 368000 -- (-1722.499) [-1722.342] (-1724.199) (-1721.709) * [-1722.116] (-1725.896) (-1724.291) (-1728.860) -- 0:00:41 368500 -- [-1721.555] (-1725.761) (-1727.129) (-1724.320) * (-1723.468) (-1723.192) [-1724.005] (-1723.127) -- 0:00:41 369000 -- (-1724.769) [-1721.892] (-1730.550) (-1724.759) * (-1722.591) (-1723.304) (-1721.087) [-1723.663] -- 0:00:41 369500 -- (-1724.340) (-1721.844) (-1722.851) [-1726.853] * (-1725.066) (-1721.331) (-1721.376) [-1724.187] -- 0:00:40 370000 -- (-1722.599) [-1724.285] (-1722.279) (-1724.663) * [-1722.652] (-1721.331) (-1721.249) (-1725.086) -- 0:00:40 Average standard deviation of split frequencies: 0.009496 370500 -- [-1721.877] (-1723.198) (-1722.245) (-1731.070) * (-1722.660) [-1722.957] (-1724.791) (-1723.213) -- 0:00:40 371000 -- (-1723.674) (-1721.769) (-1727.571) [-1725.361] * [-1722.088] (-1722.034) (-1723.941) (-1722.077) -- 0:00:40 371500 -- (-1723.440) (-1724.684) (-1723.305) [-1727.067] * [-1723.686] (-1724.660) (-1721.724) (-1722.995) -- 0:00:40 372000 -- [-1724.701] (-1724.251) (-1722.326) (-1724.150) * [-1724.975] (-1723.601) (-1723.702) (-1724.626) -- 0:00:40 372500 -- (-1723.934) (-1726.058) [-1722.814] (-1723.292) * (-1721.354) (-1729.204) (-1721.676) [-1727.126] -- 0:00:40 373000 -- [-1723.703] (-1722.854) (-1722.520) (-1725.321) * (-1723.906) [-1726.031] (-1721.676) (-1726.011) -- 0:00:40 373500 -- (-1723.523) (-1722.690) (-1722.111) [-1725.094] * (-1721.631) (-1726.035) (-1724.305) [-1722.912] -- 0:00:40 374000 -- (-1723.085) (-1721.762) [-1721.407] (-1723.204) * [-1721.342] (-1722.155) (-1721.358) (-1722.757) -- 0:00:40 374500 -- (-1722.855) (-1723.722) (-1729.714) [-1721.105] * (-1723.902) (-1721.888) [-1725.813] (-1725.303) -- 0:00:40 375000 -- (-1723.934) [-1723.313] (-1721.941) (-1721.107) * (-1721.043) (-1721.743) (-1725.072) [-1721.567] -- 0:00:40 Average standard deviation of split frequencies: 0.010578 375500 -- [-1722.743] (-1722.984) (-1723.413) (-1721.107) * (-1724.209) [-1721.652] (-1728.201) (-1722.542) -- 0:00:39 376000 -- (-1725.112) (-1723.807) (-1724.147) [-1723.415] * (-1722.125) [-1724.569] (-1721.220) (-1725.666) -- 0:00:39 376500 -- (-1723.209) [-1723.163] (-1726.596) (-1723.930) * [-1725.857] (-1721.212) (-1721.340) (-1720.960) -- 0:00:39 377000 -- (-1722.833) [-1723.552] (-1725.787) (-1722.015) * [-1722.914] (-1723.766) (-1721.351) (-1724.624) -- 0:00:39 377500 -- (-1726.341) (-1726.325) (-1727.099) [-1722.515] * (-1723.512) (-1723.561) [-1721.355] (-1723.106) -- 0:00:39 378000 -- (-1721.590) (-1723.084) (-1722.145) [-1722.166] * [-1723.352] (-1725.368) (-1721.713) (-1724.832) -- 0:00:39 378500 -- (-1724.713) (-1724.456) (-1721.661) [-1721.588] * (-1723.939) (-1723.207) (-1723.629) [-1724.832] -- 0:00:39 379000 -- (-1729.495) (-1723.532) (-1724.229) [-1721.353] * (-1723.484) (-1722.195) (-1725.385) [-1725.045] -- 0:00:39 379500 -- (-1722.547) (-1724.171) [-1722.457] (-1722.706) * [-1723.611] (-1723.607) (-1722.098) (-1725.058) -- 0:00:39 380000 -- [-1724.501] (-1723.690) (-1722.056) (-1725.407) * (-1724.956) (-1723.065) [-1721.636] (-1724.286) -- 0:00:39 Average standard deviation of split frequencies: 0.010681 380500 -- (-1722.288) [-1722.654] (-1721.230) (-1727.196) * (-1726.345) (-1723.810) [-1721.374] (-1723.338) -- 0:00:39 381000 -- (-1724.043) (-1722.460) (-1721.429) [-1721.271] * (-1723.256) [-1722.284] (-1724.512) (-1721.983) -- 0:00:40 381500 -- (-1724.483) (-1723.406) (-1723.908) [-1721.271] * (-1722.221) (-1724.625) (-1721.907) [-1724.883] -- 0:00:40 382000 -- (-1724.086) (-1723.264) (-1722.794) [-1721.138] * (-1723.671) (-1724.462) (-1722.596) [-1725.209] -- 0:00:40 382500 -- [-1724.285] (-1725.006) (-1723.256) (-1723.325) * (-1724.916) [-1724.486] (-1723.281) (-1725.483) -- 0:00:40 383000 -- (-1724.734) [-1722.732] (-1722.246) (-1725.978) * (-1722.901) (-1721.144) [-1721.329] (-1723.472) -- 0:00:40 383500 -- (-1723.427) [-1722.099] (-1721.668) (-1729.030) * (-1725.259) (-1722.757) [-1722.514] (-1723.106) -- 0:00:40 384000 -- (-1722.530) [-1722.416] (-1724.195) (-1721.472) * (-1726.648) (-1723.907) [-1722.581] (-1725.115) -- 0:00:40 384500 -- (-1726.344) (-1729.457) (-1721.444) [-1723.446] * (-1723.179) [-1723.907] (-1723.362) (-1722.278) -- 0:00:40 385000 -- (-1725.248) (-1723.760) [-1721.445] (-1724.116) * (-1726.986) (-1725.791) [-1722.050] (-1721.966) -- 0:00:39 Average standard deviation of split frequencies: 0.010915 385500 -- (-1723.165) [-1726.135] (-1722.039) (-1722.780) * (-1725.059) (-1722.816) (-1725.833) [-1722.199] -- 0:00:39 386000 -- (-1725.497) (-1727.940) (-1723.228) [-1722.658] * [-1721.254] (-1723.625) (-1729.532) (-1723.729) -- 0:00:39 386500 -- (-1724.095) [-1721.705] (-1722.340) (-1722.856) * (-1721.785) (-1722.814) [-1727.480] (-1721.034) -- 0:00:39 387000 -- (-1725.595) [-1721.727] (-1722.597) (-1722.341) * [-1723.311] (-1721.677) (-1722.491) (-1722.938) -- 0:00:39 387500 -- (-1726.404) (-1720.834) [-1722.312] (-1721.485) * (-1724.358) [-1721.649] (-1724.519) (-1724.675) -- 0:00:39 388000 -- (-1721.570) (-1721.028) [-1722.159] (-1722.588) * (-1725.635) (-1722.631) (-1723.118) [-1722.123] -- 0:00:39 388500 -- [-1722.642] (-1723.334) (-1721.983) (-1721.775) * (-1726.937) (-1721.358) (-1724.146) [-1724.866] -- 0:00:39 389000 -- (-1722.561) (-1724.990) (-1722.971) [-1722.559] * (-1725.905) (-1726.050) [-1721.951] (-1722.464) -- 0:00:39 389500 -- [-1723.885] (-1721.637) (-1722.539) (-1724.328) * (-1726.400) (-1725.464) (-1722.560) [-1721.924] -- 0:00:39 390000 -- (-1722.450) (-1726.034) (-1722.027) [-1723.418] * (-1722.916) (-1725.785) (-1723.390) [-1722.545] -- 0:00:39 Average standard deviation of split frequencies: 0.010860 390500 -- (-1722.431) (-1727.737) (-1723.669) [-1723.930] * (-1723.351) (-1723.745) (-1722.758) [-1721.681] -- 0:00:39 391000 -- (-1723.800) (-1729.730) [-1724.975] (-1722.545) * [-1723.372] (-1722.647) (-1722.878) (-1725.567) -- 0:00:38 391500 -- (-1726.299) [-1726.730] (-1725.156) (-1721.601) * (-1723.719) [-1721.491] (-1725.079) (-1725.187) -- 0:00:38 392000 -- (-1726.344) (-1729.230) (-1721.854) [-1721.619] * [-1721.278] (-1725.482) (-1724.291) (-1724.399) -- 0:00:38 392500 -- (-1726.115) [-1722.671] (-1722.595) (-1722.124) * [-1721.278] (-1723.215) (-1725.181) (-1723.001) -- 0:00:38 393000 -- (-1723.249) (-1722.672) (-1722.534) [-1724.931] * (-1723.506) [-1722.405] (-1725.703) (-1724.363) -- 0:00:38 393500 -- [-1725.431] (-1722.749) (-1722.309) (-1723.612) * (-1726.156) [-1722.743] (-1728.544) (-1724.360) -- 0:00:38 394000 -- (-1721.077) (-1725.355) (-1724.777) [-1723.175] * (-1728.417) (-1722.934) [-1721.622] (-1724.066) -- 0:00:38 394500 -- (-1721.128) (-1723.230) [-1721.508] (-1720.939) * [-1722.205] (-1728.322) (-1722.361) (-1722.538) -- 0:00:38 395000 -- (-1721.862) (-1721.132) (-1723.809) [-1721.048] * (-1722.305) (-1722.370) [-1721.446] (-1727.530) -- 0:00:38 Average standard deviation of split frequencies: 0.011458 395500 -- (-1721.239) (-1722.369) [-1721.696] (-1721.696) * [-1724.912] (-1723.101) (-1722.595) (-1725.338) -- 0:00:38 396000 -- (-1722.431) (-1724.577) (-1721.709) [-1721.572] * (-1722.483) (-1724.233) [-1726.708] (-1723.615) -- 0:00:38 396500 -- (-1723.787) [-1724.793] (-1721.833) (-1725.544) * (-1725.845) [-1722.017] (-1728.287) (-1726.374) -- 0:00:39 397000 -- (-1722.033) (-1723.735) (-1721.344) [-1727.692] * (-1724.223) [-1721.962] (-1726.316) (-1728.919) -- 0:00:39 397500 -- (-1725.110) (-1723.461) (-1721.218) [-1726.862] * [-1725.706] (-1723.940) (-1731.114) (-1722.998) -- 0:00:39 398000 -- [-1723.031] (-1722.825) (-1722.484) (-1725.346) * (-1725.199) [-1721.952] (-1725.863) (-1725.415) -- 0:00:39 398500 -- (-1724.890) [-1722.845] (-1721.139) (-1722.389) * (-1725.002) (-1721.755) (-1723.931) [-1722.522] -- 0:00:39 399000 -- (-1730.618) (-1723.564) (-1721.092) [-1722.624] * (-1724.388) [-1724.387] (-1722.247) (-1721.758) -- 0:00:39 399500 -- (-1722.313) (-1722.937) (-1721.080) [-1723.103] * (-1721.923) (-1722.551) [-1724.182] (-1723.364) -- 0:00:39 400000 -- (-1722.647) (-1724.236) [-1723.362] (-1723.247) * [-1721.856] (-1721.408) (-1724.665) (-1723.909) -- 0:00:39 Average standard deviation of split frequencies: 0.011324 400500 -- (-1722.087) [-1724.952] (-1723.049) (-1722.744) * (-1722.883) [-1720.867] (-1724.817) (-1724.496) -- 0:00:38 401000 -- (-1721.919) (-1727.220) [-1724.054] (-1721.755) * (-1721.514) (-1722.502) [-1722.828] (-1721.955) -- 0:00:38 401500 -- (-1726.442) [-1724.134] (-1723.274) (-1722.633) * (-1725.033) (-1722.006) [-1727.074] (-1721.783) -- 0:00:38 402000 -- (-1724.176) [-1723.001] (-1723.021) (-1722.843) * (-1722.591) [-1721.648] (-1728.946) (-1721.538) -- 0:00:38 402500 -- (-1721.714) (-1722.428) (-1721.526) [-1721.219] * (-1722.298) [-1725.041] (-1722.161) (-1724.524) -- 0:00:38 403000 -- (-1722.680) (-1724.587) [-1721.550] (-1724.026) * (-1722.107) (-1726.718) [-1721.339] (-1722.234) -- 0:00:38 403500 -- (-1725.994) [-1722.478] (-1722.416) (-1723.462) * (-1723.757) [-1723.744] (-1723.365) (-1721.944) -- 0:00:38 404000 -- [-1726.901] (-1723.126) (-1722.323) (-1725.564) * (-1723.281) (-1725.003) [-1721.769] (-1725.572) -- 0:00:38 404500 -- (-1726.261) (-1722.542) [-1721.660] (-1723.477) * (-1721.886) (-1723.490) [-1721.966] (-1728.544) -- 0:00:38 405000 -- [-1724.077] (-1722.048) (-1725.167) (-1723.547) * (-1722.571) (-1724.282) (-1724.115) [-1728.597] -- 0:00:38 Average standard deviation of split frequencies: 0.011393 405500 -- [-1724.783] (-1724.126) (-1724.487) (-1723.967) * (-1722.695) [-1722.253] (-1723.059) (-1727.799) -- 0:00:38 406000 -- (-1724.163) (-1724.090) (-1725.616) [-1721.453] * (-1722.695) [-1721.486] (-1722.866) (-1722.818) -- 0:00:38 406500 -- [-1721.243] (-1722.858) (-1724.651) (-1721.483) * (-1721.792) (-1721.629) (-1723.452) [-1721.385] -- 0:00:37 407000 -- (-1721.266) (-1722.113) (-1724.926) [-1722.166] * [-1722.974] (-1720.933) (-1724.004) (-1724.884) -- 0:00:37 407500 -- (-1721.240) (-1726.379) [-1723.725] (-1725.221) * (-1722.405) [-1721.451] (-1723.176) (-1721.765) -- 0:00:37 408000 -- (-1722.775) (-1724.587) (-1722.314) [-1722.402] * (-1724.195) (-1722.629) (-1724.456) [-1724.196] -- 0:00:37 408500 -- (-1724.271) [-1726.977] (-1723.915) (-1723.177) * [-1725.275] (-1724.181) (-1721.361) (-1723.414) -- 0:00:37 409000 -- (-1727.112) (-1722.758) (-1724.053) [-1723.082] * (-1725.564) (-1722.585) [-1722.185] (-1730.432) -- 0:00:37 409500 -- (-1724.924) [-1721.596] (-1722.678) (-1723.243) * (-1725.394) [-1721.121] (-1722.417) (-1722.220) -- 0:00:37 410000 -- [-1722.499] (-1724.051) (-1722.483) (-1723.624) * [-1724.222] (-1728.877) (-1721.133) (-1721.467) -- 0:00:37 Average standard deviation of split frequencies: 0.010264 410500 -- (-1725.289) (-1724.326) (-1724.471) [-1723.926] * (-1722.769) [-1725.215] (-1722.566) (-1723.858) -- 0:00:37 411000 -- (-1722.277) [-1722.217] (-1722.684) (-1724.115) * (-1723.767) (-1723.439) (-1723.727) [-1721.833] -- 0:00:37 411500 -- (-1722.145) [-1721.714] (-1724.709) (-1724.097) * (-1722.356) (-1723.505) [-1724.790] (-1726.155) -- 0:00:37 412000 -- [-1722.348] (-1722.322) (-1725.053) (-1725.296) * [-1723.675] (-1725.986) (-1723.393) (-1726.817) -- 0:00:38 412500 -- (-1722.093) (-1722.635) (-1724.579) [-1721.859] * [-1722.153] (-1725.850) (-1724.889) (-1721.989) -- 0:00:38 413000 -- (-1726.557) (-1721.618) [-1722.467] (-1723.073) * (-1722.229) (-1730.681) [-1723.146] (-1722.245) -- 0:00:38 413500 -- (-1721.009) (-1721.696) [-1722.043] (-1723.569) * (-1722.767) (-1724.789) (-1722.761) [-1721.414] -- 0:00:38 414000 -- (-1722.563) (-1722.182) [-1722.045] (-1722.216) * (-1724.369) (-1723.530) [-1721.994] (-1721.500) -- 0:00:38 414500 -- (-1721.013) (-1721.787) (-1723.044) [-1721.769] * (-1722.937) [-1723.376] (-1722.964) (-1721.326) -- 0:00:38 415000 -- (-1725.360) (-1721.672) [-1721.108] (-1729.055) * (-1721.855) [-1722.914] (-1723.116) (-1724.713) -- 0:00:38 Average standard deviation of split frequencies: 0.010132 415500 -- [-1725.058] (-1722.744) (-1721.892) (-1722.687) * (-1722.711) [-1723.282] (-1722.957) (-1723.071) -- 0:00:37 416000 -- [-1725.565] (-1723.444) (-1721.355) (-1722.909) * [-1721.774] (-1722.178) (-1724.026) (-1724.997) -- 0:00:37 416500 -- (-1725.817) (-1722.549) (-1723.104) [-1722.715] * [-1722.318] (-1722.692) (-1724.103) (-1724.537) -- 0:00:37 417000 -- (-1725.172) [-1721.808] (-1723.150) (-1721.934) * (-1722.709) (-1724.172) (-1726.593) [-1725.993] -- 0:00:37 417500 -- [-1724.537] (-1722.568) (-1724.352) (-1721.976) * (-1721.636) [-1727.516] (-1724.128) (-1722.902) -- 0:00:37 418000 -- (-1722.872) (-1721.675) (-1722.306) [-1721.838] * (-1721.779) (-1725.284) (-1723.196) [-1723.564] -- 0:00:37 418500 -- (-1721.199) (-1723.095) [-1722.207] (-1721.888) * (-1722.219) (-1725.665) (-1724.895) [-1723.084] -- 0:00:37 419000 -- (-1723.377) (-1726.891) (-1721.376) [-1722.052] * (-1721.341) [-1724.138] (-1722.487) (-1721.179) -- 0:00:37 419500 -- [-1723.421] (-1722.005) (-1722.599) (-1723.257) * (-1723.812) (-1723.511) (-1722.666) [-1721.115] -- 0:00:37 420000 -- (-1724.982) (-1724.335) (-1721.642) [-1723.514] * (-1724.147) [-1722.991] (-1722.452) (-1721.706) -- 0:00:37 Average standard deviation of split frequencies: 0.010283 420500 -- (-1722.737) (-1724.352) [-1721.621] (-1723.214) * (-1722.569) (-1724.717) [-1727.709] (-1721.672) -- 0:00:37 421000 -- (-1723.634) [-1722.346] (-1721.801) (-1725.204) * (-1721.875) (-1726.191) (-1721.880) [-1722.018] -- 0:00:37 421500 -- (-1722.951) [-1721.953] (-1721.876) (-1721.524) * (-1724.164) [-1721.859] (-1721.897) (-1722.032) -- 0:00:37 422000 -- (-1722.453) [-1721.948] (-1721.649) (-1727.232) * (-1722.347) (-1721.901) [-1724.396] (-1724.710) -- 0:00:36 422500 -- [-1724.439] (-1722.077) (-1721.833) (-1723.419) * [-1722.531] (-1721.426) (-1725.533) (-1724.407) -- 0:00:36 423000 -- (-1724.378) (-1724.507) [-1721.607] (-1724.059) * (-1723.364) (-1721.601) (-1725.112) [-1720.973] -- 0:00:36 423500 -- (-1726.671) [-1723.477] (-1721.810) (-1721.579) * (-1726.856) (-1722.991) [-1721.764] (-1722.272) -- 0:00:36 424000 -- [-1724.877] (-1724.240) (-1723.372) (-1723.050) * (-1725.604) (-1723.086) [-1722.755] (-1721.929) -- 0:00:36 424500 -- (-1723.001) (-1724.508) [-1721.280] (-1723.286) * (-1722.104) (-1722.954) (-1724.462) [-1722.403] -- 0:00:36 425000 -- (-1726.073) [-1723.599] (-1721.192) (-1724.375) * [-1722.200] (-1722.533) (-1724.068) (-1724.749) -- 0:00:36 Average standard deviation of split frequencies: 0.009959 425500 -- (-1721.869) [-1723.787] (-1720.923) (-1724.910) * (-1721.688) (-1723.065) (-1726.187) [-1722.606] -- 0:00:36 426000 -- (-1723.322) (-1724.227) [-1721.907] (-1723.989) * (-1721.057) [-1722.787] (-1724.167) (-1722.796) -- 0:00:36 426500 -- [-1722.533] (-1724.806) (-1722.699) (-1723.978) * (-1724.158) (-1722.898) (-1724.039) [-1729.758] -- 0:00:36 427000 -- (-1722.722) (-1723.685) (-1722.884) [-1722.077] * (-1724.222) (-1724.487) (-1724.022) [-1724.271] -- 0:00:36 427500 -- (-1722.488) (-1723.545) [-1723.439] (-1721.971) * (-1722.690) (-1723.237) (-1722.149) [-1724.851] -- 0:00:37 428000 -- (-1721.689) [-1721.722] (-1725.787) (-1722.075) * (-1721.845) (-1724.116) [-1725.298] (-1724.270) -- 0:00:37 428500 -- [-1721.958] (-1722.977) (-1725.679) (-1722.210) * (-1722.111) (-1721.573) [-1722.516] (-1723.081) -- 0:00:37 429000 -- [-1721.140] (-1723.315) (-1722.191) (-1722.097) * (-1724.410) [-1725.200] (-1725.000) (-1722.636) -- 0:00:37 429500 -- [-1721.460] (-1721.417) (-1722.500) (-1723.184) * (-1723.103) (-1723.381) [-1724.421] (-1727.447) -- 0:00:37 430000 -- (-1723.661) (-1721.499) (-1721.284) [-1725.250] * (-1725.562) (-1723.795) (-1722.107) [-1721.880] -- 0:00:37 Average standard deviation of split frequencies: 0.010057 430500 -- [-1722.069] (-1723.788) (-1724.828) (-1725.835) * (-1724.823) [-1723.453] (-1727.987) (-1722.877) -- 0:00:37 431000 -- (-1723.318) [-1723.505] (-1722.760) (-1729.576) * (-1728.337) (-1722.255) [-1726.743] (-1723.153) -- 0:00:36 431500 -- (-1724.972) [-1721.108] (-1729.747) (-1723.509) * [-1724.211] (-1721.619) (-1725.382) (-1722.468) -- 0:00:36 432000 -- (-1724.675) (-1724.344) [-1723.547] (-1723.789) * [-1725.732] (-1725.516) (-1727.033) (-1723.435) -- 0:00:36 432500 -- (-1724.308) [-1721.498] (-1721.742) (-1726.134) * (-1724.379) (-1724.791) (-1729.673) [-1721.522] -- 0:00:36 433000 -- (-1725.421) [-1721.536] (-1723.043) (-1722.835) * (-1724.974) [-1725.097] (-1726.162) (-1721.689) -- 0:00:36 433500 -- (-1728.076) (-1721.272) (-1724.107) [-1722.597] * (-1724.979) (-1724.192) (-1723.467) [-1721.613] -- 0:00:36 434000 -- (-1728.769) (-1721.475) [-1720.975] (-1723.147) * (-1726.355) (-1721.291) (-1725.441) [-1722.744] -- 0:00:36 434500 -- (-1722.576) (-1722.303) [-1720.968] (-1723.349) * [-1724.109] (-1722.511) (-1724.645) (-1729.838) -- 0:00:36 435000 -- (-1722.566) [-1721.403] (-1724.187) (-1723.959) * (-1726.200) [-1721.789] (-1722.434) (-1721.810) -- 0:00:36 Average standard deviation of split frequencies: 0.009286 435500 -- (-1729.931) [-1721.508] (-1727.009) (-1724.851) * (-1726.474) (-1722.061) (-1721.695) [-1722.385] -- 0:00:36 436000 -- (-1729.264) [-1723.513] (-1726.586) (-1722.149) * (-1722.630) (-1721.787) (-1724.731) [-1724.862] -- 0:00:36 436500 -- (-1721.703) [-1722.723] (-1726.297) (-1723.047) * (-1724.704) (-1723.221) (-1723.449) [-1727.872] -- 0:00:36 437000 -- (-1722.617) [-1722.031] (-1724.326) (-1723.977) * (-1725.300) (-1722.025) [-1721.989] (-1722.820) -- 0:00:36 43