--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:53:53 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0525/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -234.64 -238.51
2 -234.63 -238.64
--------------------------------------
TOTAL -234.64 -238.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890759 0.093035 0.373417 1.515343 0.855872 1501.00 1501.00 1.000
r(A<->C){all} 0.163547 0.021189 0.000030 0.477694 0.120179 139.96 175.00 1.003
r(A<->G){all} 0.169576 0.022093 0.000038 0.473322 0.127536 213.96 215.36 1.000
r(A<->T){all} 0.171954 0.020561 0.000073 0.464065 0.133910 166.40 218.23 1.000
r(C<->G){all} 0.160595 0.019227 0.000011 0.443425 0.123870 291.16 396.32 1.001
r(C<->T){all} 0.171234 0.020441 0.000216 0.458397 0.135919 300.04 311.01 1.000
r(G<->T){all} 0.163093 0.018908 0.000037 0.440438 0.127398 202.54 217.82 1.000
pi(A){all} 0.136184 0.000695 0.087296 0.188564 0.135216 1316.51 1394.38 1.001
pi(C){all} 0.280537 0.001168 0.216484 0.347255 0.280108 976.58 1082.87 1.000
pi(G){all} 0.331519 0.001300 0.259578 0.398590 0.330319 1192.81 1279.22 1.000
pi(T){all} 0.251760 0.001055 0.191203 0.318041 0.252001 779.19 1054.80 1.000
alpha{1,2} 0.407429 0.234626 0.000111 1.363863 0.237115 1285.23 1315.56 1.000
alpha{3} 0.449963 0.225913 0.000185 1.421668 0.287054 1247.09 1374.05 1.000
pinvar{all} 0.990120 0.000142 0.968609 0.999994 0.993812 1081.51 1162.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -229.270025
Model 2: PositiveSelection -229.270011
Model 0: one-ratio -229.27003
Model 7: beta -229.270022
Model 8: beta&w>1 -229.270011
Model 0 vs 1 9.999999974752427E-6
Model 2 vs 1 2.7999999986150215E-5
Model 8 vs 7 2.200000000129876E-5
>C1
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C2
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C3
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C4
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C5
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C6
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=58
C1 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C2 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C3 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C4 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C5 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C6 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
**************************************************
C1 LDVPQPAP
C2 LDVPQPAP
C3 LDVPQPAP
C4 LDVPQPAP
C5 LDVPQPAP
C6 LDVPQPAP
********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1740]--->[1740]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.442 Mb, Max= 30.575 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C2 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C3 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C4 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C5 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C6 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
**************************************************
C1 LDVPQPAP
C2 LDVPQPAP
C3 LDVPQPAP
C4 LDVPQPAP
C5 LDVPQPAP
C6 LDVPQPAP
********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C2 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C3 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C4 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C5 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C6 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
**************************************************
C1 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C2 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C3 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C4 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C5 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C6 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
**************************************************
C1 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C2 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C3 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C4 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C5 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C6 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
**************************************************
C1 TTGGATGTCCCGCAGCCTGCCCCC
C2 TTGGATGTCCCGCAGCCTGCCCCC
C3 TTGGATGTCCCGCAGCCTGCCCCC
C4 TTGGATGTCCCGCAGCCTGCCCCC
C5 TTGGATGTCCCGCAGCCTGCCCCC
C6 TTGGATGTCCCGCAGCCTGCCCCC
************************
>C1
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C2
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C3
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C4
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C5
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C6
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C1
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C2
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C3
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C4
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C5
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C6
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 174 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579801950
Setting output file names to "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1550866114
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1247554456
Seed = 700052954
Swapseed = 1579801950
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -389.420317 -- -24.965149
Chain 2 -- -389.420340 -- -24.965149
Chain 3 -- -389.420340 -- -24.965149
Chain 4 -- -389.420317 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -389.420317 -- -24.965149
Chain 2 -- -389.420340 -- -24.965149
Chain 3 -- -389.420317 -- -24.965149
Chain 4 -- -389.420317 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-389.420] (-389.420) (-389.420) (-389.420) * [-389.420] (-389.420) (-389.420) (-389.420)
500 -- (-242.252) (-254.459) (-244.849) [-243.609] * (-255.403) (-245.108) [-241.009] (-246.278) -- 0:00:00
1000 -- (-244.051) (-254.750) [-243.094] (-238.809) * (-250.148) [-245.773] (-238.792) (-239.452) -- 0:00:00
1500 -- [-242.818] (-240.220) (-238.990) (-246.346) * (-248.700) (-245.058) [-240.482] (-243.622) -- 0:00:00
2000 -- [-243.234] (-243.934) (-246.090) (-243.459) * (-247.799) (-243.011) [-247.407] (-247.026) -- 0:00:00
2500 -- (-238.278) (-245.101) (-247.105) [-239.826] * (-239.952) (-242.914) (-242.086) [-242.598] -- 0:06:39
3000 -- (-240.668) [-244.953] (-241.705) (-240.294) * [-241.096] (-240.898) (-244.507) (-247.328) -- 0:05:32
3500 -- (-243.107) (-243.900) [-245.657] (-242.497) * [-238.907] (-246.361) (-240.643) (-244.241) -- 0:04:44
4000 -- (-246.190) (-245.656) (-244.785) [-243.762] * (-248.555) [-241.278] (-242.057) (-243.845) -- 0:04:09
4500 -- (-241.717) (-248.719) [-241.525] (-246.387) * (-246.941) (-245.478) [-243.200] (-247.351) -- 0:03:41
5000 -- [-246.386] (-241.751) (-243.833) (-238.499) * [-240.361] (-252.157) (-242.446) (-246.854) -- 0:03:19
Average standard deviation of split frequencies: 0.099995
5500 -- [-244.229] (-256.754) (-255.362) (-246.164) * (-243.297) [-241.482] (-246.780) (-241.429) -- 0:03:00
6000 -- (-245.680) (-247.324) [-241.918] (-247.280) * [-238.179] (-255.321) (-252.751) (-250.891) -- 0:02:45
6500 -- (-242.066) [-247.786] (-242.256) (-246.284) * [-243.447] (-243.390) (-244.140) (-247.446) -- 0:02:32
7000 -- (-241.377) (-245.428) [-245.465] (-243.349) * (-243.335) (-248.548) (-244.626) [-246.582] -- 0:02:21
7500 -- (-240.527) [-243.460] (-245.565) (-251.010) * (-250.626) [-241.435] (-244.564) (-242.631) -- 0:02:12
8000 -- (-246.122) (-245.270) [-241.017] (-251.630) * (-247.704) [-243.487] (-246.360) (-252.176) -- 0:02:04
8500 -- (-250.006) (-246.773) [-247.989] (-236.751) * (-249.783) [-242.441] (-249.146) (-251.569) -- 0:01:56
9000 -- (-242.107) (-259.490) [-246.223] (-233.225) * [-243.385] (-253.884) (-253.287) (-251.512) -- 0:01:50
9500 -- (-246.800) (-243.821) (-249.034) [-233.826] * [-247.147] (-240.802) (-248.054) (-245.125) -- 0:01:44
10000 -- [-243.652] (-240.231) (-245.076) (-233.433) * (-254.017) (-236.719) [-248.284] (-249.811) -- 0:01:39
Average standard deviation of split frequencies: 0.077340
10500 -- (-241.600) (-235.544) (-237.607) [-233.359] * (-259.050) (-236.352) (-241.438) [-248.999] -- 0:01:34
11000 -- (-242.663) (-233.601) (-245.561) [-235.282] * (-244.237) (-235.910) [-243.309] (-242.045) -- 0:01:29
11500 -- (-245.825) (-238.148) (-243.376) [-234.626] * (-243.786) [-234.000] (-241.449) (-244.733) -- 0:01:25
12000 -- (-243.360) (-236.572) [-248.010] (-233.973) * (-251.621) (-236.548) [-241.565] (-243.176) -- 0:01:22
12500 -- (-247.665) [-235.403] (-248.922) (-233.856) * (-243.203) (-234.761) (-243.419) [-240.201] -- 0:01:19
13000 -- [-245.946] (-234.514) (-249.783) (-233.594) * (-236.874) [-237.813] (-243.079) (-241.046) -- 0:01:15
13500 -- (-240.119) [-234.020] (-248.438) (-234.336) * (-246.045) (-236.553) (-243.254) [-243.275] -- 0:01:13
14000 -- (-248.492) (-235.591) (-240.136) [-236.563] * [-247.595] (-234.909) (-245.203) (-243.288) -- 0:01:10
14500 -- [-241.410] (-234.826) (-246.795) (-237.075) * (-246.047) [-235.076] (-243.600) (-247.045) -- 0:01:07
15000 -- (-247.392) (-236.201) [-251.712] (-235.184) * (-253.612) [-235.463] (-240.664) (-247.910) -- 0:01:05
Average standard deviation of split frequencies: 0.064818
15500 -- [-243.236] (-237.802) (-242.326) (-235.263) * (-248.839) [-239.177] (-244.849) (-256.912) -- 0:01:03
16000 -- (-244.997) [-236.346] (-240.626) (-233.740) * [-246.342] (-234.198) (-253.767) (-247.937) -- 0:01:01
16500 -- (-243.015) (-234.284) (-236.776) [-236.828] * (-243.054) [-236.006] (-250.468) (-249.386) -- 0:00:59
17000 -- (-248.046) (-239.891) (-235.758) [-236.314] * (-249.577) (-233.608) (-252.478) [-249.008] -- 0:00:57
17500 -- [-247.230] (-233.862) (-235.291) (-236.264) * (-244.935) (-236.928) (-246.649) [-250.964] -- 0:00:56
18000 -- (-245.874) (-233.484) (-234.828) [-233.663] * (-244.163) (-235.345) [-244.109] (-245.610) -- 0:00:54
18500 -- (-244.347) (-235.522) (-235.955) [-234.697] * [-238.834] (-237.692) (-244.059) (-253.502) -- 0:00:53
19000 -- (-249.830) (-234.758) (-235.978) [-234.809] * [-233.866] (-236.937) (-250.789) (-247.196) -- 0:01:43
19500 -- (-254.412) (-235.622) [-235.897] (-233.849) * [-234.271] (-237.340) (-250.403) (-236.775) -- 0:01:40
20000 -- (-235.995) (-234.413) (-236.179) [-233.475] * [-233.221] (-233.253) (-249.587) (-235.598) -- 0:01:38
Average standard deviation of split frequencies: 0.057025
20500 -- (-236.501) (-234.499) (-235.793) [-235.498] * [-233.747] (-236.019) (-250.765) (-236.304) -- 0:01:35
21000 -- (-235.554) [-234.586] (-239.148) (-236.800) * (-235.291) (-237.191) (-253.082) [-240.204] -- 0:01:33
21500 -- (-234.206) (-236.813) [-236.045] (-235.650) * [-233.487] (-236.145) (-240.461) (-241.038) -- 0:01:31
22000 -- (-236.983) [-235.772] (-236.265) (-233.248) * (-234.390) [-233.206] (-239.338) (-234.579) -- 0:01:28
22500 -- (-238.786) (-235.590) (-233.952) [-234.731] * (-234.424) (-235.272) [-240.084] (-235.601) -- 0:01:26
23000 -- (-234.389) (-234.798) (-233.334) [-235.107] * [-236.783] (-234.575) (-238.026) (-235.805) -- 0:01:24
23500 -- (-237.817) [-233.921] (-235.426) (-236.470) * [-233.828] (-234.987) (-239.809) (-235.862) -- 0:01:23
24000 -- [-235.995] (-233.299) (-234.671) (-236.954) * (-236.158) (-239.080) [-235.094] (-234.346) -- 0:01:21
24500 -- (-236.534) (-237.379) [-235.375] (-233.680) * (-235.263) (-233.530) (-235.720) [-235.914] -- 0:01:19
25000 -- (-234.462) (-235.619) [-235.870] (-235.529) * (-236.450) (-234.462) [-235.164] (-239.028) -- 0:01:18
Average standard deviation of split frequencies: 0.046151
25500 -- (-236.125) [-236.197] (-232.990) (-234.990) * [-233.258] (-234.987) (-233.372) (-234.856) -- 0:01:16
26000 -- (-238.064) [-233.508] (-239.580) (-237.665) * (-233.075) (-233.645) (-236.447) [-236.104] -- 0:01:14
26500 -- [-237.334] (-237.210) (-233.191) (-235.228) * [-234.055] (-233.671) (-233.968) (-237.036) -- 0:01:13
27000 -- [-236.259] (-237.313) (-234.489) (-235.921) * (-237.420) (-237.191) (-233.895) [-236.956] -- 0:01:12
27500 -- (-238.633) (-236.914) [-233.416] (-234.005) * [-233.768] (-237.421) (-234.411) (-235.975) -- 0:01:10
28000 -- (-234.382) (-242.832) (-233.937) [-234.908] * (-234.486) (-241.415) [-234.006] (-235.764) -- 0:01:09
28500 -- [-234.359] (-238.671) (-235.954) (-235.297) * (-233.948) [-238.974] (-237.635) (-234.317) -- 0:01:08
29000 -- [-235.578] (-234.992) (-234.228) (-239.132) * (-235.729) (-235.622) [-233.800] (-236.900) -- 0:01:06
29500 -- (-236.703) (-237.749) (-234.680) [-238.641] * (-233.805) [-234.652] (-234.276) (-241.237) -- 0:01:05
30000 -- (-234.950) (-235.458) [-238.065] (-234.895) * (-233.809) (-233.296) [-234.782] (-237.286) -- 0:01:04
Average standard deviation of split frequencies: 0.043188
30500 -- (-236.653) (-236.791) [-238.784] (-236.515) * (-234.925) (-234.832) [-234.732] (-234.692) -- 0:01:03
31000 -- (-236.345) (-234.592) [-238.314] (-239.188) * [-235.485] (-233.877) (-235.583) (-234.319) -- 0:01:02
31500 -- (-233.323) [-233.462] (-238.629) (-234.761) * [-236.937] (-235.189) (-239.258) (-234.664) -- 0:01:01
32000 -- (-235.892) [-235.250] (-237.788) (-237.528) * (-237.601) (-234.080) [-233.874] (-233.634) -- 0:01:00
32500 -- (-233.638) (-234.266) [-234.407] (-233.559) * [-233.558] (-234.616) (-236.118) (-235.520) -- 0:00:59
33000 -- (-233.557) [-237.312] (-236.194) (-236.266) * [-235.730] (-238.864) (-234.766) (-233.392) -- 0:00:58
33500 -- (-233.402) (-236.362) [-233.821] (-234.087) * (-235.511) (-238.017) (-235.723) [-235.856] -- 0:00:57
34000 -- (-233.743) (-234.849) [-234.430] (-235.857) * (-236.877) [-237.894] (-243.339) (-238.442) -- 0:00:56
34500 -- (-236.417) [-233.400] (-237.533) (-234.881) * [-237.216] (-236.471) (-236.361) (-234.081) -- 0:00:55
35000 -- (-233.972) [-235.111] (-237.905) (-236.535) * (-235.201) [-234.994] (-233.877) (-235.024) -- 0:00:55
Average standard deviation of split frequencies: 0.036203
35500 -- (-236.856) [-234.576] (-235.910) (-237.379) * (-235.701) (-235.242) (-236.644) [-237.657] -- 0:00:54
36000 -- (-234.027) [-233.688] (-235.652) (-235.087) * (-234.986) (-241.780) (-234.484) [-235.104] -- 0:00:53
36500 -- (-233.457) (-238.490) [-234.405] (-233.819) * [-234.538] (-235.225) (-238.694) (-237.792) -- 0:01:19
37000 -- (-234.110) (-236.791) [-233.665] (-235.278) * (-235.801) (-235.985) [-236.181] (-236.268) -- 0:01:18
37500 -- (-233.383) (-235.205) [-233.517] (-234.575) * (-235.156) [-235.333] (-236.459) (-233.524) -- 0:01:17
38000 -- (-233.962) [-235.272] (-235.118) (-237.928) * (-242.140) [-234.927] (-233.685) (-242.771) -- 0:01:15
38500 -- (-235.800) [-234.844] (-234.563) (-235.991) * (-234.551) [-235.029] (-240.639) (-235.600) -- 0:01:14
39000 -- [-236.317] (-238.177) (-235.977) (-236.239) * (-235.308) (-235.938) (-234.908) [-235.830] -- 0:01:13
39500 -- (-236.572) (-234.564) (-237.146) [-234.035] * (-233.588) (-235.387) (-235.206) [-234.169] -- 0:01:12
40000 -- (-234.710) (-236.082) (-236.700) [-234.547] * (-233.333) [-234.745] (-237.068) (-233.506) -- 0:01:12
Average standard deviation of split frequencies: 0.031556
40500 -- (-233.834) (-234.552) [-235.773] (-234.590) * (-237.276) [-233.734] (-237.980) (-234.843) -- 0:01:11
41000 -- (-234.668) (-238.910) [-233.777] (-236.469) * (-235.006) (-236.662) (-238.166) [-236.457] -- 0:01:10
41500 -- (-235.162) (-235.144) [-234.354] (-234.346) * (-244.026) (-234.866) [-234.277] (-238.539) -- 0:01:09
42000 -- (-237.064) [-235.443] (-238.159) (-234.598) * (-238.199) [-233.065] (-233.919) (-236.356) -- 0:01:08
42500 -- [-236.250] (-238.270) (-235.426) (-234.869) * (-242.948) [-233.485] (-233.938) (-234.505) -- 0:01:07
43000 -- (-232.898) (-236.097) (-236.500) [-235.024] * [-235.580] (-236.125) (-233.076) (-235.792) -- 0:01:06
43500 -- (-235.500) [-237.574] (-233.979) (-238.755) * [-235.467] (-236.009) (-236.222) (-234.680) -- 0:01:05
44000 -- [-234.438] (-236.019) (-234.149) (-234.431) * (-237.297) (-237.029) (-236.845) [-234.485] -- 0:01:05
44500 -- (-234.302) [-239.587] (-235.308) (-234.699) * [-237.137] (-233.797) (-234.968) (-233.465) -- 0:01:04
45000 -- (-234.057) [-234.772] (-236.643) (-233.096) * (-235.269) [-234.207] (-233.303) (-236.717) -- 0:01:03
Average standard deviation of split frequencies: 0.032208
45500 -- (-234.464) (-236.309) (-234.728) [-233.164] * [-234.724] (-237.264) (-234.949) (-235.194) -- 0:01:02
46000 -- (-237.300) (-235.037) [-233.466] (-234.953) * (-234.385) (-234.013) (-235.324) [-235.387] -- 0:01:02
46500 -- [-233.656] (-235.912) (-235.334) (-236.528) * (-238.485) (-236.627) (-235.975) [-236.062] -- 0:01:01
47000 -- (-234.645) (-233.886) [-235.016] (-233.495) * (-235.888) [-235.931] (-233.340) (-233.003) -- 0:01:00
47500 -- (-236.866) [-235.870] (-237.727) (-233.665) * (-236.091) (-235.293) (-233.687) [-234.611] -- 0:01:00
48000 -- (-237.874) (-234.234) [-233.476] (-233.559) * (-237.212) [-235.012] (-234.617) (-235.242) -- 0:00:59
48500 -- (-239.826) [-235.931] (-233.757) (-233.932) * [-236.277] (-237.409) (-236.329) (-234.722) -- 0:00:58
49000 -- (-236.581) (-234.138) [-234.337] (-235.456) * (-237.892) (-233.640) [-233.952] (-235.826) -- 0:00:58
49500 -- [-237.966] (-234.307) (-235.204) (-239.835) * (-238.372) (-234.152) [-235.008] (-237.065) -- 0:00:57
50000 -- [-235.417] (-237.386) (-235.918) (-239.554) * (-236.340) (-236.116) (-234.142) [-237.543] -- 0:00:57
Average standard deviation of split frequencies: 0.030703
50500 -- [-234.976] (-234.816) (-236.532) (-238.897) * (-236.555) (-241.217) (-233.923) [-237.200] -- 0:00:56
51000 -- (-234.109) [-234.798] (-236.386) (-235.092) * (-236.437) (-235.816) (-235.061) [-238.586] -- 0:00:55
51500 -- [-235.047] (-234.083) (-233.707) (-236.842) * [-235.872] (-234.330) (-234.511) (-233.771) -- 0:00:55
52000 -- (-237.205) (-234.515) (-233.719) [-236.045] * (-234.018) (-237.197) [-237.306] (-237.183) -- 0:00:54
52500 -- [-234.721] (-234.299) (-234.835) (-237.618) * [-234.605] (-235.546) (-236.869) (-233.656) -- 0:00:54
53000 -- (-240.699) [-239.471] (-236.643) (-236.273) * [-234.422] (-235.090) (-240.558) (-235.271) -- 0:00:53
53500 -- (-236.803) (-235.101) (-235.737) [-237.637] * [-236.073] (-234.098) (-237.100) (-234.996) -- 0:01:10
54000 -- (-235.524) [-236.691] (-235.042) (-233.565) * (-236.658) (-237.123) (-236.148) [-234.381] -- 0:01:10
54500 -- (-237.066) (-236.598) (-236.847) [-233.302] * (-235.060) [-233.645] (-235.021) (-235.690) -- 0:01:09
55000 -- (-236.688) (-235.756) [-237.731] (-236.642) * [-238.871] (-237.352) (-235.191) (-233.858) -- 0:01:08
Average standard deviation of split frequencies: 0.028798
55500 -- (-236.405) (-234.740) (-235.294) [-235.667] * [-234.552] (-234.460) (-235.879) (-235.462) -- 0:01:08
56000 -- (-234.026) (-234.734) (-234.334) [-236.299] * (-235.568) [-234.267] (-235.496) (-234.322) -- 0:01:07
56500 -- [-236.147] (-235.704) (-233.917) (-236.096) * [-234.780] (-243.333) (-239.137) (-234.272) -- 0:01:06
57000 -- [-234.025] (-236.957) (-235.001) (-236.010) * (-235.856) (-236.122) (-235.946) [-234.632] -- 0:01:06
57500 -- (-234.443) (-238.169) (-236.723) [-233.694] * (-234.416) (-234.841) [-235.159] (-234.404) -- 0:01:05
58000 -- (-235.108) (-234.240) (-236.729) [-236.525] * [-233.416] (-235.384) (-235.184) (-235.266) -- 0:01:04
58500 -- (-236.713) (-238.263) (-237.072) [-233.509] * [-237.361] (-234.274) (-236.705) (-236.424) -- 0:01:04
59000 -- (-233.764) (-235.696) (-235.793) [-236.271] * [-238.591] (-239.722) (-233.200) (-233.787) -- 0:01:03
59500 -- (-234.969) (-233.333) [-235.933] (-237.437) * (-235.426) (-239.049) (-236.325) [-235.800] -- 0:01:03
60000 -- (-237.956) (-233.842) [-236.703] (-235.464) * (-235.257) (-235.226) (-236.779) [-235.841] -- 0:01:02
Average standard deviation of split frequencies: 0.026174
60500 -- (-235.122) (-237.261) (-235.113) [-234.561] * (-234.712) [-236.109] (-234.124) (-234.460) -- 0:01:02
61000 -- (-235.149) [-235.941] (-237.668) (-234.972) * (-236.281) [-233.917] (-234.438) (-235.127) -- 0:01:01
61500 -- [-237.246] (-235.083) (-233.860) (-236.645) * (-235.679) [-236.502] (-235.386) (-234.140) -- 0:01:01
62000 -- [-237.863] (-234.863) (-236.772) (-234.624) * (-235.913) (-236.678) [-234.043] (-233.347) -- 0:01:00
62500 -- (-237.419) [-235.283] (-238.881) (-236.112) * (-237.899) [-234.704] (-235.922) (-237.537) -- 0:01:00
63000 -- (-235.062) (-235.922) [-233.973] (-237.226) * (-237.295) (-242.104) (-237.172) [-234.546] -- 0:00:59
63500 -- (-235.085) (-234.617) (-237.168) [-235.728] * (-236.739) [-235.504] (-236.571) (-237.253) -- 0:00:58
64000 -- [-235.040] (-234.590) (-236.762) (-233.520) * [-235.355] (-234.248) (-236.891) (-237.689) -- 0:00:58
64500 -- (-234.108) (-236.171) [-236.218] (-235.864) * (-235.358) (-239.703) (-233.158) [-235.462] -- 0:00:58
65000 -- (-234.711) (-235.233) [-233.671] (-235.008) * (-236.446) [-234.636] (-233.895) (-233.744) -- 0:00:57
Average standard deviation of split frequencies: 0.024642
65500 -- (-236.046) [-239.138] (-235.375) (-234.756) * (-236.209) (-234.173) (-237.898) [-233.420] -- 0:00:57
66000 -- (-237.670) (-244.225) (-238.477) [-233.284] * [-234.874] (-236.191) (-240.237) (-236.707) -- 0:00:56
66500 -- [-233.627] (-237.238) (-236.465) (-233.018) * (-235.411) [-234.172] (-234.066) (-235.397) -- 0:00:56
67000 -- (-235.218) [-237.544] (-235.508) (-233.440) * (-234.227) (-234.206) (-234.541) [-237.470] -- 0:00:55
67500 -- (-234.577) [-233.445] (-233.638) (-234.660) * (-235.509) [-235.791] (-235.066) (-234.766) -- 0:00:55
68000 -- (-238.597) (-234.810) (-233.476) [-235.262] * (-237.919) (-235.905) (-237.819) [-238.144] -- 0:00:54
68500 -- (-237.530) (-234.478) (-235.811) [-234.555] * (-234.931) (-235.218) [-233.445] (-239.047) -- 0:00:54
69000 -- [-237.264] (-234.922) (-234.761) (-236.469) * [-234.932] (-236.463) (-235.271) (-234.558) -- 0:00:53
69500 -- (-237.383) (-238.748) [-238.857] (-237.090) * [-235.161] (-234.706) (-238.226) (-236.267) -- 0:00:53
70000 -- (-235.617) (-234.005) (-243.351) [-233.750] * (-235.829) [-239.000] (-238.983) (-238.740) -- 0:00:53
Average standard deviation of split frequencies: 0.019310
70500 -- [-237.449] (-234.913) (-236.415) (-234.059) * [-234.608] (-235.328) (-243.100) (-237.331) -- 0:01:05
71000 -- (-239.219) (-234.115) (-235.279) [-236.199] * (-235.628) (-235.790) [-234.656] (-236.376) -- 0:01:05
71500 -- (-239.102) (-237.627) (-233.080) [-236.818] * (-234.442) (-234.786) (-237.471) [-234.286] -- 0:01:04
72000 -- [-234.014] (-239.530) (-241.279) (-236.712) * (-235.222) (-238.192) [-233.433] (-235.941) -- 0:01:04
72500 -- [-233.181] (-234.533) (-238.392) (-234.896) * (-235.830) (-233.997) [-233.078] (-232.937) -- 0:01:03
73000 -- [-233.092] (-233.688) (-235.374) (-234.774) * (-233.605) (-235.054) [-234.619] (-234.169) -- 0:01:03
73500 -- (-234.815) (-239.485) [-236.087] (-235.116) * (-236.141) (-237.089) [-235.735] (-237.691) -- 0:01:03
74000 -- (-240.702) [-234.027] (-233.287) (-233.930) * [-238.458] (-234.152) (-234.230) (-242.591) -- 0:01:02
74500 -- (-236.518) [-237.045] (-236.815) (-236.311) * (-235.423) (-234.408) [-238.494] (-240.516) -- 0:01:02
75000 -- (-237.611) (-239.669) (-235.598) [-234.391] * (-235.390) (-234.048) [-234.711] (-235.426) -- 0:01:01
Average standard deviation of split frequencies: 0.021873
75500 -- (-234.244) (-235.744) [-238.184] (-234.212) * (-235.549) (-233.909) [-234.172] (-238.605) -- 0:01:01
76000 -- [-235.458] (-236.041) (-234.705) (-234.207) * (-234.871) (-235.035) (-234.571) [-242.344] -- 0:01:00
76500 -- (-238.165) (-240.780) (-242.305) [-235.832] * (-235.818) [-239.207] (-235.385) (-235.669) -- 0:01:00
77000 -- (-240.253) (-235.957) (-233.423) [-234.188] * (-233.841) (-241.508) (-233.466) [-239.435] -- 0:00:59
77500 -- (-239.886) (-236.756) [-235.092] (-239.244) * (-235.011) [-236.023] (-235.663) (-238.549) -- 0:00:59
78000 -- (-237.375) (-237.560) [-234.808] (-234.270) * (-235.754) (-234.154) (-234.934) [-234.072] -- 0:00:59
78500 -- [-233.146] (-235.551) (-237.114) (-237.031) * (-235.240) [-235.968] (-236.811) (-233.811) -- 0:00:58
79000 -- (-236.416) [-235.748] (-240.097) (-234.240) * (-236.794) (-234.255) (-237.188) [-233.327] -- 0:00:58
79500 -- [-233.517] (-234.369) (-234.340) (-234.608) * [-234.601] (-236.027) (-235.112) (-235.147) -- 0:00:57
80000 -- (-233.724) (-236.034) [-237.076] (-233.963) * (-233.789) [-236.939] (-237.090) (-237.158) -- 0:00:57
Average standard deviation of split frequencies: 0.023683
80500 -- (-238.751) (-233.488) [-236.272] (-236.429) * [-237.944] (-234.013) (-238.774) (-237.165) -- 0:00:57
81000 -- [-237.060] (-236.251) (-234.293) (-235.767) * [-233.371] (-234.741) (-237.817) (-236.971) -- 0:00:56
81500 -- (-234.864) [-233.577] (-238.683) (-240.959) * (-233.728) (-235.621) [-236.117] (-235.230) -- 0:00:56
82000 -- (-234.590) (-233.074) (-234.638) [-234.835] * (-234.108) (-234.446) [-235.368] (-236.903) -- 0:00:55
82500 -- [-234.400] (-234.211) (-239.386) (-233.917) * (-234.932) [-239.367] (-236.110) (-234.151) -- 0:00:55
83000 -- [-233.400] (-234.277) (-236.453) (-234.947) * (-241.529) (-235.433) [-236.424] (-234.840) -- 0:00:55
83500 -- (-237.932) (-233.445) [-235.113] (-234.229) * (-236.131) [-234.946] (-238.145) (-237.449) -- 0:00:54
84000 -- [-235.671] (-236.359) (-238.906) (-235.023) * (-236.824) (-235.271) [-234.641] (-240.290) -- 0:00:54
84500 -- (-234.833) (-236.815) (-235.566) [-235.966] * (-235.389) (-233.725) (-236.122) [-233.952] -- 0:00:54
85000 -- (-235.537) [-235.969] (-234.420) (-234.718) * (-234.978) (-236.434) (-236.134) [-233.857] -- 0:00:53
Average standard deviation of split frequencies: 0.024811
85500 -- (-235.812) (-235.441) [-239.433] (-235.690) * (-233.703) [-236.438] (-235.139) (-235.122) -- 0:00:53
86000 -- [-237.771] (-235.524) (-234.375) (-234.887) * (-237.009) [-234.611] (-235.905) (-235.320) -- 0:00:53
86500 -- (-234.140) (-233.527) [-234.561] (-234.820) * (-235.280) (-237.808) (-234.337) [-236.285] -- 0:00:52
87000 -- [-234.226] (-234.212) (-237.064) (-235.740) * [-233.330] (-234.990) (-239.626) (-233.718) -- 0:00:52
87500 -- (-234.569) (-237.500) [-236.734] (-235.051) * (-236.190) [-234.848] (-233.676) (-234.969) -- 0:01:02
88000 -- (-240.382) [-236.608] (-235.279) (-233.559) * (-234.196) (-234.109) (-236.207) [-234.449] -- 0:01:02
88500 -- (-235.749) [-238.189] (-236.683) (-233.550) * [-236.490] (-234.588) (-236.104) (-235.803) -- 0:01:01
89000 -- (-236.808) (-233.264) [-240.108] (-234.093) * (-234.720) (-233.500) [-234.472] (-236.537) -- 0:01:01
89500 -- [-234.102] (-234.728) (-243.515) (-235.234) * [-236.378] (-236.314) (-235.141) (-233.888) -- 0:01:01
90000 -- (-233.726) [-234.058] (-242.582) (-236.013) * (-236.888) [-233.462] (-237.772) (-235.808) -- 0:01:00
Average standard deviation of split frequencies: 0.024081
90500 -- (-235.208) (-234.926) [-235.887] (-237.783) * (-235.132) [-236.853] (-234.871) (-236.923) -- 0:01:00
91000 -- (-236.852) (-233.923) (-233.987) [-237.123] * (-237.674) (-234.646) [-234.771] (-234.782) -- 0:00:59
91500 -- (-236.630) [-236.758] (-236.070) (-234.891) * [-236.032] (-233.926) (-236.745) (-234.100) -- 0:00:59
92000 -- [-236.289] (-237.320) (-236.945) (-235.238) * (-233.855) (-235.882) [-235.332] (-235.129) -- 0:00:59
92500 -- (-236.823) (-236.935) (-235.082) [-233.911] * (-234.496) (-238.018) (-234.253) [-233.421] -- 0:00:58
93000 -- (-236.962) (-235.317) [-236.365] (-235.806) * [-233.577] (-237.690) (-235.084) (-234.007) -- 0:00:58
93500 -- (-236.912) (-237.997) (-237.777) [-234.042] * [-234.369] (-233.667) (-235.137) (-236.113) -- 0:00:58
94000 -- (-235.214) [-235.139] (-237.483) (-237.812) * (-234.830) (-233.984) [-235.243] (-237.956) -- 0:00:57
94500 -- (-234.066) [-233.586] (-236.728) (-239.405) * [-234.539] (-234.552) (-233.926) (-235.321) -- 0:00:57
95000 -- (-237.545) [-233.764] (-235.605) (-237.768) * [-234.744] (-235.427) (-235.520) (-234.984) -- 0:00:57
Average standard deviation of split frequencies: 0.022743
95500 -- [-234.312] (-234.714) (-234.316) (-234.383) * (-235.897) (-236.544) (-233.512) [-234.583] -- 0:00:56
96000 -- (-237.511) (-235.987) (-234.536) [-235.627] * (-238.992) (-237.096) (-235.672) [-233.951] -- 0:00:56
96500 -- [-237.225] (-239.043) (-237.141) (-237.360) * (-235.523) [-235.916] (-235.998) (-235.758) -- 0:00:56
97000 -- [-237.128] (-234.158) (-236.989) (-233.894) * (-234.999) (-233.688) (-233.554) [-234.115] -- 0:00:55
97500 -- [-236.779] (-234.694) (-235.610) (-233.703) * (-233.961) (-237.667) [-233.409] (-235.526) -- 0:00:55
98000 -- [-235.636] (-239.495) (-235.201) (-235.163) * [-234.265] (-239.992) (-236.093) (-240.326) -- 0:00:55
98500 -- [-235.863] (-239.906) (-238.327) (-233.775) * (-234.404) [-234.681] (-238.438) (-235.895) -- 0:00:54
99000 -- (-237.696) (-234.582) [-237.306] (-235.495) * (-236.509) (-235.379) [-237.519] (-235.710) -- 0:00:54
99500 -- [-234.734] (-235.174) (-236.196) (-233.846) * (-235.360) (-235.335) [-237.296] (-237.026) -- 0:00:54
100000 -- (-234.343) (-233.527) (-236.858) [-234.153] * (-234.367) (-233.870) [-237.139] (-245.192) -- 0:00:54
Average standard deviation of split frequencies: 0.020292
100500 -- [-236.675] (-241.119) (-236.582) (-234.504) * (-233.995) (-236.690) [-235.354] (-237.160) -- 0:00:53
101000 -- (-236.223) (-233.842) [-233.943] (-236.617) * (-234.084) (-235.750) (-234.591) [-234.978] -- 0:00:53
101500 -- [-234.504] (-234.881) (-236.184) (-235.121) * (-236.828) [-234.494] (-237.346) (-243.797) -- 0:00:53
102000 -- [-235.120] (-233.976) (-234.238) (-234.176) * (-235.886) [-235.166] (-240.798) (-239.592) -- 0:00:52
102500 -- [-234.401] (-233.475) (-234.835) (-236.650) * (-234.313) [-236.103] (-233.786) (-240.638) -- 0:00:52
103000 -- (-233.788) [-235.506] (-235.971) (-235.170) * [-235.061] (-238.901) (-235.807) (-233.475) -- 0:00:52
103500 -- (-235.493) [-232.949] (-235.571) (-233.721) * (-233.956) (-233.863) (-243.812) [-234.762] -- 0:00:51
104000 -- [-233.359] (-233.713) (-238.220) (-235.079) * (-234.715) (-233.770) [-235.330] (-234.430) -- 0:00:51
104500 -- (-236.157) (-234.067) (-239.018) [-233.238] * [-233.097] (-236.208) (-234.623) (-236.278) -- 0:00:59
105000 -- (-234.482) (-236.235) (-233.305) [-233.408] * (-235.511) (-235.090) [-235.067] (-234.514) -- 0:00:59
Average standard deviation of split frequencies: 0.016455
105500 -- (-236.594) (-233.159) (-235.715) [-235.606] * (-236.531) (-238.594) [-233.787] (-233.304) -- 0:00:59
106000 -- [-235.209] (-237.830) (-238.581) (-234.757) * (-236.665) (-234.104) [-235.290] (-234.111) -- 0:00:59
106500 -- (-234.511) [-233.613] (-235.903) (-239.806) * [-235.506] (-238.316) (-235.014) (-234.990) -- 0:00:58
107000 -- (-235.037) [-234.238] (-234.479) (-234.531) * (-233.989) (-235.282) [-234.900] (-235.380) -- 0:00:58
107500 -- (-239.613) [-235.833] (-235.425) (-233.328) * (-234.348) [-236.119] (-233.611) (-237.665) -- 0:00:58
108000 -- (-240.173) (-235.021) [-233.979] (-239.199) * (-236.912) (-235.178) [-236.425] (-235.979) -- 0:00:57
108500 -- (-237.656) (-234.840) [-234.785] (-238.780) * [-234.015] (-236.535) (-233.262) (-235.213) -- 0:00:57
109000 -- (-235.830) (-234.331) [-233.754] (-237.201) * [-233.875] (-237.282) (-234.999) (-235.579) -- 0:00:57
109500 -- (-235.700) (-233.256) (-234.512) [-240.647] * [-234.746] (-239.769) (-234.367) (-235.516) -- 0:00:56
110000 -- (-234.349) [-233.853] (-236.429) (-240.203) * [-233.111] (-235.037) (-235.691) (-234.328) -- 0:00:56
Average standard deviation of split frequencies: 0.016802
110500 -- [-233.710] (-234.417) (-236.185) (-234.532) * (-235.247) (-239.691) [-237.894] (-234.607) -- 0:00:56
111000 -- [-233.252] (-235.267) (-237.377) (-235.729) * [-234.898] (-233.949) (-238.863) (-236.942) -- 0:00:56
111500 -- [-234.548] (-234.419) (-234.301) (-235.716) * (-236.866) [-236.106] (-235.098) (-239.133) -- 0:00:55
112000 -- (-234.307) [-236.278] (-239.635) (-235.664) * (-234.273) (-236.461) (-242.003) [-237.280] -- 0:00:55
112500 -- (-234.483) (-237.234) [-236.912] (-235.441) * [-236.959] (-234.666) (-234.097) (-235.116) -- 0:00:55
113000 -- [-236.609] (-235.704) (-236.490) (-237.396) * [-235.329] (-241.987) (-238.666) (-237.663) -- 0:00:54
113500 -- (-234.612) (-234.968) (-239.735) [-236.430] * (-234.588) (-235.918) [-238.241] (-238.007) -- 0:00:54
114000 -- [-233.568] (-236.452) (-237.376) (-236.874) * (-233.632) [-234.999] (-240.214) (-238.393) -- 0:00:54
114500 -- [-236.970] (-236.702) (-233.711) (-236.286) * [-233.576] (-234.114) (-235.331) (-236.282) -- 0:00:54
115000 -- (-236.794) [-234.732] (-234.146) (-235.028) * [-235.499] (-236.300) (-238.161) (-239.639) -- 0:00:53
Average standard deviation of split frequencies: 0.017212
115500 -- (-234.011) (-241.597) [-233.684] (-235.616) * (-234.966) (-238.422) (-235.092) [-235.995] -- 0:00:53
116000 -- (-233.862) (-234.646) (-233.857) [-234.099] * (-234.394) (-239.245) [-235.949] (-237.195) -- 0:00:53
116500 -- (-236.166) (-234.203) (-234.188) [-233.466] * (-233.963) (-234.073) [-233.433] (-236.622) -- 0:00:53
117000 -- [-233.997] (-237.797) (-234.605) (-237.442) * (-236.579) (-240.652) [-234.130] (-234.320) -- 0:00:52
117500 -- (-233.820) [-236.323] (-234.691) (-237.898) * [-234.089] (-233.309) (-235.074) (-237.659) -- 0:00:52
118000 -- (-233.899) (-235.354) [-238.233] (-233.254) * (-233.720) (-236.465) (-233.650) [-234.713] -- 0:00:52
118500 -- (-236.335) (-234.903) [-233.749] (-234.824) * (-235.172) (-233.935) (-236.873) [-233.992] -- 0:00:52
119000 -- (-233.888) (-236.987) (-238.679) [-235.840] * (-235.993) (-235.727) (-237.469) [-233.680] -- 0:00:51
119500 -- (-237.466) (-234.495) [-237.572] (-239.516) * (-236.460) (-234.868) (-237.671) [-234.352] -- 0:00:51
120000 -- (-234.965) (-236.914) [-233.529] (-236.503) * (-235.552) [-234.736] (-239.353) (-235.009) -- 0:00:51
Average standard deviation of split frequencies: 0.015856
120500 -- [-233.934] (-233.970) (-236.718) (-233.896) * (-236.704) (-235.070) [-233.463] (-236.039) -- 0:00:51
121000 -- (-235.215) (-236.393) [-238.907] (-233.378) * (-233.615) [-235.960] (-234.067) (-234.250) -- 0:00:58
121500 -- (-237.891) (-235.514) [-235.791] (-235.974) * (-234.098) (-234.408) [-235.150] (-233.556) -- 0:00:57
122000 -- (-235.693) (-236.765) [-236.999] (-234.219) * [-234.502] (-235.691) (-234.076) (-237.685) -- 0:00:57
122500 -- (-234.807) (-234.868) [-238.034] (-235.253) * (-237.209) [-236.631] (-237.119) (-235.094) -- 0:00:57
123000 -- (-237.798) (-235.123) (-235.658) [-234.366] * [-236.050] (-238.584) (-235.076) (-236.484) -- 0:00:57
123500 -- (-234.161) (-235.383) [-238.117] (-236.257) * (-240.934) (-238.292) [-234.370] (-233.631) -- 0:00:56
124000 -- (-234.442) [-233.783] (-235.568) (-234.506) * (-235.573) (-235.077) [-235.437] (-239.420) -- 0:00:56
124500 -- [-239.032] (-235.354) (-233.049) (-235.631) * (-238.287) (-235.354) [-240.506] (-234.426) -- 0:00:56
125000 -- (-237.641) (-236.572) [-234.283] (-235.485) * (-237.740) (-237.516) (-235.517) [-233.712] -- 0:00:56
Average standard deviation of split frequencies: 0.016628
125500 -- [-237.997] (-233.716) (-233.910) (-235.288) * [-233.993] (-237.908) (-236.124) (-236.306) -- 0:00:55
126000 -- (-233.915) (-233.482) [-236.975] (-234.578) * (-236.930) (-233.989) (-237.048) [-234.553] -- 0:00:55
126500 -- (-234.413) [-236.770] (-237.655) (-234.944) * [-233.179] (-234.327) (-236.868) (-236.484) -- 0:00:55
127000 -- (-235.907) (-234.537) (-236.034) [-234.435] * [-236.936] (-236.395) (-235.054) (-235.351) -- 0:00:54
127500 -- [-237.955] (-234.894) (-235.355) (-235.001) * [-236.633] (-233.986) (-238.760) (-235.859) -- 0:00:54
128000 -- [-235.987] (-238.172) (-236.536) (-235.036) * (-233.783) (-237.770) (-237.371) [-233.807] -- 0:00:54
128500 -- (-234.930) [-236.060] (-236.014) (-241.089) * (-235.521) (-233.219) (-235.020) [-234.678] -- 0:00:54
129000 -- (-237.370) (-239.680) (-235.062) [-239.388] * [-235.180] (-236.325) (-234.527) (-234.037) -- 0:00:54
129500 -- (-234.236) (-235.540) [-234.351] (-237.873) * (-234.623) (-234.726) (-236.301) [-239.610] -- 0:00:53
130000 -- [-235.259] (-235.598) (-234.745) (-236.106) * (-235.374) (-234.731) (-233.209) [-235.752] -- 0:00:53
Average standard deviation of split frequencies: 0.017237
130500 -- [-234.863] (-234.837) (-238.759) (-236.537) * (-233.995) (-236.485) (-235.466) [-234.793] -- 0:00:53
131000 -- (-238.315) (-234.475) [-235.879] (-236.733) * (-237.823) (-235.232) (-234.559) [-236.213] -- 0:00:53
131500 -- (-233.527) (-233.381) [-233.698] (-236.834) * (-234.786) [-236.488] (-235.346) (-236.113) -- 0:00:52
132000 -- (-235.091) (-235.770) [-233.851] (-237.721) * [-238.067] (-236.126) (-233.686) (-235.211) -- 0:00:52
132500 -- [-234.350] (-236.919) (-238.772) (-237.243) * (-240.161) [-235.964] (-234.009) (-235.455) -- 0:00:52
133000 -- (-235.626) [-236.539] (-236.870) (-234.014) * (-240.003) (-234.153) (-236.571) [-235.028] -- 0:00:52
133500 -- [-235.105] (-235.451) (-234.475) (-235.680) * (-237.311) (-244.548) (-235.217) [-236.203] -- 0:00:51
134000 -- (-234.234) (-237.326) [-236.108] (-234.792) * (-236.283) (-236.440) [-234.117] (-236.239) -- 0:00:51
134500 -- (-234.463) [-234.064] (-237.119) (-233.655) * (-236.384) (-233.712) [-236.209] (-236.096) -- 0:00:51
135000 -- (-238.432) (-234.784) (-238.240) [-233.682] * (-234.319) (-236.678) [-233.493] (-237.209) -- 0:00:51
Average standard deviation of split frequencies: 0.018791
135500 -- (-235.015) [-233.817] (-234.688) (-234.353) * [-234.376] (-234.612) (-234.188) (-234.545) -- 0:00:51
136000 -- [-236.254] (-234.233) (-233.941) (-236.916) * [-233.996] (-234.302) (-235.373) (-237.210) -- 0:00:50
136500 -- (-237.832) [-235.612] (-234.950) (-234.809) * (-233.740) (-234.578) (-235.235) [-237.227] -- 0:00:50
137000 -- (-235.597) [-234.299] (-235.031) (-235.496) * (-233.221) (-239.199) [-233.644] (-235.174) -- 0:00:50
137500 -- (-233.560) (-239.908) [-234.450] (-240.123) * (-233.758) (-236.168) (-242.086) [-237.790] -- 0:00:50
138000 -- [-235.528] (-234.337) (-233.663) (-236.981) * (-235.212) (-238.874) (-236.926) [-238.071] -- 0:00:49
138500 -- (-238.592) (-233.535) (-234.766) [-236.264] * (-234.717) (-234.203) (-235.627) [-236.030] -- 0:00:55
139000 -- (-234.404) (-233.228) (-235.344) [-235.744] * (-238.199) [-236.035] (-234.937) (-234.420) -- 0:00:55
139500 -- (-233.710) (-238.083) [-234.080] (-237.761) * [-235.253] (-237.051) (-234.593) (-233.533) -- 0:00:55
140000 -- [-234.498] (-234.529) (-234.631) (-237.234) * [-236.843] (-234.324) (-234.744) (-234.617) -- 0:00:55
Average standard deviation of split frequencies: 0.019921
140500 -- (-233.991) (-234.884) [-233.860] (-236.845) * (-236.140) [-235.514] (-234.737) (-234.690) -- 0:00:55
141000 -- [-238.600] (-234.017) (-237.619) (-239.937) * (-237.540) [-239.805] (-237.512) (-235.662) -- 0:00:54
141500 -- [-235.607] (-234.885) (-234.958) (-234.494) * [-235.237] (-235.690) (-234.348) (-236.695) -- 0:00:54
142000 -- (-234.719) (-237.407) [-235.375] (-236.890) * [-235.772] (-234.689) (-235.165) (-239.851) -- 0:00:54
142500 -- (-237.126) (-238.967) (-235.688) [-234.208] * [-234.831] (-233.422) (-239.919) (-237.341) -- 0:00:54
143000 -- (-237.198) (-234.919) [-236.425] (-235.883) * (-233.548) (-235.308) [-234.632] (-234.233) -- 0:00:53
143500 -- (-234.683) (-236.531) [-233.411] (-238.755) * (-233.954) (-234.433) (-233.818) [-237.497] -- 0:00:53
144000 -- (-235.287) (-236.484) [-234.066] (-238.044) * (-234.144) (-239.789) (-233.847) [-236.012] -- 0:00:53
144500 -- [-234.495] (-238.208) (-234.370) (-234.393) * [-234.637] (-234.169) (-234.923) (-236.265) -- 0:00:53
145000 -- (-235.782) (-235.776) (-235.004) [-236.847] * [-234.608] (-236.033) (-234.143) (-236.009) -- 0:00:53
Average standard deviation of split frequencies: 0.018693
145500 -- (-237.927) (-235.601) (-234.852) [-236.244] * (-233.233) (-240.920) (-235.823) [-233.044] -- 0:00:52
146000 -- (-234.175) (-239.356) [-234.956] (-236.274) * (-236.396) (-236.190) [-236.092] (-235.758) -- 0:00:52
146500 -- [-233.976] (-235.091) (-237.464) (-235.844) * (-234.770) (-234.088) (-238.647) [-235.072] -- 0:00:52
147000 -- (-233.577) [-233.402] (-236.534) (-237.142) * (-234.771) [-235.214] (-238.718) (-233.739) -- 0:00:52
147500 -- [-237.698] (-233.966) (-238.131) (-233.787) * (-234.252) (-237.648) (-242.634) [-233.173] -- 0:00:52
148000 -- (-234.794) (-236.655) [-234.254] (-234.862) * (-236.098) (-240.670) [-242.275] (-235.169) -- 0:00:51
148500 -- (-236.355) [-234.732] (-238.349) (-234.572) * (-235.384) (-241.333) [-235.520] (-235.090) -- 0:00:51
149000 -- (-234.700) [-235.053] (-236.471) (-236.285) * [-236.061] (-234.885) (-236.015) (-236.787) -- 0:00:51
149500 -- (-234.461) [-234.387] (-235.325) (-233.403) * (-236.067) (-235.821) [-236.020] (-235.491) -- 0:00:51
150000 -- (-234.030) [-233.815] (-236.290) (-233.767) * (-234.783) (-236.070) [-233.093] (-238.589) -- 0:00:51
Average standard deviation of split frequencies: 0.020685
150500 -- (-236.471) (-235.860) [-236.279] (-234.573) * (-236.591) [-234.956] (-233.318) (-237.701) -- 0:00:50
151000 -- [-235.592] (-233.603) (-234.851) (-233.491) * (-233.649) (-234.008) [-234.989] (-236.383) -- 0:00:50
151500 -- (-238.041) (-234.245) [-235.145] (-233.606) * (-233.758) (-235.468) [-234.869] (-234.532) -- 0:00:50
152000 -- (-235.163) (-235.309) [-237.156] (-234.969) * (-238.569) (-235.317) (-236.800) [-234.663] -- 0:00:50
152500 -- (-237.514) [-234.065] (-235.872) (-235.673) * (-240.299) (-235.047) (-236.190) [-233.817] -- 0:00:50
153000 -- (-233.907) [-236.563] (-237.680) (-237.397) * (-235.124) (-237.142) (-236.452) [-234.921] -- 0:00:49
153500 -- [-233.918] (-235.078) (-237.007) (-241.191) * (-235.065) [-234.053] (-233.785) (-241.680) -- 0:00:49
154000 -- (-234.650) (-234.304) (-237.582) [-234.526] * (-233.851) (-233.571) [-235.143] (-235.721) -- 0:00:49
154500 -- (-236.506) [-233.714] (-242.281) (-233.331) * (-236.548) [-233.882] (-236.023) (-235.199) -- 0:00:49
155000 -- (-234.825) (-235.744) (-237.206) [-235.955] * (-234.239) (-235.830) (-234.291) [-233.724] -- 0:00:49
Average standard deviation of split frequencies: 0.019731
155500 -- (-235.338) (-235.864) [-235.947] (-235.687) * (-233.405) (-236.577) [-236.353] (-234.285) -- 0:00:54
156000 -- (-237.005) [-236.156] (-235.613) (-233.865) * [-236.064] (-237.857) (-234.891) (-237.930) -- 0:00:54
156500 -- (-243.801) [-242.500] (-236.184) (-234.230) * [-233.582] (-233.608) (-234.458) (-237.980) -- 0:00:53
157000 -- (-236.398) (-234.314) [-235.641] (-235.189) * (-235.809) (-233.816) [-234.126] (-235.945) -- 0:00:53
157500 -- [-235.965] (-237.168) (-236.820) (-238.319) * (-235.182) [-235.196] (-234.730) (-237.445) -- 0:00:53
158000 -- (-234.512) (-236.413) (-242.242) [-235.191] * (-235.789) (-236.539) (-235.373) [-233.429] -- 0:00:53
158500 -- (-237.630) (-235.661) [-235.809] (-234.694) * (-237.199) (-236.101) [-235.449] (-235.663) -- 0:00:53
159000 -- (-235.472) (-236.122) [-234.774] (-235.718) * (-236.340) (-233.720) [-236.243] (-234.984) -- 0:00:52
159500 -- (-235.129) (-236.636) (-234.995) [-237.267] * (-236.036) (-234.488) (-235.408) [-235.271] -- 0:00:52
160000 -- (-235.287) (-238.088) (-234.063) [-237.199] * (-236.137) [-236.950] (-234.510) (-234.742) -- 0:00:52
Average standard deviation of split frequencies: 0.018295
160500 -- (-235.317) [-234.402] (-234.212) (-236.616) * (-234.370) [-238.743] (-237.125) (-235.627) -- 0:00:52
161000 -- (-234.224) [-234.752] (-234.645) (-235.789) * (-236.478) (-234.871) (-239.419) [-235.693] -- 0:00:52
161500 -- (-235.894) [-235.019] (-233.962) (-235.145) * (-237.525) [-235.227] (-235.124) (-235.751) -- 0:00:51
162000 -- [-233.705] (-234.407) (-236.981) (-233.339) * [-235.744] (-235.005) (-232.961) (-233.398) -- 0:00:51
162500 -- [-235.611] (-235.796) (-233.645) (-234.434) * (-236.878) (-237.002) [-234.390] (-238.975) -- 0:00:51
163000 -- [-234.101] (-234.928) (-239.051) (-235.420) * (-238.205) (-233.359) [-235.860] (-234.527) -- 0:00:51
163500 -- (-233.869) (-235.107) (-235.475) [-238.240] * (-235.616) (-235.071) [-234.943] (-239.057) -- 0:00:51
164000 -- (-234.672) (-234.985) (-236.354) [-235.791] * (-234.004) [-235.122] (-233.837) (-237.952) -- 0:00:50
164500 -- (-235.587) [-236.488] (-236.741) (-234.325) * [-235.142] (-236.795) (-236.033) (-234.686) -- 0:00:50
165000 -- (-236.649) (-236.329) [-237.433] (-235.230) * [-235.092] (-236.171) (-239.125) (-234.110) -- 0:00:50
Average standard deviation of split frequencies: 0.017670
165500 -- (-237.965) [-234.555] (-235.486) (-237.183) * (-236.722) (-234.599) (-233.776) [-237.177] -- 0:00:50
166000 -- (-238.466) (-234.663) (-234.240) [-233.368] * (-234.202) (-235.263) [-234.765] (-238.521) -- 0:00:50
166500 -- (-236.688) (-236.498) [-233.514] (-232.946) * (-235.240) (-233.636) [-236.601] (-235.667) -- 0:00:50
167000 -- [-239.340] (-235.686) (-235.236) (-237.570) * (-238.683) (-235.051) (-238.577) [-233.102] -- 0:00:49
167500 -- (-241.743) (-234.167) (-238.244) [-236.495] * (-234.748) (-238.680) (-236.807) [-233.096] -- 0:00:49
168000 -- (-236.615) (-235.983) (-235.441) [-237.935] * (-233.317) [-235.828] (-233.894) (-234.708) -- 0:00:49
168500 -- (-236.091) [-235.063] (-234.458) (-233.764) * (-238.058) (-234.399) (-236.853) [-236.450] -- 0:00:49
169000 -- (-234.698) (-241.195) (-234.015) [-235.260] * (-235.542) (-235.070) (-236.424) [-235.469] -- 0:00:49
169500 -- (-233.296) (-237.489) (-236.066) [-235.705] * (-237.147) (-233.353) [-237.561] (-235.214) -- 0:00:48
170000 -- (-237.926) (-234.302) (-237.392) [-234.009] * (-239.224) [-235.776] (-234.361) (-233.744) -- 0:00:48
Average standard deviation of split frequencies: 0.018198
170500 -- (-236.197) (-234.691) [-233.810] (-235.403) * (-236.015) [-234.386] (-236.474) (-233.010) -- 0:00:48
171000 -- (-239.156) [-236.784] (-233.988) (-236.425) * [-235.435] (-233.242) (-236.390) (-233.612) -- 0:00:48
171500 -- (-235.792) (-237.600) [-235.998] (-235.026) * (-235.458) (-237.758) [-235.830] (-237.602) -- 0:00:48
172000 -- (-233.941) (-235.098) [-237.296] (-234.696) * (-241.504) (-233.504) [-241.571] (-240.815) -- 0:00:48
172500 -- (-236.411) (-233.253) (-236.463) [-235.277] * (-244.198) [-233.875] (-235.650) (-236.524) -- 0:00:52
173000 -- (-234.469) [-233.408] (-237.910) (-234.716) * [-237.874] (-234.637) (-234.275) (-235.476) -- 0:00:52
173500 -- (-236.047) (-235.318) [-236.039] (-234.145) * (-238.666) [-234.110] (-235.013) (-234.058) -- 0:00:52
174000 -- (-234.128) (-234.974) [-234.368] (-237.050) * (-235.885) (-233.292) (-234.205) [-238.142] -- 0:00:52
174500 -- [-233.995] (-235.789) (-233.871) (-235.124) * (-234.192) (-234.291) [-235.314] (-238.799) -- 0:00:52
175000 -- [-234.363] (-236.634) (-233.527) (-234.679) * (-238.210) [-235.003] (-233.655) (-243.805) -- 0:00:51
Average standard deviation of split frequencies: 0.016386
175500 -- (-233.766) (-233.656) [-235.484] (-234.015) * (-236.810) (-235.977) [-235.451] (-239.122) -- 0:00:51
176000 -- [-234.202] (-233.580) (-236.675) (-235.902) * (-233.489) (-236.558) (-235.837) [-238.096] -- 0:00:51
176500 -- (-235.920) [-237.851] (-235.640) (-234.861) * (-237.344) (-237.057) [-236.304] (-240.329) -- 0:00:51
177000 -- (-237.017) (-236.107) [-235.308] (-233.822) * (-237.261) [-235.625] (-234.928) (-238.246) -- 0:00:51
177500 -- [-234.561] (-234.059) (-235.182) (-235.312) * (-235.311) (-236.635) [-236.864] (-237.465) -- 0:00:50
178000 -- (-237.121) (-234.106) [-236.118] (-235.949) * (-235.139) (-233.138) (-235.158) [-233.415] -- 0:00:50
178500 -- (-237.692) [-235.674] (-234.052) (-236.520) * (-234.536) (-234.054) [-235.925] (-236.407) -- 0:00:50
179000 -- (-236.102) (-233.373) [-235.216] (-234.307) * (-234.994) [-236.159] (-234.202) (-234.535) -- 0:00:50
179500 -- (-235.862) [-234.060] (-236.414) (-234.207) * [-234.642] (-233.964) (-234.242) (-233.742) -- 0:00:50
180000 -- (-234.849) (-238.084) [-234.451] (-236.025) * (-234.248) (-233.327) [-235.015] (-233.683) -- 0:00:50
Average standard deviation of split frequencies: 0.016576
180500 -- (-236.312) [-236.052] (-238.148) (-234.366) * [-235.549] (-239.468) (-234.350) (-234.154) -- 0:00:49
181000 -- [-236.889] (-238.301) (-234.834) (-235.095) * (-236.123) (-235.085) [-233.980] (-235.534) -- 0:00:49
181500 -- (-238.314) (-236.664) [-233.923] (-240.323) * (-235.153) [-237.212] (-234.489) (-235.527) -- 0:00:49
182000 -- (-234.802) (-238.022) [-234.161] (-238.577) * [-235.440] (-233.429) (-238.165) (-235.348) -- 0:00:49
182500 -- (-233.711) (-234.666) (-233.985) [-237.039] * (-234.456) (-238.453) [-235.848] (-235.120) -- 0:00:49
183000 -- (-235.920) [-236.637] (-233.845) (-238.300) * (-233.164) (-237.313) (-234.447) [-235.440] -- 0:00:49
183500 -- (-237.442) (-237.851) (-233.500) [-236.673] * (-235.636) [-235.451] (-234.266) (-237.953) -- 0:00:48
184000 -- (-233.469) (-236.849) (-235.447) [-234.302] * [-233.930] (-236.159) (-234.539) (-234.155) -- 0:00:48
184500 -- [-235.738] (-234.213) (-235.436) (-234.967) * (-239.257) [-235.183] (-234.157) (-236.846) -- 0:00:48
185000 -- (-233.904) [-234.827] (-234.419) (-234.757) * (-239.061) (-236.541) (-237.766) [-233.913] -- 0:00:48
Average standard deviation of split frequencies: 0.015365
185500 -- [-234.966] (-236.071) (-238.257) (-234.671) * (-236.836) (-234.465) (-242.016) [-237.152] -- 0:00:48
186000 -- (-235.632) (-233.310) [-236.919] (-234.655) * (-236.053) (-234.084) (-235.981) [-237.397] -- 0:00:48
186500 -- (-236.648) [-235.250] (-237.226) (-243.863) * (-236.014) (-234.048) [-234.025] (-234.394) -- 0:00:47
187000 -- (-241.597) [-234.257] (-235.064) (-234.395) * [-235.354] (-234.931) (-233.608) (-234.540) -- 0:00:47
187500 -- (-236.493) (-236.230) [-233.929] (-234.983) * (-235.071) (-235.378) [-235.809] (-236.080) -- 0:00:47
188000 -- [-233.099] (-234.486) (-233.488) (-236.739) * (-234.999) (-235.709) [-237.043] (-237.360) -- 0:00:47
188500 -- (-234.419) (-236.021) [-235.550] (-236.603) * (-233.691) (-236.812) [-237.029] (-234.461) -- 0:00:47
189000 -- (-234.863) (-233.828) (-240.562) [-236.044] * (-233.778) (-235.302) [-241.371] (-233.409) -- 0:00:47
189500 -- (-235.012) (-236.719) (-236.820) [-235.913] * [-238.226] (-235.903) (-237.169) (-235.019) -- 0:00:51
190000 -- (-235.150) (-236.812) [-236.660] (-235.659) * (-235.689) (-238.412) (-237.687) [-233.748] -- 0:00:51
Average standard deviation of split frequencies: 0.014980
190500 -- (-234.745) [-235.338] (-234.917) (-235.552) * (-235.301) (-234.428) [-233.810] (-236.143) -- 0:00:50
191000 -- [-238.563] (-235.338) (-233.444) (-237.160) * (-237.058) (-235.739) [-234.759] (-236.698) -- 0:00:50
191500 -- (-238.591) [-233.278] (-233.729) (-234.933) * (-236.003) [-234.608] (-234.989) (-236.140) -- 0:00:50
192000 -- (-235.756) (-234.008) (-235.200) [-236.577] * (-233.191) [-233.750] (-234.885) (-236.743) -- 0:00:50
192500 -- (-235.293) (-233.778) (-237.436) [-237.336] * (-235.807) [-235.703] (-235.072) (-239.746) -- 0:00:50
193000 -- (-238.891) (-234.442) (-234.826) [-242.777] * (-235.938) (-236.059) [-234.653] (-236.640) -- 0:00:50
193500 -- (-236.630) (-235.010) (-236.747) [-235.248] * (-238.057) (-234.743) (-234.592) [-235.387] -- 0:00:50
194000 -- [-235.327] (-239.392) (-233.985) (-235.514) * (-238.059) (-234.852) [-233.779] (-236.249) -- 0:00:49
194500 -- (-237.156) [-234.983] (-234.158) (-237.761) * (-234.501) (-236.429) (-236.426) [-235.517] -- 0:00:49
195000 -- (-233.804) (-238.599) [-235.721] (-235.118) * (-234.958) (-236.835) (-235.410) [-234.660] -- 0:00:49
Average standard deviation of split frequencies: 0.015846
195500 -- (-233.688) [-235.248] (-235.121) (-236.760) * (-237.489) (-233.809) [-237.386] (-234.970) -- 0:00:49
196000 -- [-236.564] (-234.612) (-235.662) (-233.821) * (-237.340) [-235.283] (-236.268) (-237.686) -- 0:00:49
196500 -- (-234.595) (-235.906) [-236.299] (-237.953) * (-234.216) [-235.220] (-237.074) (-234.104) -- 0:00:49
197000 -- (-233.724) (-236.712) (-233.784) [-236.334] * (-235.830) [-236.528] (-234.151) (-236.005) -- 0:00:48
197500 -- (-236.832) (-236.601) [-236.286] (-235.161) * [-233.951] (-235.760) (-234.642) (-236.849) -- 0:00:48
198000 -- [-235.033] (-235.836) (-234.380) (-235.834) * (-234.213) [-233.806] (-234.147) (-236.586) -- 0:00:48
198500 -- (-233.623) (-237.722) [-234.658] (-236.367) * (-234.110) (-237.840) [-234.058] (-235.189) -- 0:00:48
199000 -- [-235.115] (-234.631) (-235.634) (-235.032) * (-233.455) (-234.823) (-234.114) [-233.784] -- 0:00:48
199500 -- (-238.970) (-234.141) [-236.724] (-235.045) * (-235.497) (-235.474) (-234.806) [-236.554] -- 0:00:48
200000 -- [-235.679] (-234.604) (-235.466) (-234.758) * [-234.588] (-236.667) (-236.054) (-233.471) -- 0:00:48
Average standard deviation of split frequencies: 0.015123
200500 -- (-235.167) (-235.647) [-233.428] (-235.520) * (-233.956) (-234.149) (-234.129) [-234.186] -- 0:00:47
201000 -- (-234.246) (-234.369) [-233.955] (-235.074) * [-234.474] (-233.724) (-234.736) (-234.665) -- 0:00:47
201500 -- (-236.961) (-235.251) (-234.741) [-238.163] * [-233.630] (-236.182) (-235.276) (-233.338) -- 0:00:47
202000 -- (-233.195) [-235.062] (-239.417) (-239.812) * (-235.791) (-234.010) [-236.428] (-234.125) -- 0:00:47
202500 -- (-234.869) (-235.699) (-236.018) [-235.477] * [-235.175] (-235.314) (-236.613) (-235.679) -- 0:00:47
203000 -- (-235.144) (-236.113) [-238.953] (-236.925) * (-234.987) (-233.812) (-235.291) [-234.708] -- 0:00:47
203500 -- (-234.797) [-235.269] (-235.612) (-236.618) * (-235.213) [-234.398] (-238.501) (-234.503) -- 0:00:46
204000 -- (-234.302) (-235.111) [-235.511] (-236.096) * (-236.204) (-234.073) (-235.852) [-233.848] -- 0:00:46
204500 -- (-236.319) (-237.246) [-233.821] (-235.615) * (-234.851) (-235.281) (-236.329) [-234.168] -- 0:00:46
205000 -- (-236.859) [-236.835] (-238.569) (-239.413) * [-233.934] (-235.467) (-235.048) (-235.107) -- 0:00:50
Average standard deviation of split frequencies: 0.013730
205500 -- (-235.757) (-235.994) (-237.399) [-233.094] * (-234.660) (-235.160) [-235.652] (-235.683) -- 0:00:50
206000 -- (-237.001) (-237.801) (-236.551) [-235.098] * (-233.885) (-234.976) [-233.210] (-238.869) -- 0:00:50
206500 -- [-234.067] (-235.818) (-233.796) (-245.515) * [-235.948] (-233.068) (-239.767) (-237.070) -- 0:00:49
207000 -- (-233.480) [-235.786] (-234.406) (-235.233) * [-236.019] (-233.259) (-237.656) (-240.495) -- 0:00:49
207500 -- [-234.283] (-234.668) (-236.011) (-234.751) * (-234.734) (-234.941) [-233.984] (-236.740) -- 0:00:49
208000 -- (-235.480) [-233.673] (-235.801) (-235.624) * (-234.461) (-233.506) (-233.990) [-236.385] -- 0:00:49
208500 -- (-237.306) [-234.534] (-235.654) (-236.917) * (-237.017) [-234.652] (-237.635) (-235.535) -- 0:00:49
209000 -- [-236.924] (-234.920) (-237.489) (-236.999) * [-236.608] (-241.466) (-234.131) (-234.368) -- 0:00:49
209500 -- (-235.811) [-234.914] (-240.866) (-238.679) * [-235.428] (-236.444) (-234.933) (-234.865) -- 0:00:49
210000 -- (-236.109) [-234.816] (-235.876) (-234.270) * (-234.909) (-236.477) (-237.086) [-233.927] -- 0:00:48
Average standard deviation of split frequencies: 0.013426
210500 -- (-241.308) (-235.896) (-235.577) [-233.385] * (-235.532) [-236.132] (-233.620) (-234.174) -- 0:00:48
211000 -- (-242.761) (-234.029) (-234.024) [-233.525] * [-233.068] (-236.704) (-233.976) (-234.071) -- 0:00:48
211500 -- [-239.172] (-238.399) (-238.210) (-234.200) * (-233.807) (-237.308) (-233.656) [-233.998] -- 0:00:48
212000 -- (-235.150) [-238.042] (-236.696) (-235.750) * (-238.542) (-235.869) (-235.882) [-233.835] -- 0:00:48
212500 -- [-233.749] (-235.873) (-236.596) (-236.880) * (-236.782) (-234.781) [-233.981] (-236.720) -- 0:00:48
213000 -- [-236.973] (-236.935) (-236.013) (-233.754) * [-234.111] (-234.830) (-233.731) (-236.137) -- 0:00:48
213500 -- (-235.015) (-238.514) (-235.944) [-239.500] * (-235.651) (-237.534) [-235.810] (-233.944) -- 0:00:47
214000 -- [-234.230] (-234.990) (-235.970) (-234.798) * (-234.710) (-233.733) [-234.176] (-234.436) -- 0:00:47
214500 -- (-237.827) [-234.025] (-234.880) (-233.218) * (-235.570) [-233.979] (-236.500) (-236.874) -- 0:00:47
215000 -- (-235.077) (-233.614) [-236.822] (-234.270) * [-235.536] (-233.860) (-239.490) (-234.755) -- 0:00:47
Average standard deviation of split frequencies: 0.013231
215500 -- (-236.008) (-236.097) (-237.563) [-234.399] * (-238.206) (-233.683) [-235.156] (-236.198) -- 0:00:47
216000 -- (-236.671) (-235.747) [-234.951] (-233.419) * (-234.253) (-233.840) [-235.534] (-233.314) -- 0:00:47
216500 -- (-233.996) [-235.169] (-236.847) (-234.820) * (-234.745) (-236.300) (-239.336) [-235.721] -- 0:00:47
217000 -- [-234.971] (-234.733) (-236.020) (-235.502) * (-238.285) (-236.720) (-238.006) [-234.253] -- 0:00:46
217500 -- (-234.273) (-236.596) [-233.914] (-235.527) * [-239.883] (-237.138) (-240.216) (-235.485) -- 0:00:46
218000 -- (-239.257) (-236.355) (-236.962) [-237.550] * [-234.102] (-238.337) (-234.569) (-235.481) -- 0:00:46
218500 -- (-235.481) (-234.822) (-242.216) [-237.592] * [-233.353] (-235.037) (-236.031) (-234.380) -- 0:00:46
219000 -- (-235.367) (-235.121) (-235.281) [-235.976] * (-234.054) (-235.994) (-236.458) [-235.558] -- 0:00:49
219500 -- (-235.321) (-236.956) [-234.494] (-236.392) * (-233.541) [-236.000] (-235.077) (-235.374) -- 0:00:49
220000 -- [-236.501] (-235.800) (-234.813) (-236.630) * (-239.969) (-237.799) [-233.481] (-235.844) -- 0:00:49
Average standard deviation of split frequencies: 0.013446
220500 -- [-233.854] (-233.524) (-237.367) (-234.609) * (-233.628) (-237.314) [-234.662] (-234.744) -- 0:00:49
221000 -- (-234.978) (-236.011) (-236.740) [-233.856] * (-235.120) (-238.777) (-233.548) [-235.103] -- 0:00:49
221500 -- (-234.575) (-234.779) [-235.786] (-234.663) * [-234.439] (-237.449) (-235.655) (-233.306) -- 0:00:49
222000 -- (-233.552) (-235.229) (-236.649) [-235.108] * [-234.953] (-235.255) (-238.483) (-234.720) -- 0:00:49
222500 -- [-237.506] (-234.579) (-234.825) (-235.533) * (-235.136) (-234.193) (-234.157) [-234.748] -- 0:00:48
223000 -- [-233.616] (-236.406) (-233.865) (-235.268) * (-234.254) [-235.208] (-238.435) (-234.798) -- 0:00:48
223500 -- (-240.428) (-235.906) (-235.876) [-236.261] * (-237.388) [-235.923] (-237.075) (-237.033) -- 0:00:48
224000 -- (-236.207) (-235.492) (-238.155) [-235.666] * [-237.026] (-235.977) (-237.566) (-233.305) -- 0:00:48
224500 -- (-237.171) (-238.611) [-241.147] (-235.661) * (-233.596) [-233.358] (-235.159) (-235.230) -- 0:00:48
225000 -- (-238.330) [-236.148] (-239.020) (-234.639) * (-236.915) (-234.109) (-233.956) [-234.484] -- 0:00:48
Average standard deviation of split frequencies: 0.012883
225500 -- (-239.641) (-235.602) (-233.981) [-236.680] * [-233.306] (-235.112) (-234.339) (-235.951) -- 0:00:48
226000 -- [-235.739] (-237.619) (-238.902) (-235.628) * (-233.764) (-236.762) (-235.503) [-236.870] -- 0:00:47
226500 -- [-235.320] (-236.585) (-237.077) (-236.873) * [-233.257] (-235.865) (-237.626) (-232.944) -- 0:00:47
227000 -- [-234.201] (-236.295) (-237.943) (-236.288) * (-234.968) (-235.673) [-236.319] (-233.367) -- 0:00:47
227500 -- (-234.720) (-236.962) [-234.458] (-235.238) * (-233.340) [-235.598] (-234.306) (-235.662) -- 0:00:47
228000 -- (-234.828) (-233.476) (-233.559) [-237.424] * (-235.857) (-235.552) [-234.305] (-237.150) -- 0:00:47
228500 -- (-234.225) (-235.228) [-238.452] (-236.174) * (-238.078) (-233.109) [-234.687] (-234.957) -- 0:00:47
229000 -- (-233.459) (-235.186) [-235.854] (-237.296) * (-233.212) [-234.288] (-237.282) (-239.706) -- 0:00:47
229500 -- (-237.389) (-237.619) [-235.524] (-237.957) * [-235.452] (-236.807) (-239.111) (-238.196) -- 0:00:47
230000 -- (-234.144) (-233.246) (-235.529) [-236.247] * (-235.924) [-233.638] (-235.996) (-235.110) -- 0:00:46
Average standard deviation of split frequencies: 0.012142
230500 -- (-237.633) (-234.850) [-236.604] (-234.946) * (-236.621) (-236.086) [-234.906] (-234.716) -- 0:00:46
231000 -- (-234.946) (-235.260) [-241.006] (-239.135) * (-238.545) [-236.635] (-234.699) (-236.034) -- 0:00:46
231500 -- (-238.863) (-237.068) [-238.038] (-236.872) * (-236.421) (-237.682) [-234.763] (-234.918) -- 0:00:46
232000 -- [-235.998] (-237.143) (-235.450) (-238.834) * (-234.628) [-236.389] (-240.149) (-234.421) -- 0:00:46
232500 -- (-236.670) (-236.310) (-236.457) [-236.188] * [-234.044] (-233.773) (-235.931) (-237.682) -- 0:00:46
233000 -- [-235.364] (-234.407) (-233.789) (-236.462) * (-237.428) (-234.587) [-232.945] (-239.227) -- 0:00:46
233500 -- (-235.209) (-240.006) (-237.620) [-233.951] * (-236.661) (-235.367) [-236.581] (-237.715) -- 0:00:45
234000 -- (-237.882) [-234.412] (-233.991) (-238.050) * (-236.037) (-235.373) (-238.022) [-236.832] -- 0:00:45
234500 -- (-236.044) (-241.044) (-239.806) [-235.591] * (-235.197) [-234.385] (-236.729) (-236.542) -- 0:00:45
235000 -- (-233.908) [-235.152] (-234.000) (-233.533) * [-235.845] (-238.496) (-234.179) (-236.330) -- 0:00:45
Average standard deviation of split frequencies: 0.011610
235500 -- (-234.117) [-234.742] (-233.810) (-236.353) * (-236.247) (-234.099) (-237.432) [-238.421] -- 0:00:45
236000 -- (-236.362) [-236.439] (-234.034) (-237.100) * (-234.353) (-238.238) [-240.145] (-235.555) -- 0:00:48
236500 -- (-235.466) (-235.421) (-237.755) [-233.861] * (-235.135) (-237.367) [-234.063] (-235.327) -- 0:00:48
237000 -- [-236.592] (-233.287) (-234.107) (-236.325) * (-234.793) [-236.242] (-233.459) (-234.745) -- 0:00:48
237500 -- (-234.419) (-237.105) (-236.463) [-235.089] * [-235.995] (-234.982) (-235.545) (-234.512) -- 0:00:48
238000 -- (-234.481) (-235.863) [-236.628] (-234.673) * (-238.419) [-234.859] (-237.037) (-237.022) -- 0:00:48
238500 -- (-236.035) (-235.236) [-235.094] (-235.598) * (-237.443) (-240.958) [-234.367] (-236.213) -- 0:00:47
239000 -- [-234.968] (-238.427) (-236.480) (-235.524) * (-239.160) [-236.752] (-234.838) (-233.218) -- 0:00:47
239500 -- (-235.468) [-237.617] (-234.155) (-239.531) * (-239.583) (-235.288) [-233.559] (-236.496) -- 0:00:47
240000 -- (-234.818) [-235.186] (-235.426) (-235.736) * [-235.294] (-234.213) (-234.296) (-234.299) -- 0:00:47
Average standard deviation of split frequencies: 0.011752
240500 -- [-234.463] (-234.190) (-234.483) (-234.119) * (-235.384) (-243.577) [-236.030] (-234.214) -- 0:00:47
241000 -- (-234.005) [-236.680] (-234.434) (-235.696) * [-234.000] (-234.973) (-235.518) (-234.820) -- 0:00:47
241500 -- (-239.093) (-236.334) (-234.983) [-235.047] * (-235.149) (-234.314) [-235.604] (-235.987) -- 0:00:47
242000 -- [-233.799] (-244.708) (-233.685) (-236.899) * (-233.783) (-235.950) (-235.914) [-234.689] -- 0:00:46
242500 -- [-236.258] (-234.386) (-239.160) (-234.990) * (-233.441) (-235.480) (-234.309) [-234.997] -- 0:00:46
243000 -- (-235.223) (-235.254) (-240.207) [-234.838] * (-235.372) (-235.234) (-235.990) [-233.395] -- 0:00:46
243500 -- (-235.212) (-235.577) (-236.198) [-233.786] * (-234.287) (-234.722) (-239.175) [-235.123] -- 0:00:46
244000 -- (-234.253) [-237.553] (-234.196) (-235.504) * (-234.276) [-235.627] (-241.792) (-236.677) -- 0:00:46
244500 -- (-233.808) (-233.592) (-236.469) [-235.638] * [-234.979] (-234.540) (-242.800) (-237.740) -- 0:00:46
245000 -- (-233.969) [-233.974] (-235.124) (-233.260) * (-237.449) (-235.294) [-237.695] (-236.184) -- 0:00:46
Average standard deviation of split frequencies: 0.010180
245500 -- [-236.220] (-235.155) (-235.033) (-233.783) * (-233.818) (-236.205) (-233.808) [-236.053] -- 0:00:46
246000 -- (-236.585) (-233.690) (-234.722) [-238.231] * (-234.488) (-233.462) (-236.268) [-237.510] -- 0:00:45
246500 -- (-236.948) (-235.377) [-233.463] (-236.200) * (-234.765) (-236.418) (-235.974) [-233.617] -- 0:00:45
247000 -- [-233.034] (-234.399) (-236.496) (-237.820) * (-233.988) (-234.087) (-236.601) [-236.195] -- 0:00:45
247500 -- (-236.847) [-234.265] (-235.006) (-234.860) * (-233.198) (-237.321) [-235.066] (-235.268) -- 0:00:45
248000 -- (-236.407) (-234.304) (-236.002) [-233.291] * (-237.980) [-237.240] (-236.085) (-235.494) -- 0:00:45
248500 -- (-239.531) [-237.078] (-236.947) (-237.550) * (-235.651) (-234.173) [-234.720] (-239.115) -- 0:00:45
249000 -- (-238.959) (-235.044) (-237.728) [-233.469] * [-234.711] (-235.438) (-234.948) (-234.693) -- 0:00:45
249500 -- (-234.985) (-234.712) (-238.190) [-237.039] * (-235.249) (-236.272) [-235.357] (-236.085) -- 0:00:45
250000 -- [-237.737] (-236.330) (-234.930) (-235.695) * (-235.198) (-235.763) (-236.036) [-234.949] -- 0:00:45
Average standard deviation of split frequencies: 0.010696
250500 -- (-236.975) [-238.308] (-235.459) (-235.422) * (-234.994) (-235.115) (-236.004) [-235.200] -- 0:00:44
251000 -- [-233.912] (-234.251) (-234.590) (-237.078) * (-235.409) (-235.562) (-237.085) [-235.699] -- 0:00:44
251500 -- [-234.851] (-236.216) (-235.332) (-236.006) * (-235.160) (-237.643) [-234.371] (-234.968) -- 0:00:44
252000 -- (-237.063) [-236.259] (-234.618) (-238.764) * (-235.619) [-233.603] (-235.433) (-237.924) -- 0:00:44
252500 -- (-234.754) [-235.280] (-236.631) (-234.712) * [-234.391] (-234.202) (-239.273) (-236.090) -- 0:00:44
253000 -- [-235.316] (-235.081) (-236.127) (-240.029) * (-234.587) (-234.582) (-240.156) [-233.476] -- 0:00:47
253500 -- [-233.303] (-234.796) (-239.615) (-238.232) * (-236.242) (-235.722) (-238.954) [-235.446] -- 0:00:47
254000 -- (-238.469) (-236.650) [-234.946] (-234.962) * (-235.926) (-233.135) [-238.153] (-235.220) -- 0:00:46
254500 -- [-238.958] (-234.839) (-235.188) (-236.118) * (-234.284) (-234.186) [-234.288] (-236.061) -- 0:00:46
255000 -- (-234.795) [-235.220] (-234.438) (-237.712) * (-236.102) (-241.987) [-235.282] (-234.019) -- 0:00:46
Average standard deviation of split frequencies: 0.011164
255500 -- (-239.071) (-234.551) [-233.681] (-235.809) * (-233.719) (-238.887) [-234.814] (-242.510) -- 0:00:46
256000 -- [-237.643] (-233.169) (-235.616) (-236.634) * (-236.455) (-237.413) [-235.314] (-237.262) -- 0:00:46
256500 -- (-237.252) [-233.451] (-235.533) (-234.060) * [-236.324] (-238.207) (-234.265) (-240.017) -- 0:00:46
257000 -- (-239.468) (-235.916) [-237.628] (-235.324) * [-236.097] (-235.835) (-236.116) (-235.586) -- 0:00:46
257500 -- (-238.123) (-241.635) (-235.439) [-235.734] * (-235.896) [-233.775] (-238.386) (-233.876) -- 0:00:46
258000 -- [-233.918] (-236.921) (-234.347) (-235.386) * (-236.444) (-236.941) [-233.794] (-233.138) -- 0:00:46
258500 -- (-237.556) [-233.800] (-234.630) (-235.590) * (-237.296) [-234.719] (-235.223) (-234.159) -- 0:00:45
259000 -- (-240.991) [-235.226] (-235.966) (-235.789) * (-234.665) [-234.839] (-236.455) (-237.018) -- 0:00:45
259500 -- (-239.209) (-235.724) [-233.880] (-234.871) * (-234.377) (-234.117) [-237.608] (-235.739) -- 0:00:45
260000 -- (-234.350) [-240.302] (-234.570) (-238.571) * (-234.526) (-235.294) (-235.944) [-234.507] -- 0:00:45
Average standard deviation of split frequencies: 0.011077
260500 -- (-233.819) (-234.731) (-234.611) [-236.451] * (-236.010) [-235.385] (-237.042) (-234.653) -- 0:00:45
261000 -- [-235.361] (-234.177) (-239.118) (-235.791) * (-236.995) [-234.569] (-235.510) (-234.795) -- 0:00:45
261500 -- (-240.349) [-236.584] (-238.373) (-233.587) * (-235.322) (-233.797) (-233.146) [-240.260] -- 0:00:45
262000 -- (-235.357) (-234.898) [-235.227] (-234.045) * (-237.410) (-235.936) [-236.287] (-234.206) -- 0:00:45
262500 -- (-234.856) (-234.102) [-233.691] (-233.587) * (-234.219) (-233.940) [-238.405] (-235.866) -- 0:00:44
263000 -- (-234.174) [-234.584] (-235.231) (-234.161) * [-234.102] (-234.707) (-237.954) (-236.025) -- 0:00:44
263500 -- (-237.474) (-237.450) [-234.911] (-234.213) * (-236.194) [-234.479] (-235.235) (-233.645) -- 0:00:44
264000 -- (-235.543) (-235.397) [-235.032] (-234.507) * (-235.832) [-234.225] (-235.336) (-236.935) -- 0:00:44
264500 -- [-235.383] (-235.377) (-236.143) (-235.337) * (-235.253) (-235.985) (-236.389) [-235.496] -- 0:00:44
265000 -- (-235.244) (-237.853) [-233.432] (-234.935) * (-236.209) (-236.770) (-233.567) [-235.869] -- 0:00:44
Average standard deviation of split frequencies: 0.012405
265500 -- [-236.743] (-236.873) (-243.502) (-236.646) * (-234.833) [-236.086] (-234.254) (-234.731) -- 0:00:44
266000 -- (-237.398) (-235.430) (-237.097) [-234.260] * (-235.576) (-236.176) (-233.343) [-238.472] -- 0:00:44
266500 -- (-240.070) [-235.460] (-236.339) (-236.885) * [-236.522] (-236.918) (-235.499) (-234.857) -- 0:00:44
267000 -- [-233.989] (-240.186) (-234.526) (-238.393) * (-235.446) [-238.249] (-235.924) (-233.372) -- 0:00:43
267500 -- (-236.484) (-236.213) [-239.321] (-236.178) * (-235.763) (-236.894) [-237.538] (-234.189) -- 0:00:43
268000 -- (-238.859) (-235.644) (-237.650) [-236.144] * [-235.544] (-239.252) (-234.766) (-235.656) -- 0:00:43
268500 -- (-237.140) (-238.690) [-235.068] (-235.507) * (-233.630) [-233.981] (-233.359) (-234.756) -- 0:00:43
269000 -- (-234.384) (-237.999) [-236.784] (-234.636) * (-234.622) (-237.553) [-235.125] (-234.869) -- 0:00:43
269500 -- (-235.404) [-234.044] (-233.783) (-234.425) * (-234.849) (-237.782) (-236.635) [-241.184] -- 0:00:43
270000 -- (-234.795) (-235.006) (-235.248) [-241.034] * [-234.741] (-235.863) (-237.097) (-242.379) -- 0:00:43
Average standard deviation of split frequencies: 0.013421
270500 -- (-234.991) [-237.957] (-234.599) (-241.651) * (-235.210) (-236.757) (-239.343) [-235.972] -- 0:00:45
271000 -- (-235.206) [-235.269] (-237.907) (-233.248) * (-239.617) (-234.173) (-236.517) [-236.950] -- 0:00:45
271500 -- (-233.653) [-233.926] (-236.201) (-237.339) * (-235.993) (-233.425) (-233.519) [-236.020] -- 0:00:45
272000 -- (-233.768) (-236.009) (-234.965) [-238.407] * (-239.029) (-235.305) [-234.310] (-233.637) -- 0:00:45
272500 -- (-235.323) (-236.214) [-235.261] (-236.363) * (-234.224) [-238.496] (-233.683) (-234.570) -- 0:00:45
273000 -- (-235.183) [-236.033] (-236.768) (-233.498) * (-235.341) (-235.848) [-235.478] (-235.571) -- 0:00:45
273500 -- (-235.839) [-233.853] (-236.519) (-234.038) * [-236.087] (-233.986) (-236.667) (-238.322) -- 0:00:45
274000 -- (-238.886) (-233.618) (-238.198) [-235.448] * (-235.838) [-233.493] (-234.917) (-237.174) -- 0:00:45
274500 -- (-237.320) (-234.509) [-237.841] (-235.717) * (-235.724) [-234.486] (-234.297) (-235.583) -- 0:00:44
275000 -- (-240.437) (-236.070) (-238.333) [-235.464] * (-233.604) (-235.001) [-233.343] (-234.344) -- 0:00:44
Average standard deviation of split frequencies: 0.013463
275500 -- (-236.262) (-233.666) [-234.774] (-235.823) * [-234.419] (-236.019) (-238.088) (-233.748) -- 0:00:44
276000 -- [-239.653] (-234.665) (-236.964) (-239.698) * (-235.785) [-234.979] (-235.271) (-235.644) -- 0:00:44
276500 -- (-238.338) (-234.120) (-234.857) [-233.781] * [-235.084] (-234.060) (-236.344) (-234.249) -- 0:00:44
277000 -- (-235.926) [-235.648] (-234.307) (-234.399) * (-235.583) (-236.269) [-234.738] (-238.711) -- 0:00:44
277500 -- [-236.752] (-235.762) (-233.761) (-233.240) * (-235.605) [-235.930] (-237.946) (-237.970) -- 0:00:44
278000 -- [-234.083] (-233.920) (-235.270) (-234.583) * [-233.347] (-237.121) (-234.484) (-236.316) -- 0:00:44
278500 -- (-234.068) (-237.360) (-235.614) [-235.102] * (-235.108) (-236.205) (-235.908) [-241.383] -- 0:00:44
279000 -- [-234.513] (-234.915) (-236.611) (-234.400) * [-234.071] (-235.024) (-233.702) (-237.480) -- 0:00:43
279500 -- (-233.877) [-239.042] (-234.147) (-237.082) * [-234.867] (-235.671) (-233.282) (-237.688) -- 0:00:43
280000 -- [-234.102] (-237.085) (-239.002) (-234.603) * (-238.624) (-241.407) (-234.123) [-236.036] -- 0:00:43
Average standard deviation of split frequencies: 0.013962
280500 -- (-234.420) (-235.309) [-235.379] (-238.150) * (-237.362) (-234.523) (-233.706) [-236.816] -- 0:00:43
281000 -- [-234.918] (-234.737) (-234.055) (-236.022) * [-235.797] (-239.651) (-236.828) (-237.025) -- 0:00:43
281500 -- (-238.111) (-233.576) (-239.532) [-234.085] * (-235.970) [-235.557] (-234.266) (-234.323) -- 0:00:43
282000 -- [-237.023] (-238.348) (-237.602) (-234.955) * [-235.813] (-236.295) (-234.097) (-234.607) -- 0:00:43
282500 -- [-235.671] (-236.346) (-233.175) (-234.059) * (-235.894) (-236.310) (-239.870) [-237.226] -- 0:00:43
283000 -- (-234.645) [-236.537] (-233.974) (-234.559) * (-234.121) (-239.582) (-235.782) [-234.582] -- 0:00:43
283500 -- (-235.374) (-234.929) (-236.100) [-235.286] * (-235.666) (-237.538) [-233.764] (-236.183) -- 0:00:42
284000 -- [-237.276] (-241.778) (-235.893) (-235.069) * [-238.078] (-237.225) (-234.285) (-236.898) -- 0:00:42
284500 -- (-236.572) [-237.328] (-235.244) (-234.124) * (-237.593) (-234.767) (-236.286) [-236.774] -- 0:00:42
285000 -- [-234.691] (-235.138) (-239.090) (-233.655) * (-235.157) (-233.466) (-239.611) [-238.507] -- 0:00:42
Average standard deviation of split frequencies: 0.015968
285500 -- (-239.043) [-234.272] (-234.948) (-238.014) * (-236.928) (-240.706) [-234.217] (-235.190) -- 0:00:42
286000 -- (-234.176) [-234.807] (-235.921) (-234.718) * (-236.226) (-238.220) [-235.184] (-235.792) -- 0:00:42
286500 -- (-237.398) [-234.029] (-235.988) (-235.179) * [-233.196] (-234.757) (-237.025) (-235.384) -- 0:00:42
287000 -- (-234.981) [-235.152] (-233.758) (-236.380) * [-234.227] (-235.032) (-234.431) (-240.577) -- 0:00:42
287500 -- [-241.326] (-236.435) (-234.641) (-233.755) * [-234.274] (-237.285) (-238.029) (-236.878) -- 0:00:44
288000 -- (-238.260) (-235.962) [-235.927] (-234.743) * [-236.194] (-236.761) (-236.191) (-233.474) -- 0:00:44
288500 -- [-235.078] (-237.888) (-235.264) (-235.703) * [-236.294] (-238.644) (-235.894) (-236.252) -- 0:00:44
289000 -- (-233.421) (-234.424) (-235.907) [-233.545] * [-234.890] (-234.510) (-233.009) (-235.756) -- 0:00:44
289500 -- (-235.835) [-234.161] (-238.831) (-234.146) * (-236.677) (-233.978) (-233.391) [-235.252] -- 0:00:44
290000 -- (-236.596) (-233.175) [-235.865] (-233.740) * (-236.904) (-234.853) [-234.458] (-234.410) -- 0:00:44
Average standard deviation of split frequencies: 0.015948
290500 -- (-236.471) [-234.028] (-234.808) (-236.097) * [-233.956] (-238.167) (-235.506) (-237.264) -- 0:00:43
291000 -- (-235.950) [-235.559] (-234.066) (-235.375) * (-234.777) (-236.401) [-234.029] (-233.293) -- 0:00:43
291500 -- (-234.696) (-242.083) [-234.084] (-238.272) * (-236.710) (-236.826) [-237.106] (-234.923) -- 0:00:43
292000 -- [-234.201] (-237.319) (-234.029) (-233.683) * (-233.957) (-234.280) (-240.690) [-234.187] -- 0:00:43
292500 -- (-236.336) (-239.533) [-239.310] (-237.199) * (-233.891) [-234.030] (-234.002) (-233.909) -- 0:00:43
293000 -- (-234.655) (-235.320) [-236.862] (-236.322) * (-234.231) (-234.979) (-233.020) [-234.077] -- 0:00:43
293500 -- (-237.688) (-236.672) (-235.050) [-233.037] * (-238.728) (-236.039) (-236.081) [-235.044] -- 0:00:43
294000 -- (-235.946) (-235.727) (-237.267) [-234.876] * (-235.937) (-236.589) (-235.004) [-236.599] -- 0:00:43
294500 -- (-237.555) (-234.821) (-234.880) [-233.969] * (-237.611) (-236.559) [-236.554] (-238.886) -- 0:00:43
295000 -- (-235.091) [-235.710] (-233.456) (-234.993) * (-237.757) [-233.821] (-238.889) (-237.431) -- 0:00:43
Average standard deviation of split frequencies: 0.015926
295500 -- (-234.600) [-235.861] (-235.286) (-236.140) * (-238.033) (-237.708) (-236.730) [-234.931] -- 0:00:42
296000 -- (-234.533) [-234.821] (-234.521) (-235.278) * (-238.646) [-238.741] (-239.140) (-234.787) -- 0:00:42
296500 -- (-233.993) (-234.531) [-235.104] (-237.892) * (-234.712) (-237.437) (-233.946) [-236.179] -- 0:00:42
297000 -- (-237.307) (-233.814) [-236.376] (-236.994) * (-234.908) (-235.769) [-233.493] (-236.763) -- 0:00:42
297500 -- [-233.057] (-238.707) (-236.650) (-234.884) * (-233.812) (-236.366) [-236.054] (-235.366) -- 0:00:42
298000 -- (-234.746) [-239.269] (-236.295) (-234.997) * (-234.337) (-236.177) (-237.891) [-233.837] -- 0:00:42
298500 -- (-233.869) [-235.095] (-236.377) (-236.466) * (-236.197) (-239.741) (-234.203) [-235.807] -- 0:00:42
299000 -- (-234.203) (-234.313) (-235.361) [-236.279] * [-234.772] (-239.518) (-236.944) (-234.760) -- 0:00:42
299500 -- (-235.670) (-238.211) (-234.106) [-234.927] * [-234.492] (-238.075) (-236.100) (-235.349) -- 0:00:42
300000 -- (-236.205) (-236.968) [-235.315] (-234.688) * [-236.891] (-234.497) (-233.702) (-234.721) -- 0:00:42
Average standard deviation of split frequencies: 0.016267
300500 -- (-233.688) (-233.748) [-235.121] (-235.100) * (-234.429) [-235.901] (-234.892) (-235.321) -- 0:00:41
301000 -- (-235.846) (-234.506) (-236.076) [-235.803] * (-240.536) [-234.014] (-239.464) (-237.731) -- 0:00:41
301500 -- (-235.848) (-235.827) (-234.459) [-236.247] * (-238.241) (-238.509) (-235.386) [-235.162] -- 0:00:41
302000 -- (-234.781) [-234.940] (-235.506) (-234.261) * (-241.580) (-243.089) (-235.194) [-234.470] -- 0:00:41
302500 -- (-235.430) [-234.463] (-234.970) (-237.442) * (-239.445) (-240.580) [-236.818] (-234.714) -- 0:00:41
303000 -- (-238.989) [-234.975] (-241.059) (-235.658) * (-235.409) (-235.292) [-235.518] (-235.727) -- 0:00:41
303500 -- [-234.688] (-238.224) (-239.748) (-240.458) * (-235.150) (-234.283) (-237.042) [-236.846] -- 0:00:41
304000 -- [-237.674] (-237.811) (-239.487) (-236.137) * (-240.339) [-234.361] (-234.817) (-235.678) -- 0:00:41
304500 -- (-233.940) (-234.630) (-235.983) [-235.750] * (-238.312) (-236.790) [-233.704] (-234.825) -- 0:00:43
305000 -- (-233.406) (-239.161) [-238.382] (-238.155) * (-235.462) (-237.045) (-237.339) [-236.277] -- 0:00:43
Average standard deviation of split frequencies: 0.016657
305500 -- [-236.476] (-236.016) (-237.575) (-236.584) * (-233.742) (-235.170) [-235.062] (-233.763) -- 0:00:43
306000 -- (-235.277) (-238.701) (-236.639) [-237.018] * [-239.711] (-238.135) (-238.347) (-233.223) -- 0:00:43
306500 -- (-236.538) (-235.319) [-236.097] (-238.004) * (-233.609) [-235.488] (-234.189) (-234.431) -- 0:00:42
307000 -- (-235.036) [-233.063] (-235.838) (-233.635) * (-234.074) (-234.153) [-236.096] (-237.003) -- 0:00:42
307500 -- (-234.027) (-236.410) [-236.131] (-233.323) * (-234.251) (-236.251) (-237.944) [-234.166] -- 0:00:42
308000 -- [-234.532] (-236.505) (-236.473) (-237.204) * (-237.473) (-236.456) [-233.383] (-236.159) -- 0:00:42
308500 -- (-236.712) [-234.907] (-235.603) (-239.292) * (-236.715) [-237.067] (-233.509) (-234.144) -- 0:00:42
309000 -- [-234.018] (-236.705) (-237.763) (-235.245) * (-234.256) (-234.942) (-233.955) [-235.277] -- 0:00:42
309500 -- (-234.722) [-236.833] (-234.687) (-233.191) * [-233.353] (-238.257) (-233.876) (-236.095) -- 0:00:42
310000 -- [-234.296] (-237.633) (-234.083) (-235.120) * [-235.737] (-235.973) (-234.960) (-234.666) -- 0:00:42
Average standard deviation of split frequencies: 0.017166
310500 -- [-234.553] (-235.975) (-236.894) (-234.080) * (-235.296) (-236.848) (-235.307) [-238.066] -- 0:00:42
311000 -- (-235.100) [-237.338] (-234.464) (-234.277) * (-234.605) (-240.146) (-235.176) [-235.202] -- 0:00:42
311500 -- (-236.627) [-234.522] (-234.320) (-233.632) * [-235.242] (-237.648) (-236.862) (-234.748) -- 0:00:41
312000 -- (-234.544) [-235.789] (-234.376) (-238.718) * (-234.481) (-237.561) (-235.588) [-236.245] -- 0:00:41
312500 -- (-235.277) (-235.972) [-238.006] (-234.593) * (-234.130) [-238.887] (-236.151) (-240.475) -- 0:00:41
313000 -- (-235.915) (-244.714) [-235.055] (-237.216) * (-237.004) [-237.437] (-238.879) (-237.764) -- 0:00:41
313500 -- [-234.924] (-234.311) (-235.247) (-235.880) * (-243.485) (-237.991) [-233.621] (-234.351) -- 0:00:41
314000 -- (-235.374) (-233.424) (-236.467) [-236.304] * (-237.936) (-234.372) [-233.343] (-233.195) -- 0:00:41
314500 -- [-235.888] (-237.588) (-236.172) (-234.946) * (-237.096) (-233.674) [-235.212] (-234.726) -- 0:00:41
315000 -- [-233.009] (-236.171) (-234.301) (-237.191) * (-234.687) (-234.626) (-238.282) [-235.393] -- 0:00:41
Average standard deviation of split frequencies: 0.017528
315500 -- [-233.416] (-234.831) (-234.547) (-235.457) * (-236.356) (-238.093) [-240.120] (-233.596) -- 0:00:41
316000 -- (-237.429) [-235.228] (-235.846) (-236.235) * (-236.226) [-235.807] (-238.079) (-234.877) -- 0:00:41
316500 -- (-235.000) (-233.186) (-235.530) [-237.823] * (-235.055) [-234.923] (-240.962) (-234.559) -- 0:00:41
317000 -- (-234.896) (-233.098) (-234.339) [-233.912] * (-234.994) (-236.106) [-235.500] (-236.388) -- 0:00:40
317500 -- (-235.093) (-233.712) (-233.737) [-233.957] * (-233.735) (-233.312) (-239.624) [-237.163] -- 0:00:40
318000 -- (-235.107) (-234.440) (-236.102) [-233.271] * (-234.125) (-234.003) [-235.199] (-234.945) -- 0:00:40
318500 -- (-234.675) [-235.267] (-238.100) (-235.725) * (-234.672) (-235.339) (-236.478) [-234.702] -- 0:00:40
319000 -- (-234.329) (-233.674) [-235.865] (-235.112) * (-236.593) (-235.046) (-241.853) [-236.813] -- 0:00:40
319500 -- (-235.699) [-235.208] (-238.147) (-233.529) * (-236.508) [-235.029] (-235.547) (-236.247) -- 0:00:40
320000 -- (-235.950) (-237.066) (-234.538) [-234.170] * [-236.797] (-233.687) (-240.080) (-235.162) -- 0:00:40
Average standard deviation of split frequencies: 0.017825
320500 -- [-238.637] (-236.152) (-235.411) (-234.205) * (-234.962) [-234.802] (-236.879) (-236.670) -- 0:00:40
321000 -- (-236.588) (-235.956) [-234.966] (-234.070) * (-235.405) (-237.991) (-239.084) [-234.978] -- 0:00:40
321500 -- [-234.018] (-235.288) (-236.239) (-237.447) * (-236.701) (-235.676) (-236.331) [-234.476] -- 0:00:42
322000 -- (-233.902) [-236.103] (-236.348) (-235.400) * (-235.075) [-233.304] (-236.188) (-234.850) -- 0:00:42
322500 -- (-235.176) (-236.605) (-237.203) [-237.551] * (-235.568) (-234.649) [-236.927] (-236.084) -- 0:00:42
323000 -- (-236.250) [-234.948] (-233.792) (-234.704) * (-234.864) [-233.429] (-237.275) (-235.838) -- 0:00:41
323500 -- (-235.609) (-238.302) (-234.434) [-239.125] * (-239.106) (-235.605) [-235.484] (-235.018) -- 0:00:41
324000 -- (-235.121) [-238.060] (-234.245) (-236.843) * [-237.357] (-236.610) (-240.782) (-235.370) -- 0:00:41
324500 -- (-234.424) (-237.890) (-233.689) [-236.799] * (-237.401) [-237.406] (-239.214) (-233.973) -- 0:00:41
325000 -- [-234.493] (-236.277) (-234.361) (-237.650) * (-233.771) (-235.006) [-236.433] (-233.485) -- 0:00:41
Average standard deviation of split frequencies: 0.018713
325500 -- (-235.042) (-235.589) [-236.603] (-234.181) * (-234.993) (-235.254) [-234.456] (-234.983) -- 0:00:41
326000 -- (-234.233) [-233.957] (-235.205) (-235.158) * (-237.816) [-236.886] (-236.676) (-234.208) -- 0:00:41
326500 -- (-238.061) [-233.516] (-234.439) (-239.323) * (-234.964) [-235.496] (-233.738) (-234.038) -- 0:00:41
327000 -- (-238.639) [-234.583] (-235.988) (-234.016) * [-234.186] (-236.797) (-238.071) (-233.670) -- 0:00:41
327500 -- (-233.823) (-236.724) [-234.509] (-236.217) * (-233.746) (-234.168) (-236.279) [-234.350] -- 0:00:41
328000 -- (-234.121) (-233.979) [-240.928] (-236.872) * (-235.306) (-234.774) [-235.349] (-237.108) -- 0:00:40
328500 -- (-236.624) [-234.944] (-233.734) (-238.897) * (-235.915) (-234.313) (-237.369) [-235.011] -- 0:00:40
329000 -- (-234.899) [-235.073] (-234.710) (-235.485) * (-234.045) (-235.404) [-236.185] (-235.777) -- 0:00:40
329500 -- (-235.426) [-236.284] (-234.699) (-237.378) * (-234.927) (-234.213) [-234.248] (-236.651) -- 0:00:40
330000 -- (-237.484) (-235.547) (-239.369) [-235.711] * (-235.668) (-237.478) [-233.453] (-234.129) -- 0:00:40
Average standard deviation of split frequencies: 0.018617
330500 -- (-233.669) (-234.167) [-235.078] (-235.279) * (-233.752) [-233.441] (-237.679) (-237.060) -- 0:00:40
331000 -- [-234.316] (-234.188) (-237.197) (-235.708) * (-236.613) (-235.913) (-234.172) [-238.647] -- 0:00:40
331500 -- (-235.669) (-234.508) [-235.387] (-238.141) * (-236.395) (-234.070) (-235.124) [-234.950] -- 0:00:40
332000 -- (-234.798) [-234.131] (-235.193) (-238.488) * (-237.490) (-236.061) (-234.589) [-236.688] -- 0:00:40
332500 -- (-237.386) (-235.340) [-235.696] (-235.580) * (-234.674) (-234.165) (-233.516) [-233.732] -- 0:00:40
333000 -- (-235.787) (-235.451) (-237.093) [-235.420] * [-236.404] (-234.072) (-235.185) (-239.781) -- 0:00:40
333500 -- (-237.444) (-234.719) (-234.658) [-234.808] * (-236.335) (-234.291) (-233.487) [-237.226] -- 0:00:39
334000 -- (-235.699) (-235.000) [-235.311] (-233.280) * (-236.031) (-238.077) (-234.559) [-233.610] -- 0:00:39
334500 -- (-233.553) (-238.505) [-233.630] (-235.034) * (-235.502) (-234.578) [-234.274] (-234.615) -- 0:00:39
335000 -- (-234.425) (-235.328) [-233.412] (-235.059) * (-233.404) (-235.322) (-237.352) [-233.782] -- 0:00:39
Average standard deviation of split frequencies: 0.019064
335500 -- (-234.662) (-235.156) (-233.811) [-235.388] * [-233.984] (-236.410) (-234.685) (-234.079) -- 0:00:39
336000 -- (-236.044) (-235.032) [-235.687] (-234.911) * (-234.160) [-236.758] (-236.659) (-239.251) -- 0:00:39
336500 -- (-235.912) (-237.854) [-233.903] (-236.306) * [-233.744] (-233.606) (-238.500) (-235.176) -- 0:00:39
337000 -- [-235.151] (-235.386) (-237.457) (-239.525) * (-234.970) [-235.083] (-238.092) (-237.756) -- 0:00:39
337500 -- (-235.675) (-235.081) [-233.056] (-234.001) * (-237.678) (-235.582) (-235.080) [-235.106] -- 0:00:39
338000 -- (-234.284) (-234.374) [-234.583] (-233.962) * (-240.282) (-234.099) (-235.414) [-236.519] -- 0:00:39
338500 -- [-233.925] (-235.289) (-233.596) (-233.612) * (-235.016) [-234.861] (-233.726) (-239.508) -- 0:00:41
339000 -- (-234.323) (-235.522) [-234.215] (-234.894) * (-236.060) (-235.482) [-235.883] (-236.386) -- 0:00:40
339500 -- (-235.686) (-234.605) [-235.699] (-237.391) * (-235.297) (-235.008) [-233.230] (-236.423) -- 0:00:40
340000 -- (-235.928) (-234.025) (-235.422) [-235.788] * (-235.923) [-237.129] (-235.142) (-234.637) -- 0:00:40
Average standard deviation of split frequencies: 0.019200
340500 -- (-237.134) (-233.832) (-236.786) [-234.858] * (-236.020) (-235.908) [-234.455] (-234.840) -- 0:00:40
341000 -- (-234.860) [-236.568] (-238.799) (-233.794) * (-234.848) (-237.991) (-236.001) [-234.212] -- 0:00:40
341500 -- (-235.629) [-235.836] (-236.907) (-235.085) * (-238.409) (-235.079) (-233.287) [-236.686] -- 0:00:40
342000 -- (-234.401) (-234.280) [-240.316] (-234.324) * (-237.129) (-234.431) [-233.945] (-237.308) -- 0:00:40
342500 -- (-235.742) (-237.732) (-236.571) [-234.106] * (-244.790) [-234.367] (-233.646) (-236.002) -- 0:00:40
343000 -- (-235.537) (-233.247) [-235.080] (-236.285) * (-236.052) [-237.209] (-236.095) (-237.546) -- 0:00:40
343500 -- (-236.441) (-234.433) [-233.797] (-234.914) * (-234.777) (-233.810) (-237.993) [-235.466] -- 0:00:40
344000 -- (-237.142) (-238.151) (-234.233) [-234.514] * (-236.338) (-236.042) [-236.037] (-237.384) -- 0:00:40
344500 -- [-234.318] (-235.795) (-236.196) (-234.487) * [-234.797] (-239.120) (-237.373) (-235.122) -- 0:00:39
345000 -- (-236.761) (-233.076) (-234.692) [-233.672] * [-233.236] (-233.994) (-238.533) (-236.162) -- 0:00:39
Average standard deviation of split frequencies: 0.019226
345500 -- (-239.664) [-233.058] (-233.515) (-233.234) * (-234.131) (-234.269) (-241.691) [-236.119] -- 0:00:39
346000 -- (-239.237) [-234.486] (-235.286) (-236.226) * (-236.731) (-235.577) (-245.213) [-238.591] -- 0:00:39
346500 -- [-234.603] (-236.870) (-236.549) (-236.790) * (-237.253) [-236.007] (-236.817) (-236.119) -- 0:00:39
347000 -- [-235.532] (-234.517) (-233.884) (-237.231) * (-235.606) (-235.322) [-234.379] (-234.278) -- 0:00:39
347500 -- (-234.122) [-237.974] (-233.085) (-235.833) * (-239.296) (-234.061) [-235.590] (-234.446) -- 0:00:39
348000 -- (-233.571) (-237.708) (-234.526) [-234.924] * (-237.890) (-236.413) (-237.884) [-233.671] -- 0:00:39
348500 -- [-239.029] (-235.910) (-236.960) (-240.826) * (-238.907) (-235.999) (-235.628) [-234.110] -- 0:00:39
349000 -- (-233.852) [-236.493] (-233.517) (-236.135) * (-233.430) [-237.446] (-235.037) (-234.259) -- 0:00:39
349500 -- [-234.798] (-236.660) (-234.085) (-242.311) * (-236.999) (-234.820) (-234.692) [-233.693] -- 0:00:39
350000 -- (-242.521) (-234.856) (-233.451) [-235.742] * (-234.109) (-235.741) (-236.467) [-234.969] -- 0:00:39
Average standard deviation of split frequencies: 0.018662
350500 -- (-236.003) (-235.742) (-233.763) [-235.051] * (-235.813) [-236.537] (-233.676) (-234.044) -- 0:00:38
351000 -- [-234.180] (-235.941) (-236.289) (-235.801) * (-239.643) (-236.002) [-235.954] (-237.830) -- 0:00:38
351500 -- (-236.137) (-233.041) (-234.658) [-236.782] * (-236.344) [-233.747] (-234.262) (-239.439) -- 0:00:38
352000 -- (-237.992) [-236.272] (-234.018) (-234.901) * (-234.782) [-233.676] (-235.776) (-237.847) -- 0:00:38
352500 -- [-235.258] (-236.327) (-235.106) (-236.321) * (-236.389) (-236.117) (-234.360) [-236.388] -- 0:00:38
353000 -- (-236.794) [-235.882] (-235.569) (-236.847) * [-233.988] (-236.173) (-233.931) (-234.530) -- 0:00:38
353500 -- [-236.425] (-234.420) (-237.740) (-237.099) * (-234.380) (-237.525) [-236.516] (-235.477) -- 0:00:38
354000 -- [-236.901] (-235.327) (-238.102) (-239.174) * (-237.646) (-236.360) [-234.749] (-236.446) -- 0:00:38
354500 -- [-240.552] (-234.483) (-235.768) (-237.318) * (-233.252) (-234.891) (-235.713) [-234.796] -- 0:00:38
355000 -- [-234.439] (-237.291) (-237.261) (-234.754) * [-234.046] (-235.273) (-235.520) (-237.960) -- 0:00:38
Average standard deviation of split frequencies: 0.018686
355500 -- (-235.164) (-234.480) (-242.882) [-233.141] * (-235.323) (-237.122) [-235.553] (-234.060) -- 0:00:39
356000 -- [-235.051] (-237.707) (-234.171) (-233.741) * (-239.648) (-235.206) [-238.023] (-233.983) -- 0:00:39
356500 -- (-238.573) (-239.635) [-235.528] (-237.810) * (-235.688) [-234.688] (-237.509) (-235.303) -- 0:00:39
357000 -- [-237.105] (-239.357) (-235.367) (-238.464) * (-234.755) (-237.448) [-235.782] (-233.527) -- 0:00:39
357500 -- (-240.164) [-237.141] (-236.716) (-233.226) * [-234.507] (-237.236) (-233.581) (-236.553) -- 0:00:39
358000 -- (-237.540) [-235.132] (-236.209) (-240.906) * (-233.807) (-235.194) [-234.282] (-239.570) -- 0:00:39
358500 -- (-238.945) (-234.507) (-234.646) [-241.608] * (-235.237) (-234.176) (-237.263) [-237.518] -- 0:00:39
359000 -- (-235.939) (-236.189) [-233.646] (-243.526) * (-234.607) (-234.725) [-234.358] (-236.085) -- 0:00:39
359500 -- (-233.774) (-236.858) [-236.128] (-237.364) * (-235.247) [-235.289] (-234.956) (-233.306) -- 0:00:39
360000 -- [-234.866] (-237.140) (-233.568) (-235.658) * (-236.209) [-238.441] (-234.404) (-234.525) -- 0:00:39
Average standard deviation of split frequencies: 0.018879
360500 -- [-236.111] (-240.211) (-236.575) (-234.366) * (-233.521) (-237.757) [-235.296] (-235.320) -- 0:00:39
361000 -- (-234.569) [-236.149] (-235.918) (-233.875) * (-234.438) [-237.812] (-240.444) (-235.878) -- 0:00:38
361500 -- [-234.990] (-233.248) (-233.399) (-234.052) * (-233.592) [-235.785] (-235.287) (-234.815) -- 0:00:38
362000 -- (-235.181) (-235.338) [-234.459] (-234.906) * (-238.063) (-236.409) (-238.625) [-233.502] -- 0:00:38
362500 -- (-237.098) (-235.555) [-239.594] (-238.568) * (-234.250) [-233.857] (-237.547) (-233.387) -- 0:00:38
363000 -- (-238.368) (-234.361) (-237.049) [-236.280] * [-233.646] (-236.359) (-236.493) (-233.926) -- 0:00:38
363500 -- (-235.024) (-234.838) (-240.167) [-239.245] * (-237.302) (-235.879) [-235.795] (-233.866) -- 0:00:38
364000 -- (-238.957) [-239.973] (-234.506) (-239.289) * (-234.926) (-234.244) (-235.369) [-236.476] -- 0:00:38
364500 -- [-234.852] (-233.883) (-234.911) (-233.120) * (-241.574) [-234.110] (-235.873) (-237.455) -- 0:00:38
365000 -- [-234.749] (-240.342) (-233.929) (-233.208) * [-233.443] (-234.381) (-235.337) (-236.596) -- 0:00:38
Average standard deviation of split frequencies: 0.018103
365500 -- [-237.058] (-235.752) (-233.982) (-237.950) * [-234.104] (-238.112) (-239.084) (-238.048) -- 0:00:38
366000 -- (-237.471) (-238.192) [-233.826] (-243.770) * (-236.429) (-234.237) (-233.550) [-236.603] -- 0:00:38
366500 -- [-235.299] (-235.190) (-235.764) (-235.775) * (-235.138) (-234.088) (-235.298) [-235.920] -- 0:00:38
367000 -- (-233.397) [-235.868] (-237.039) (-234.981) * (-234.316) [-238.290] (-238.854) (-236.946) -- 0:00:37
367500 -- (-233.555) (-236.988) [-234.829] (-234.950) * (-235.141) [-240.083] (-234.893) (-235.396) -- 0:00:37
368000 -- (-233.543) (-235.471) (-235.818) [-233.719] * (-236.652) [-237.407] (-237.583) (-233.570) -- 0:00:37
368500 -- [-233.129] (-234.403) (-235.209) (-235.442) * [-236.491] (-237.025) (-234.697) (-242.038) -- 0:00:37
369000 -- (-235.476) (-233.806) (-233.859) [-233.941] * (-234.184) (-235.059) (-234.157) [-237.716] -- 0:00:37
369500 -- (-234.411) (-234.574) (-236.781) [-234.053] * [-235.505] (-238.102) (-234.953) (-234.821) -- 0:00:37
370000 -- (-233.873) [-233.699] (-235.866) (-234.952) * (-236.434) (-238.573) [-233.995] (-234.686) -- 0:00:37
Average standard deviation of split frequencies: 0.019289
370500 -- (-234.342) [-234.795] (-237.534) (-237.857) * (-234.621) (-237.539) [-233.894] (-233.950) -- 0:00:37
371000 -- (-234.492) (-239.587) (-241.008) [-233.028] * (-235.253) [-236.715] (-236.462) (-233.542) -- 0:00:37
371500 -- (-236.219) [-235.433] (-237.112) (-238.747) * (-237.649) (-234.583) [-237.056] (-236.413) -- 0:00:37
372000 -- (-234.386) [-236.598] (-235.406) (-238.272) * [-234.456] (-233.612) (-237.253) (-237.855) -- 0:00:37
372500 -- [-237.364] (-235.507) (-234.698) (-234.997) * [-234.072] (-236.395) (-235.685) (-237.323) -- 0:00:37
373000 -- (-234.501) (-239.578) (-235.909) [-234.441] * (-234.832) (-238.034) [-235.342] (-234.937) -- 0:00:38
373500 -- (-236.693) (-236.662) [-234.039] (-233.946) * [-234.245] (-233.833) (-233.933) (-240.784) -- 0:00:38
374000 -- [-236.105] (-236.410) (-235.780) (-236.773) * (-233.877) [-234.445] (-235.239) (-236.206) -- 0:00:38
374500 -- [-235.069] (-234.869) (-234.496) (-241.598) * (-233.649) (-235.098) [-235.204] (-233.375) -- 0:00:38
375000 -- (-237.741) (-234.344) [-234.480] (-241.930) * [-234.149] (-233.480) (-235.453) (-234.571) -- 0:00:38
Average standard deviation of split frequencies: 0.019015
375500 -- (-235.263) (-234.356) [-236.251] (-237.299) * (-233.849) [-234.938] (-234.659) (-234.153) -- 0:00:38
376000 -- [-233.708] (-236.333) (-236.238) (-235.668) * [-235.347] (-235.316) (-235.323) (-237.252) -- 0:00:38
376500 -- (-235.913) [-239.720] (-235.264) (-235.385) * (-233.970) [-233.538] (-238.564) (-234.800) -- 0:00:38
377000 -- (-235.136) (-237.075) (-235.117) [-234.150] * (-234.482) (-233.579) (-233.707) [-234.550] -- 0:00:38
377500 -- (-236.984) [-234.620] (-233.448) (-234.862) * (-234.129) [-234.885] (-235.148) (-233.844) -- 0:00:37
378000 -- (-238.522) (-237.936) [-235.321] (-236.757) * (-238.511) [-234.019] (-238.743) (-237.251) -- 0:00:37
378500 -- (-238.424) (-236.702) [-237.849] (-234.964) * (-237.218) [-234.154] (-239.472) (-236.316) -- 0:00:37
379000 -- (-238.907) (-235.139) (-238.639) [-235.273] * (-238.214) [-234.786] (-239.325) (-235.139) -- 0:00:37
379500 -- (-235.605) (-237.255) (-239.355) [-234.142] * (-237.215) (-236.614) [-234.738] (-239.910) -- 0:00:37
380000 -- [-235.695] (-236.270) (-237.834) (-239.208) * (-235.161) (-238.358) [-233.878] (-234.075) -- 0:00:37
Average standard deviation of split frequencies: 0.017847
380500 -- [-234.896] (-234.543) (-238.360) (-239.584) * (-235.109) (-234.556) (-234.779) [-233.438] -- 0:00:37
381000 -- [-234.238] (-235.038) (-236.162) (-237.698) * (-234.721) [-236.628] (-233.906) (-233.799) -- 0:00:37
381500 -- [-233.269] (-234.499) (-233.196) (-233.556) * (-234.919) [-235.119] (-234.470) (-237.005) -- 0:00:37
382000 -- (-241.202) (-234.120) (-234.926) [-235.670] * (-236.516) [-235.078] (-233.780) (-238.285) -- 0:00:37
382500 -- (-236.664) [-234.013] (-235.233) (-239.001) * (-234.863) (-234.257) [-234.086] (-237.126) -- 0:00:37
383000 -- (-239.021) (-235.543) (-234.722) [-237.496] * (-235.118) (-236.079) [-233.397] (-235.840) -- 0:00:37
383500 -- (-236.521) (-233.824) (-235.074) [-233.325] * [-236.458] (-233.742) (-234.446) (-236.921) -- 0:00:36
384000 -- (-236.389) [-233.455] (-233.898) (-236.121) * (-236.124) (-235.242) (-233.888) [-235.488] -- 0:00:36
384500 -- (-238.238) (-233.522) [-234.648] (-235.375) * (-237.974) (-238.550) [-237.673] (-236.843) -- 0:00:36
385000 -- (-234.088) [-237.068] (-235.332) (-233.827) * (-234.119) [-237.832] (-234.625) (-239.930) -- 0:00:36
Average standard deviation of split frequencies: 0.017026
385500 -- (-235.367) [-234.619] (-235.433) (-240.760) * [-236.583] (-235.682) (-235.187) (-237.709) -- 0:00:36
386000 -- (-234.279) (-234.358) [-235.961] (-234.531) * (-237.408) (-235.731) [-234.948] (-234.252) -- 0:00:36
386500 -- (-235.323) (-240.745) (-235.228) [-234.108] * (-235.805) (-234.421) (-236.699) [-236.992] -- 0:00:36
387000 -- (-233.482) (-237.914) (-234.087) [-233.509] * [-233.621] (-242.955) (-236.263) (-242.046) -- 0:00:36
387500 -- [-235.169] (-239.759) (-234.388) (-233.449) * (-234.154) (-238.961) (-235.906) [-236.526] -- 0:00:36
388000 -- (-235.829) (-235.589) [-234.631] (-234.408) * (-236.904) (-236.049) (-238.256) [-236.847] -- 0:00:36
388500 -- [-234.962] (-237.151) (-234.725) (-239.071) * (-234.972) (-235.255) [-235.113] (-235.291) -- 0:00:36
389000 -- (-234.095) (-234.206) (-233.564) [-236.625] * [-234.177] (-234.457) (-234.964) (-239.961) -- 0:00:36
389500 -- (-235.324) (-236.417) [-233.769] (-234.005) * (-234.222) (-237.786) (-235.096) [-234.388] -- 0:00:36
390000 -- (-234.178) (-235.004) (-233.905) [-236.640] * (-235.303) (-238.230) [-236.120] (-238.606) -- 0:00:37
Average standard deviation of split frequencies: 0.016290
390500 -- (-236.683) [-234.330] (-234.703) (-234.486) * [-235.805] (-235.349) (-234.335) (-236.523) -- 0:00:37
391000 -- (-235.792) (-234.527) (-234.187) [-235.398] * (-237.055) [-233.680] (-236.363) (-235.063) -- 0:00:37
391500 -- (-238.288) (-237.081) (-234.483) [-235.040] * (-234.414) (-237.267) [-233.901] (-235.206) -- 0:00:37
392000 -- (-235.746) (-236.362) (-237.312) [-238.045] * (-237.765) (-235.126) [-235.040] (-234.263) -- 0:00:37
392500 -- (-235.108) [-236.847] (-234.317) (-235.783) * [-233.352] (-237.848) (-235.125) (-233.440) -- 0:00:37
393000 -- (-235.824) [-233.490] (-235.655) (-235.291) * (-233.554) [-234.919] (-237.522) (-235.303) -- 0:00:37
393500 -- (-236.794) (-235.029) (-240.229) [-235.027] * [-234.197] (-233.584) (-233.771) (-234.228) -- 0:00:36
394000 -- (-233.024) (-235.516) (-237.275) [-238.200] * (-234.183) (-235.198) (-234.501) [-234.950] -- 0:00:36
394500 -- (-234.145) [-235.432] (-238.405) (-236.100) * (-234.122) (-235.132) [-233.444] (-235.737) -- 0:00:36
395000 -- (-233.266) (-234.425) [-235.573] (-234.098) * (-237.535) [-233.372] (-235.791) (-237.213) -- 0:00:36
Average standard deviation of split frequencies: 0.015896
395500 -- (-234.608) (-236.941) (-236.688) [-234.210] * (-234.423) (-234.133) (-233.346) [-234.071] -- 0:00:36
396000 -- [-233.666] (-235.179) (-235.269) (-237.739) * (-234.147) (-233.369) [-234.724] (-236.169) -- 0:00:36
396500 -- (-233.055) [-236.078] (-234.954) (-234.593) * (-235.675) (-233.523) (-235.925) [-236.266] -- 0:00:36
397000 -- [-235.263] (-234.566) (-233.843) (-233.505) * (-233.483) (-235.306) [-238.743] (-240.368) -- 0:00:36
397500 -- [-235.529] (-234.187) (-238.745) (-235.696) * (-237.759) [-235.405] (-236.117) (-234.149) -- 0:00:36
398000 -- [-236.098] (-237.986) (-237.001) (-234.629) * [-235.456] (-237.525) (-234.944) (-234.713) -- 0:00:36
398500 -- (-237.376) [-236.539] (-234.288) (-234.959) * [-235.591] (-237.197) (-236.469) (-234.328) -- 0:00:36
399000 -- (-235.628) (-234.632) (-234.175) [-235.916] * [-237.838] (-234.968) (-233.579) (-233.960) -- 0:00:36
399500 -- (-237.130) (-234.154) (-234.846) [-233.797] * (-238.059) (-234.830) (-234.274) [-233.750] -- 0:00:36
400000 -- (-235.368) [-233.932] (-234.903) (-233.917) * (-248.206) [-234.421] (-239.474) (-235.633) -- 0:00:36
Average standard deviation of split frequencies: 0.015157
400500 -- (-236.649) (-235.306) (-233.866) [-236.343] * (-240.771) (-234.581) (-234.136) [-234.600] -- 0:00:35
401000 -- [-235.868] (-235.851) (-236.688) (-239.997) * [-236.446] (-236.172) (-235.417) (-234.153) -- 0:00:35
401500 -- [-233.629] (-235.908) (-235.935) (-234.149) * [-234.749] (-234.028) (-233.583) (-234.857) -- 0:00:35
402000 -- (-233.441) [-234.754] (-235.088) (-234.646) * [-238.214] (-238.287) (-236.474) (-233.545) -- 0:00:35
402500 -- [-234.441] (-234.092) (-237.824) (-238.572) * (-236.647) (-235.737) [-235.187] (-238.193) -- 0:00:35
403000 -- [-233.095] (-234.682) (-236.338) (-236.096) * [-234.049] (-233.753) (-236.135) (-235.022) -- 0:00:35
403500 -- (-236.993) [-235.878] (-237.374) (-233.936) * (-234.622) [-234.290] (-237.002) (-234.415) -- 0:00:35
404000 -- [-234.465] (-235.675) (-233.575) (-234.032) * (-237.272) [-235.901] (-235.889) (-234.249) -- 0:00:35
404500 -- (-240.270) (-235.764) [-237.052] (-234.451) * (-236.467) [-235.169] (-235.890) (-233.363) -- 0:00:35
405000 -- (-234.567) [-236.446] (-236.044) (-234.966) * [-233.429] (-235.501) (-234.368) (-234.083) -- 0:00:35
Average standard deviation of split frequencies: 0.015352
405500 -- (-238.454) (-236.842) (-236.085) [-233.852] * (-232.983) [-235.709] (-233.878) (-233.756) -- 0:00:35
406000 -- (-235.704) (-235.971) [-235.648] (-236.370) * (-238.176) [-238.387] (-234.633) (-236.967) -- 0:00:35
406500 -- (-234.232) (-235.684) (-237.215) [-233.884] * (-235.399) (-240.316) [-236.754] (-235.923) -- 0:00:35
407000 -- (-235.835) (-234.174) (-236.965) [-236.010] * [-237.169] (-235.324) (-237.504) (-239.125) -- 0:00:36
407500 -- [-235.978] (-234.436) (-237.515) (-235.749) * [-234.749] (-235.736) (-234.025) (-236.295) -- 0:00:36
408000 -- [-239.626] (-238.416) (-233.711) (-234.809) * (-234.662) (-233.420) [-233.814] (-235.399) -- 0:00:36
408500 -- (-239.277) (-236.657) (-236.155) [-234.977] * (-235.363) (-237.421) (-235.038) [-234.641] -- 0:00:36
409000 -- (-234.890) (-235.058) [-235.485] (-233.566) * (-240.922) (-234.319) [-234.767] (-236.691) -- 0:00:36
409500 -- (-236.416) [-236.388] (-235.664) (-234.483) * (-236.055) (-236.650) (-235.693) [-236.752] -- 0:00:36
410000 -- (-233.527) [-235.047] (-234.715) (-234.764) * (-235.218) (-235.428) (-234.326) [-235.283] -- 0:00:35
Average standard deviation of split frequencies: 0.014923
410500 -- (-233.184) (-235.051) (-236.066) [-234.591] * (-235.559) [-234.172] (-235.433) (-233.518) -- 0:00:35
411000 -- [-235.944] (-240.217) (-238.202) (-236.306) * (-234.787) [-233.969] (-233.410) (-236.004) -- 0:00:35
411500 -- (-233.116) (-233.813) [-235.247] (-237.622) * (-235.651) (-233.489) (-233.158) [-233.638] -- 0:00:35
412000 -- (-236.828) (-240.449) (-233.882) [-234.898] * (-235.743) (-238.635) (-236.163) [-234.248] -- 0:00:35
412500 -- (-236.662) [-239.653] (-234.429) (-236.322) * [-234.543] (-235.614) (-234.678) (-236.484) -- 0:00:35
413000 -- (-239.449) (-239.909) (-235.936) [-233.720] * (-236.746) [-235.832] (-235.905) (-236.623) -- 0:00:35
413500 -- (-238.248) (-235.542) (-236.473) [-234.110] * [-236.177] (-235.191) (-233.191) (-233.949) -- 0:00:35
414000 -- (-234.995) [-234.112] (-238.259) (-235.011) * (-235.487) (-233.594) [-234.795] (-233.721) -- 0:00:35
414500 -- (-244.600) (-235.644) (-237.793) [-235.106] * [-234.314] (-234.012) (-236.390) (-233.985) -- 0:00:35
415000 -- (-235.153) (-238.902) (-237.010) [-234.529] * (-236.154) (-235.624) (-234.409) [-234.195] -- 0:00:35
Average standard deviation of split frequencies: 0.014731
415500 -- [-234.427] (-235.263) (-234.059) (-234.710) * (-235.176) (-235.384) (-237.365) [-235.251] -- 0:00:35
416000 -- [-235.406] (-234.044) (-234.030) (-235.146) * (-237.676) [-236.027] (-239.582) (-237.771) -- 0:00:35
416500 -- (-234.047) (-236.397) [-234.946] (-239.941) * [-234.987] (-235.796) (-236.849) (-235.680) -- 0:00:35
417000 -- (-235.157) (-239.252) [-235.222] (-236.754) * (-233.745) (-235.946) (-234.136) [-235.742] -- 0:00:34
417500 -- (-236.953) (-234.229) (-237.114) [-236.728] * (-233.070) (-237.482) [-236.223] (-235.681) -- 0:00:34
418000 -- (-233.469) (-238.150) (-238.493) [-234.267] * [-233.330] (-236.167) (-234.912) (-235.974) -- 0:00:34
418500 -- [-234.245] (-235.455) (-237.153) (-235.888) * [-234.113] (-239.244) (-235.923) (-234.605) -- 0:00:34
419000 -- (-237.019) (-233.451) [-235.479] (-238.153) * (-234.752) (-239.115) [-233.413] (-236.050) -- 0:00:34
419500 -- [-235.482] (-235.172) (-234.119) (-233.766) * (-233.769) (-236.779) (-234.092) [-233.851] -- 0:00:34
420000 -- (-234.742) (-233.543) [-233.848] (-236.530) * (-242.480) (-235.494) [-234.023] (-234.521) -- 0:00:34
Average standard deviation of split frequencies: 0.013645
420500 -- [-237.859] (-234.190) (-234.561) (-235.953) * (-236.707) [-236.576] (-236.467) (-237.365) -- 0:00:34
421000 -- (-239.822) (-234.486) [-236.039] (-237.095) * (-236.241) (-239.666) (-235.430) [-235.354] -- 0:00:34
421500 -- (-233.835) [-234.902] (-234.413) (-240.881) * (-235.453) (-235.824) [-235.016] (-234.855) -- 0:00:34
422000 -- [-234.187] (-235.470) (-233.706) (-241.284) * (-235.031) [-234.331] (-234.373) (-237.325) -- 0:00:34
422500 -- (-236.211) [-235.463] (-233.913) (-235.817) * (-238.915) [-235.733] (-234.113) (-240.286) -- 0:00:34
423000 -- (-234.345) [-238.170] (-237.158) (-235.620) * [-234.833] (-238.032) (-234.314) (-236.049) -- 0:00:34
423500 -- (-236.637) (-236.300) (-234.680) [-236.531] * (-234.614) (-236.551) [-233.601] (-237.085) -- 0:00:34
424000 -- [-235.330] (-234.318) (-241.359) (-237.998) * (-233.626) (-234.892) (-233.202) [-233.890] -- 0:00:35
424500 -- [-235.828] (-239.124) (-236.955) (-235.299) * (-234.658) (-235.511) [-235.516] (-233.629) -- 0:00:35
425000 -- (-238.165) (-234.924) [-234.817] (-235.196) * [-235.538] (-233.562) (-233.790) (-237.000) -- 0:00:35
Average standard deviation of split frequencies: 0.013771
425500 -- (-234.700) [-237.633] (-235.486) (-235.077) * (-233.634) [-234.233] (-234.586) (-236.928) -- 0:00:35
426000 -- [-234.192] (-236.163) (-233.539) (-235.732) * (-236.042) (-234.149) [-233.305] (-238.755) -- 0:00:35
426500 -- (-236.575) [-237.762] (-234.288) (-240.082) * [-235.201] (-234.754) (-235.258) (-233.848) -- 0:00:34
427000 -- [-234.954] (-235.349) (-237.886) (-235.128) * [-234.201] (-233.227) (-233.684) (-236.015) -- 0:00:34
427500 -- (-236.054) [-235.160] (-234.091) (-236.023) * (-236.535) (-233.604) (-234.682) [-234.114] -- 0:00:34
428000 -- [-242.275] (-233.811) (-234.540) (-236.205) * (-236.368) (-234.218) [-235.483] (-233.777) -- 0:00:34
428500 -- (-237.065) (-233.733) [-236.571] (-235.461) * [-235.718] (-234.516) (-240.310) (-234.721) -- 0:00:34
429000 -- (-234.908) (-235.424) (-237.255) [-234.388] * [-235.353] (-234.278) (-234.401) (-234.161) -- 0:00:34
429500 -- [-237.329] (-234.992) (-237.698) (-240.696) * [-241.754] (-236.738) (-235.284) (-234.731) -- 0:00:34
430000 -- [-233.340] (-233.950) (-238.985) (-239.808) * (-234.564) [-235.724] (-233.425) (-234.463) -- 0:00:34
Average standard deviation of split frequencies: 0.013378
430500 -- [-233.876] (-237.438) (-239.340) (-237.210) * (-235.811) (-239.911) (-233.637) [-234.109] -- 0:00:34
431000 -- (-234.088) [-236.323] (-234.376) (-234.751) * [-235.418] (-236.112) (-234.725) (-234.565) -- 0:00:34
431500 -- (-234.742) (-235.184) [-233.832] (-235.391) * (-236.116) [-234.795] (-236.912) (-235.216) -- 0:00:34
432000 -- [-234.471] (-233.611) (-233.197) (-234.763) * [-234.507] (-235.567) (-235.881) (-235.426) -- 0:00:34
432500 -- (-236.606) (-233.418) [-236.484] (-236.050) * (-237.052) (-234.217) [-237.378] (-236.121) -- 0:00:34
433000 -- (-233.622) [-234.419] (-236.012) (-233.450) * (-236.757) (-234.675) [-234.856] (-234.440) -- 0:00:34
433500 -- [-234.140] (-240.513) (-235.947) (-236.157) * (-237.187) (-234.558) (-234.101) [-235.417] -- 0:00:33
434000 -- (-234.534) (-240.775) [-234.297] (-237.453) * (-237.348) (-236.284) (-238.592) [-237.590] -- 0:00:33
434500 -- [-234.487] (-238.792) (-239.270) (-234.342) * (-236.772) (-236.241) (-234.708) [-234.456] -- 0:00:33
435000 -- (-234.437) [-235.434] (-235.378) (-234.380) * (-234.393) (-236.239) (-238.681) [-236.477] -- 0:00:33
Average standard deviation of split frequencies: 0.013335
435500 -- (-236.990) (-237.277) (-237.425) [-234.584] * (-237.330) (-234.587) [-235.662] (-234.057) -- 0:00:33
436000 -- [-234.090] (-237.952) (-234.419) (-239.845) * (-238.897) (-235.947) [-234.957] (-238.329) -- 0:00:33
436500 -- (-234.472) [-234.477] (-238.504) (-237.954) * (-234.172) (-234.513) [-237.197] (-238.072) -- 0:00:33
437000 -- (-234.878) [-235.842] (-237.755) (-238.260) * [-234.054] (-234.448) (-233.639) (-239.090) -- 0:00:33
437500 -- (-237.119) (-235.743) (-235.696) [-234.234] * [-237.693] (-236.232) (-234.938) (-234.862) -- 0:00:33
438000 -- (-234.966) (-233.864) [-234.449] (-233.318) * [-235.840] (-236.611) (-233.262) (-235.561) -- 0:00:33
438500 -- (-237.975) (-234.761) [-235.071] (-234.213) * (-233.680) [-237.718] (-233.028) (-241.680) -- 0:00:33
439000 -- (-234.198) (-237.297) (-235.647) [-235.488] * [-235.305] (-237.692) (-236.711) (-234.113) -- 0:00:33
439500 -- [-234.083] (-239.791) (-234.886) (-233.478) * (-239.084) (-236.680) [-234.433] (-236.077) -- 0:00:33
440000 -- (-234.768) (-239.917) [-234.515] (-235.404) * [-233.631] (-235.338) (-236.184) (-237.078) -- 0:00:33
Average standard deviation of split frequencies: 0.013152
440500 -- (-234.422) [-241.565] (-238.824) (-236.515) * (-236.518) (-235.154) [-234.593] (-235.441) -- 0:00:34
441000 -- (-235.451) (-242.362) (-239.033) [-236.006] * (-236.015) (-234.971) [-234.594] (-233.937) -- 0:00:34
441500 -- (-235.077) (-235.033) [-236.385] (-237.370) * [-233.811] (-234.286) (-236.298) (-235.497) -- 0:00:34
442000 -- [-235.771] (-234.971) (-235.736) (-236.335) * (-233.464) (-237.874) (-238.726) [-234.671] -- 0:00:34
442500 -- [-234.776] (-233.895) (-238.010) (-237.345) * (-238.074) (-234.099) [-233.642] (-239.078) -- 0:00:34
443000 -- (-235.000) [-233.840] (-233.894) (-237.808) * (-235.784) (-235.200) [-234.259] (-238.491) -- 0:00:33
443500 -- [-234.422] (-235.255) (-237.244) (-237.928) * [-233.843] (-237.338) (-233.892) (-233.945) -- 0:00:33
444000 -- (-233.618) (-234.748) (-235.718) [-237.541] * [-233.209] (-234.631) (-233.009) (-239.558) -- 0:00:33
444500 -- [-235.734] (-235.166) (-237.839) (-234.814) * (-233.253) (-235.843) (-234.023) [-235.691] -- 0:00:33
445000 -- (-235.544) (-233.483) (-235.998) [-235.554] * (-237.289) (-237.601) (-238.211) [-234.173] -- 0:00:33
Average standard deviation of split frequencies: 0.013623
445500 -- (-234.793) [-234.055] (-234.722) (-236.515) * (-233.591) (-234.970) [-236.012] (-237.317) -- 0:00:33
446000 -- (-237.910) [-236.112] (-234.942) (-238.323) * (-237.826) [-238.839] (-235.439) (-236.178) -- 0:00:33
446500 -- (-235.353) (-236.359) (-234.529) [-234.770] * (-238.113) (-233.756) [-233.946] (-236.090) -- 0:00:33
447000 -- [-235.597] (-235.429) (-237.895) (-236.495) * (-237.263) [-235.655] (-237.777) (-237.204) -- 0:00:33
447500 -- (-234.573) [-234.240] (-234.235) (-235.364) * [-234.970] (-235.284) (-235.442) (-238.888) -- 0:00:33
448000 -- (-233.818) (-236.442) (-234.612) [-235.013] * (-234.045) [-233.912] (-235.195) (-237.211) -- 0:00:33
448500 -- (-235.271) (-233.379) (-237.229) [-235.203] * [-234.793] (-236.909) (-234.368) (-241.360) -- 0:00:33
449000 -- (-234.977) (-236.449) (-233.956) [-234.127] * (-236.088) (-235.585) (-238.209) [-238.458] -- 0:00:33
449500 -- [-234.701] (-236.782) (-235.532) (-234.612) * (-235.462) (-240.016) [-232.929] (-238.438) -- 0:00:33
450000 -- (-233.620) (-233.642) (-234.864) [-240.024] * (-234.380) (-235.148) [-238.792] (-236.187) -- 0:00:33
Average standard deviation of split frequencies: 0.014179
450500 -- [-233.337] (-233.561) (-235.074) (-238.663) * (-236.881) (-235.426) [-235.473] (-234.854) -- 0:00:32
451000 -- (-234.204) [-233.469] (-236.787) (-236.980) * (-234.708) (-235.038) (-236.732) [-233.724] -- 0:00:32
451500 -- (-234.754) (-237.225) [-233.061] (-237.189) * (-234.426) [-234.112] (-237.837) (-236.025) -- 0:00:32
452000 -- (-239.473) (-234.174) [-234.970] (-234.832) * (-235.400) [-235.538] (-238.859) (-235.109) -- 0:00:32
452500 -- (-234.737) (-237.510) (-233.676) [-237.865] * (-237.501) (-235.552) [-239.650] (-234.861) -- 0:00:32
453000 -- (-233.475) (-233.584) (-234.586) [-233.233] * (-236.555) [-234.708] (-235.791) (-234.831) -- 0:00:32
453500 -- [-233.309] (-238.548) (-234.399) (-235.273) * (-238.122) (-234.164) [-234.779] (-238.285) -- 0:00:32
454000 -- [-234.452] (-236.229) (-234.764) (-233.834) * (-239.256) (-234.080) [-234.230] (-235.232) -- 0:00:32
454500 -- [-235.076] (-237.358) (-237.050) (-235.683) * [-234.209] (-233.737) (-237.250) (-236.136) -- 0:00:32
455000 -- (-234.944) (-235.015) [-235.033] (-235.633) * (-234.044) [-236.876] (-233.234) (-237.291) -- 0:00:32
Average standard deviation of split frequencies: 0.014186
455500 -- (-235.708) [-235.405] (-233.305) (-235.063) * (-234.718) (-233.767) (-233.905) [-236.577] -- 0:00:32
456000 -- (-234.118) [-239.309] (-235.696) (-234.949) * (-237.881) (-233.393) (-237.776) [-236.394] -- 0:00:32
456500 -- [-234.740] (-235.588) (-232.968) (-233.985) * [-239.428] (-233.022) (-234.443) (-234.806) -- 0:00:32
457000 -- (-235.445) (-237.092) [-234.912] (-235.383) * (-237.650) (-233.515) (-236.700) [-234.817] -- 0:00:32
457500 -- (-235.390) (-238.715) (-234.435) [-237.246] * (-236.451) (-236.247) [-236.210] (-236.189) -- 0:00:33
458000 -- (-234.942) (-235.295) (-233.116) [-233.883] * [-235.341] (-235.655) (-233.527) (-242.313) -- 0:00:33
458500 -- [-235.121] (-239.954) (-233.036) (-234.941) * [-236.677] (-238.579) (-236.269) (-234.627) -- 0:00:33
459000 -- (-234.591) [-237.336] (-233.888) (-234.877) * (-233.127) (-237.295) (-233.726) [-235.766] -- 0:00:33
459500 -- (-236.226) [-234.335] (-234.628) (-235.934) * [-234.059] (-235.507) (-235.063) (-233.766) -- 0:00:32
460000 -- (-236.436) (-234.954) (-235.413) [-235.489] * (-238.925) [-235.886] (-237.475) (-237.598) -- 0:00:32
Average standard deviation of split frequencies: 0.014213
460500 -- (-237.663) (-235.471) [-236.340] (-238.282) * (-236.805) (-236.866) [-238.865] (-237.128) -- 0:00:32
461000 -- (-234.761) (-236.950) [-236.961] (-239.406) * (-237.241) (-235.342) (-237.792) [-235.880] -- 0:00:32
461500 -- (-237.516) (-235.731) (-236.475) [-235.411] * [-235.750] (-234.882) (-236.811) (-239.883) -- 0:00:32
462000 -- (-234.922) (-237.990) [-236.262] (-238.160) * (-236.438) (-240.702) (-235.280) [-234.164] -- 0:00:32
462500 -- (-236.776) (-235.650) (-236.992) [-236.729] * [-234.670] (-235.057) (-235.131) (-234.762) -- 0:00:32
463000 -- (-234.284) (-234.812) [-233.446] (-234.940) * (-234.379) (-236.902) (-234.561) [-236.067] -- 0:00:32
463500 -- [-238.853] (-234.552) (-237.430) (-234.298) * (-233.399) (-235.624) [-235.084] (-234.397) -- 0:00:32
464000 -- (-234.099) [-236.273] (-237.038) (-235.685) * (-234.047) [-240.130] (-234.936) (-236.546) -- 0:00:32
464500 -- (-236.204) (-235.636) (-236.111) [-238.945] * (-236.108) (-237.056) [-236.610] (-234.399) -- 0:00:32
465000 -- (-234.030) (-237.516) (-237.491) [-234.716] * (-235.818) (-233.764) [-235.285] (-235.986) -- 0:00:32
Average standard deviation of split frequencies: 0.014612
465500 -- [-238.504] (-236.871) (-235.832) (-237.071) * [-235.849] (-233.940) (-235.748) (-234.047) -- 0:00:32
466000 -- [-235.670] (-237.276) (-238.846) (-236.794) * (-236.713) (-233.594) (-236.477) [-233.495] -- 0:00:32
466500 -- (-235.584) (-235.657) [-237.537] (-240.252) * (-241.375) (-234.255) [-233.592] (-233.772) -- 0:00:32
467000 -- (-234.783) [-234.233] (-233.957) (-234.791) * (-237.112) (-234.218) [-234.989] (-235.214) -- 0:00:31
467500 -- (-234.315) (-233.996) (-234.572) [-234.089] * [-235.030] (-235.985) (-234.965) (-239.809) -- 0:00:31
468000 -- (-233.721) (-236.363) (-236.214) [-233.368] * (-235.874) [-234.063] (-236.865) (-233.884) -- 0:00:31
468500 -- (-238.318) (-235.450) [-233.408] (-233.543) * (-234.712) [-233.522] (-238.369) (-235.139) -- 0:00:31
469000 -- [-234.881] (-237.637) (-233.165) (-234.574) * [-234.678] (-235.178) (-234.196) (-237.944) -- 0:00:31
469500 -- (-233.464) (-234.729) (-233.272) [-238.843] * [-234.789] (-234.528) (-237.867) (-240.145) -- 0:00:31
470000 -- [-234.480] (-235.894) (-235.759) (-235.518) * [-235.345] (-233.370) (-235.692) (-233.446) -- 0:00:31
Average standard deviation of split frequencies: 0.015135
470500 -- (-242.825) (-234.466) [-237.723] (-234.862) * (-236.940) (-233.311) [-234.828] (-235.151) -- 0:00:31
471000 -- (-237.170) (-236.830) [-240.508] (-233.940) * (-236.176) (-233.520) (-241.937) [-235.207] -- 0:00:31
471500 -- (-236.067) (-236.776) (-235.530) [-234.742] * (-235.100) [-233.263] (-234.934) (-235.193) -- 0:00:31
472000 -- [-237.839] (-234.802) (-235.388) (-235.298) * (-234.472) (-238.919) (-236.154) [-237.839] -- 0:00:31
472500 -- (-233.252) [-236.031] (-237.315) (-234.238) * (-233.645) (-233.910) [-234.317] (-237.315) -- 0:00:31
473000 -- (-234.030) [-237.918] (-235.842) (-236.009) * (-233.537) (-234.911) (-237.130) [-235.823] -- 0:00:31
473500 -- (-235.084) (-233.380) (-235.138) [-234.727] * [-233.556] (-236.093) (-236.834) (-235.314) -- 0:00:31
474000 -- (-236.668) (-234.451) [-234.465] (-234.846) * (-234.069) (-238.773) (-237.996) [-235.266] -- 0:00:31
474500 -- (-234.069) (-237.180) [-235.541] (-234.358) * (-235.458) (-239.674) [-236.657] (-235.120) -- 0:00:32
475000 -- (-234.190) (-236.429) [-235.238] (-233.905) * [-233.476] (-235.831) (-238.852) (-234.805) -- 0:00:32
Average standard deviation of split frequencies: 0.015350
475500 -- (-235.600) (-233.567) [-234.143] (-235.360) * (-233.915) [-236.365] (-235.047) (-236.894) -- 0:00:31
476000 -- (-234.655) [-235.878] (-234.198) (-241.708) * (-233.876) (-234.083) [-233.744] (-234.216) -- 0:00:31
476500 -- (-233.542) (-236.940) [-233.787] (-241.678) * (-239.300) (-237.628) (-234.696) [-234.175] -- 0:00:31
477000 -- (-243.049) [-233.856] (-248.915) (-233.289) * (-239.576) (-235.952) (-234.281) [-236.250] -- 0:00:31
477500 -- (-235.354) (-235.981) (-234.022) [-234.830] * (-238.099) [-235.031] (-233.458) (-235.616) -- 0:00:31
478000 -- (-237.537) [-235.787] (-233.147) (-235.079) * (-234.006) (-234.303) (-233.783) [-235.542] -- 0:00:31
478500 -- (-237.599) [-235.172] (-234.084) (-236.301) * (-237.318) (-235.881) (-233.977) [-235.601] -- 0:00:31
479000 -- (-238.477) (-233.723) [-234.672] (-235.741) * (-233.902) (-234.962) [-234.412] (-234.074) -- 0:00:31
479500 -- (-243.762) (-235.547) (-233.278) [-237.288] * (-237.836) (-237.329) [-234.592] (-234.631) -- 0:00:31
480000 -- (-236.435) [-235.358] (-233.607) (-238.421) * [-239.621] (-237.816) (-234.211) (-234.285) -- 0:00:31
Average standard deviation of split frequencies: 0.015637
480500 -- (-238.467) [-234.218] (-235.077) (-235.749) * (-240.187) (-235.993) (-234.444) [-236.101] -- 0:00:31
481000 -- (-237.361) [-234.640] (-237.464) (-235.454) * (-233.814) [-235.279] (-238.980) (-237.523) -- 0:00:31
481500 -- (-237.042) (-237.667) [-233.442] (-235.542) * [-234.809] (-237.125) (-234.342) (-236.322) -- 0:00:31
482000 -- (-237.519) [-234.088] (-234.656) (-236.407) * (-235.160) [-234.998] (-235.081) (-235.884) -- 0:00:31
482500 -- (-235.209) [-234.634] (-234.898) (-233.240) * (-235.888) (-234.576) (-238.814) [-236.942] -- 0:00:31
483000 -- (-236.560) (-237.337) [-234.032] (-235.211) * [-233.667] (-235.617) (-236.036) (-233.575) -- 0:00:31
483500 -- (-236.942) (-237.146) (-234.640) [-234.539] * (-235.191) (-234.127) (-235.054) [-236.931] -- 0:00:30
484000 -- (-236.057) (-236.860) [-233.517] (-234.999) * (-233.282) (-234.372) (-238.593) [-234.749] -- 0:00:30
484500 -- (-236.821) (-234.642) (-233.756) [-234.547] * (-235.114) (-237.176) [-242.392] (-233.526) -- 0:00:30
485000 -- (-234.992) (-235.625) [-233.903] (-234.072) * (-232.997) [-235.621] (-238.062) (-233.997) -- 0:00:30
Average standard deviation of split frequencies: 0.016541
485500 -- (-234.521) (-235.359) (-236.952) [-233.467] * (-237.995) [-236.718] (-237.787) (-233.723) -- 0:00:30
486000 -- (-235.879) [-235.562] (-236.736) (-237.647) * [-234.479] (-237.986) (-235.906) (-234.568) -- 0:00:30
486500 -- (-237.426) (-234.102) [-234.175] (-233.770) * [-234.980] (-235.982) (-238.755) (-234.191) -- 0:00:30
487000 -- (-233.634) [-235.561] (-238.760) (-235.925) * (-235.894) (-236.115) [-233.656] (-234.955) -- 0:00:30
487500 -- (-233.809) (-233.112) (-235.494) [-236.599] * [-235.786] (-238.031) (-236.540) (-234.510) -- 0:00:30
488000 -- (-236.290) (-234.374) (-234.176) [-237.346] * (-236.940) [-236.763] (-234.626) (-236.558) -- 0:00:30
488500 -- (-234.954) [-234.338] (-236.630) (-234.407) * (-234.206) [-235.355] (-233.955) (-235.461) -- 0:00:30
489000 -- (-234.940) (-234.878) [-234.561] (-235.302) * (-233.655) (-239.970) (-235.064) [-236.173] -- 0:00:30
489500 -- (-235.962) [-234.391] (-239.035) (-233.412) * (-236.540) (-238.170) [-237.341] (-238.084) -- 0:00:30
490000 -- [-234.718] (-235.356) (-238.385) (-233.542) * (-234.698) (-235.934) (-236.112) [-239.499] -- 0:00:30
Average standard deviation of split frequencies: 0.016066
490500 -- (-235.775) (-236.586) [-235.158] (-235.731) * (-234.253) [-235.678] (-234.197) (-236.180) -- 0:00:30
491000 -- [-233.999] (-235.789) (-235.001) (-236.148) * (-235.763) [-236.046] (-236.610) (-236.291) -- 0:00:30
491500 -- (-234.118) [-235.031] (-234.727) (-237.250) * (-240.496) (-235.826) [-235.154] (-235.195) -- 0:00:31
492000 -- (-234.100) [-233.381] (-234.833) (-236.026) * (-235.151) [-235.772] (-234.840) (-237.229) -- 0:00:30
492500 -- (-234.695) [-234.488] (-235.765) (-233.765) * [-234.450] (-235.689) (-235.750) (-236.116) -- 0:00:30
493000 -- [-234.946] (-234.914) (-236.305) (-233.883) * (-233.191) (-238.641) (-234.586) [-235.778] -- 0:00:30
493500 -- (-236.172) (-234.689) [-233.656] (-235.130) * [-234.316] (-234.042) (-236.162) (-235.000) -- 0:00:30
494000 -- (-237.368) (-234.790) (-235.568) [-234.111] * (-233.900) (-237.829) (-234.481) [-236.925] -- 0:00:30
494500 -- (-239.536) [-234.071] (-235.729) (-235.010) * [-234.691] (-235.677) (-238.531) (-233.755) -- 0:00:30
495000 -- (-239.415) (-232.953) [-235.485] (-239.266) * (-233.733) [-234.132] (-234.476) (-239.573) -- 0:00:30
Average standard deviation of split frequencies: 0.015365
495500 -- (-239.436) [-233.474] (-238.183) (-236.332) * (-238.368) (-241.273) [-237.237] (-237.733) -- 0:00:30
496000 -- (-237.007) (-235.030) [-236.172] (-235.873) * (-237.681) (-240.050) (-241.585) [-234.797] -- 0:00:30
496500 -- (-242.691) (-234.487) [-235.980] (-233.680) * (-235.623) (-239.100) [-233.446] (-236.352) -- 0:00:30
497000 -- (-235.455) (-235.206) (-238.666) [-234.849] * [-238.031] (-237.955) (-233.363) (-236.023) -- 0:00:30
497500 -- (-234.981) (-235.780) [-234.877] (-235.359) * (-236.366) [-235.487] (-237.279) (-235.012) -- 0:00:30
498000 -- (-233.948) (-235.034) (-236.457) [-233.128] * [-235.188] (-238.218) (-234.465) (-234.667) -- 0:00:30
498500 -- (-238.122) (-239.890) [-236.007] (-234.028) * (-234.977) (-233.709) [-235.982] (-235.630) -- 0:00:30
499000 -- [-235.812] (-236.193) (-233.329) (-234.000) * [-234.151] (-234.705) (-235.432) (-236.874) -- 0:00:30
499500 -- [-240.334] (-235.835) (-235.560) (-235.055) * [-233.614] (-235.213) (-234.558) (-234.588) -- 0:00:30
500000 -- [-236.651] (-241.250) (-241.031) (-234.986) * (-233.551) (-234.769) (-240.988) [-236.408] -- 0:00:30
Average standard deviation of split frequencies: 0.014960
500500 -- [-233.428] (-234.907) (-237.818) (-235.990) * (-236.262) (-234.896) (-236.392) [-237.441] -- 0:00:29
501000 -- [-234.510] (-234.016) (-237.942) (-236.530) * (-234.441) [-236.435] (-236.855) (-235.615) -- 0:00:29
501500 -- (-234.321) (-234.253) (-236.497) [-235.763] * [-238.725] (-233.932) (-233.359) (-236.069) -- 0:00:29
502000 -- (-234.290) (-233.981) [-238.055] (-235.530) * (-234.271) (-237.040) [-235.451] (-236.316) -- 0:00:29
502500 -- (-236.644) [-233.995] (-239.738) (-235.418) * [-233.691] (-239.719) (-234.414) (-234.856) -- 0:00:29
503000 -- (-234.777) (-233.692) [-235.924] (-233.647) * (-234.589) (-234.832) (-237.435) [-234.600] -- 0:00:29
503500 -- (-237.002) (-235.464) (-235.740) [-238.958] * (-234.354) (-234.222) [-240.257] (-235.872) -- 0:00:29
504000 -- (-233.628) (-236.245) [-233.657] (-234.637) * (-234.990) [-234.656] (-239.502) (-235.388) -- 0:00:29
504500 -- (-233.641) (-235.572) [-234.694] (-237.134) * (-235.082) (-235.403) [-237.483] (-236.352) -- 0:00:29
505000 -- (-233.678) [-234.638] (-236.583) (-239.390) * (-235.450) (-233.202) [-236.745] (-235.270) -- 0:00:29
Average standard deviation of split frequencies: 0.015010
505500 -- [-239.563] (-235.941) (-234.629) (-235.972) * (-234.549) (-236.684) (-234.241) [-235.578] -- 0:00:29
506000 -- [-234.963] (-235.957) (-234.683) (-238.614) * (-240.378) (-236.490) (-234.698) [-235.932] -- 0:00:29
506500 -- (-233.253) (-237.421) [-236.119] (-237.394) * (-234.287) (-236.668) (-236.350) [-236.698] -- 0:00:29
507000 -- [-234.721] (-233.673) (-233.101) (-235.940) * (-236.329) (-235.370) (-238.337) [-235.119] -- 0:00:29
507500 -- [-233.849] (-235.134) (-235.803) (-237.108) * (-235.110) (-236.317) (-235.092) [-234.845] -- 0:00:29
508000 -- (-233.616) [-240.399] (-237.879) (-234.909) * (-237.407) [-234.544] (-236.244) (-235.430) -- 0:00:29
508500 -- (-236.770) (-236.036) [-233.470] (-237.504) * (-238.424) (-241.380) (-236.824) [-235.282] -- 0:00:29
509000 -- (-241.813) [-234.952] (-236.824) (-240.619) * [-233.953] (-234.469) (-234.766) (-234.710) -- 0:00:29
509500 -- (-239.545) (-236.424) (-237.484) [-242.754] * (-238.978) (-233.532) [-234.985] (-237.153) -- 0:00:29
510000 -- [-240.786] (-233.300) (-236.813) (-236.304) * (-234.306) (-240.416) [-235.131] (-235.127) -- 0:00:29
Average standard deviation of split frequencies: 0.014444
510500 -- (-234.761) (-235.417) [-238.349] (-233.969) * (-240.445) [-235.713] (-238.142) (-234.478) -- 0:00:29
511000 -- (-236.800) [-235.527] (-233.669) (-235.941) * (-233.827) (-237.679) (-236.648) [-234.884] -- 0:00:29
511500 -- (-236.220) (-237.538) (-237.932) [-235.515] * (-233.806) (-238.023) [-236.459] (-234.992) -- 0:00:29
512000 -- (-235.958) (-234.683) [-235.321] (-233.930) * (-240.465) (-235.890) [-238.213] (-234.560) -- 0:00:29
512500 -- (-240.225) (-238.796) [-234.879] (-235.269) * [-235.605] (-238.500) (-236.119) (-232.944) -- 0:00:29
513000 -- (-235.855) (-233.384) [-240.577] (-235.604) * (-236.592) (-235.711) [-234.010] (-237.028) -- 0:00:29
513500 -- (-238.247) [-234.034] (-235.925) (-238.707) * (-235.651) (-236.107) (-233.566) [-234.100] -- 0:00:29
514000 -- (-234.351) [-234.562] (-238.101) (-237.711) * [-233.688] (-236.555) (-234.214) (-235.125) -- 0:00:29
514500 -- (-238.386) [-233.777] (-236.064) (-235.109) * (-233.759) [-233.884] (-233.130) (-234.703) -- 0:00:29
515000 -- (-238.219) (-235.312) (-234.848) [-234.927] * (-233.736) [-233.149] (-234.821) (-234.396) -- 0:00:29
Average standard deviation of split frequencies: 0.013704
515500 -- [-236.052] (-242.105) (-235.083) (-235.231) * (-233.498) (-233.493) (-235.730) [-236.101] -- 0:00:29
516000 -- (-233.980) (-233.622) [-238.005] (-238.319) * (-237.016) (-234.065) [-236.933] (-237.777) -- 0:00:29
516500 -- (-233.998) (-235.292) [-236.007] (-238.225) * (-233.707) [-237.850] (-235.377) (-234.750) -- 0:00:29
517000 -- [-237.115] (-235.079) (-234.508) (-237.456) * (-234.623) [-234.266] (-236.921) (-233.404) -- 0:00:28
517500 -- (-234.138) (-237.866) (-235.902) [-235.081] * (-234.060) (-232.944) (-235.799) [-234.528] -- 0:00:28
518000 -- (-235.904) [-233.680] (-238.904) (-234.288) * (-236.639) (-234.141) (-234.819) [-236.513] -- 0:00:28
518500 -- (-234.440) (-235.342) (-234.869) [-237.585] * (-235.110) (-237.327) (-236.653) [-234.583] -- 0:00:28
519000 -- [-236.497] (-237.212) (-233.887) (-235.835) * (-234.485) (-235.129) (-235.785) [-235.296] -- 0:00:28
519500 -- (-235.185) [-244.342] (-236.256) (-236.032) * [-234.290] (-238.292) (-233.827) (-235.655) -- 0:00:28
520000 -- (-236.285) [-234.576] (-234.031) (-238.048) * (-235.110) (-237.013) (-235.906) [-236.314] -- 0:00:28
Average standard deviation of split frequencies: 0.013411
520500 -- (-235.630) (-236.885) [-237.761] (-236.770) * [-233.754] (-234.697) (-234.166) (-235.559) -- 0:00:28
521000 -- (-235.725) (-239.179) (-237.907) [-235.590] * [-233.940] (-234.788) (-234.723) (-237.290) -- 0:00:28
521500 -- (-233.534) [-237.297] (-236.693) (-234.116) * (-236.373) [-237.407] (-235.301) (-233.314) -- 0:00:28
522000 -- (-236.784) [-237.699] (-236.078) (-234.929) * (-237.638) (-239.809) (-235.190) [-235.744] -- 0:00:28
522500 -- (-236.841) (-234.555) [-237.304] (-238.908) * (-233.560) (-236.734) [-234.450] (-237.064) -- 0:00:28
523000 -- (-236.610) (-234.239) [-236.949] (-238.321) * (-233.812) [-238.335] (-237.578) (-234.313) -- 0:00:28
523500 -- (-233.447) [-233.642] (-235.474) (-234.641) * [-233.521] (-239.107) (-237.143) (-233.999) -- 0:00:28
524000 -- (-235.385) [-237.243] (-235.039) (-236.161) * (-236.842) (-235.164) [-236.725] (-233.888) -- 0:00:28
524500 -- (-237.799) (-233.353) [-234.495] (-234.379) * (-234.560) (-236.022) (-235.411) [-234.778] -- 0:00:28
525000 -- [-233.365] (-233.730) (-234.597) (-234.610) * (-234.793) (-238.060) (-234.761) [-234.390] -- 0:00:28
Average standard deviation of split frequencies: 0.012659
525500 -- (-235.507) (-240.460) (-236.372) [-233.283] * (-235.872) [-235.722] (-238.027) (-237.055) -- 0:00:28
526000 -- (-236.478) [-235.751] (-235.102) (-235.428) * (-233.228) [-234.761] (-234.045) (-234.089) -- 0:00:28
526500 -- (-239.056) (-235.960) (-236.698) [-234.041] * (-240.527) [-234.106] (-234.718) (-234.161) -- 0:00:28
527000 -- (-234.762) [-234.629] (-234.089) (-235.420) * (-236.156) (-235.156) (-240.959) [-235.191] -- 0:00:28
527500 -- (-239.855) (-234.276) (-235.430) [-233.832] * (-237.343) [-234.188] (-237.716) (-239.568) -- 0:00:28
528000 -- (-238.630) (-238.319) [-235.039] (-234.896) * (-235.992) (-234.693) (-236.342) [-235.301] -- 0:00:28
528500 -- (-239.612) (-240.028) (-234.242) [-234.514] * (-239.230) [-237.456] (-236.610) (-235.375) -- 0:00:28
529000 -- (-236.226) (-234.501) (-234.598) [-233.644] * (-237.136) (-239.002) (-234.530) [-237.390] -- 0:00:28
529500 -- (-234.875) (-236.057) [-234.584] (-235.566) * (-234.224) (-234.180) (-238.444) [-235.680] -- 0:00:28
530000 -- (-234.403) [-234.230] (-235.618) (-242.450) * (-238.658) [-236.463] (-239.499) (-237.064) -- 0:00:28
Average standard deviation of split frequencies: 0.012326
530500 -- [-234.038] (-234.514) (-236.655) (-236.724) * (-237.428) (-234.322) (-237.509) [-234.172] -- 0:00:28
531000 -- [-238.985] (-234.675) (-235.310) (-233.998) * (-239.200) [-238.564] (-236.495) (-233.162) -- 0:00:28
531500 -- [-233.640] (-233.707) (-234.364) (-236.047) * (-235.846) [-237.184] (-236.157) (-235.300) -- 0:00:28
532000 -- (-236.401) [-235.596] (-239.215) (-235.793) * (-236.741) (-235.502) (-235.052) [-234.898] -- 0:00:28
532500 -- (-233.090) [-236.744] (-234.806) (-238.184) * (-240.826) [-235.187] (-234.798) (-233.770) -- 0:00:28
533000 -- [-235.526] (-234.470) (-233.977) (-234.958) * (-236.725) (-235.546) [-233.483] (-236.205) -- 0:00:28
533500 -- (-237.558) (-234.899) [-234.703] (-236.790) * [-234.115] (-237.586) (-234.830) (-234.557) -- 0:00:27
534000 -- (-235.746) (-233.798) (-234.421) [-234.944] * (-235.502) (-237.776) (-234.023) [-234.336] -- 0:00:27
534500 -- (-236.481) (-233.479) (-233.638) [-233.686] * (-235.973) (-233.254) (-236.229) [-237.094] -- 0:00:27
535000 -- (-233.949) (-233.235) [-236.665] (-241.704) * (-234.039) (-236.842) (-235.468) [-235.768] -- 0:00:27
Average standard deviation of split frequencies: 0.012368
535500 -- (-235.983) (-234.371) [-235.331] (-234.694) * (-236.101) [-235.163] (-240.588) (-235.695) -- 0:00:27
536000 -- (-235.619) [-235.000] (-239.888) (-236.459) * (-233.414) (-235.928) [-235.195] (-235.800) -- 0:00:27
536500 -- (-235.872) (-236.340) (-240.113) [-236.813] * (-233.221) [-236.939] (-238.672) (-237.161) -- 0:00:27
537000 -- (-235.458) (-235.184) [-237.146] (-236.687) * (-241.623) (-236.326) [-236.742] (-237.808) -- 0:00:27
537500 -- [-235.301] (-234.487) (-234.799) (-237.526) * (-239.165) (-235.642) [-236.072] (-236.043) -- 0:00:27
538000 -- [-234.208] (-238.107) (-234.802) (-236.134) * [-234.209] (-238.861) (-237.684) (-235.464) -- 0:00:27
538500 -- (-236.832) (-238.468) (-233.993) [-235.989] * (-237.262) (-235.784) (-233.795) [-236.754] -- 0:00:27
539000 -- (-236.811) (-235.028) [-238.506] (-238.179) * (-234.382) [-234.994] (-234.191) (-236.738) -- 0:00:27
539500 -- (-235.318) (-239.753) [-239.174] (-235.379) * (-236.352) (-235.668) [-240.071] (-237.759) -- 0:00:27
540000 -- (-234.536) (-237.683) (-235.972) [-236.043] * [-233.121] (-236.058) (-235.410) (-242.946) -- 0:00:27
Average standard deviation of split frequencies: 0.012697
540500 -- (-235.519) (-235.252) [-236.730] (-236.326) * [-233.529] (-235.131) (-234.852) (-236.730) -- 0:00:27
541000 -- [-236.162] (-234.332) (-235.289) (-234.363) * (-236.126) [-234.968] (-235.177) (-235.587) -- 0:00:27
541500 -- (-236.640) (-237.233) (-234.412) [-234.807] * [-234.714] (-234.656) (-239.903) (-234.767) -- 0:00:27
542000 -- (-234.723) [-236.258] (-237.323) (-233.862) * (-237.588) (-234.720) [-237.119] (-233.775) -- 0:00:27
542500 -- (-235.646) (-235.849) [-233.855] (-238.585) * (-234.594) (-235.734) (-234.790) [-234.692] -- 0:00:27
543000 -- (-235.107) [-236.637] (-239.221) (-235.106) * (-237.455) (-235.766) [-234.135] (-234.764) -- 0:00:27
543500 -- (-234.389) (-236.624) (-234.754) [-235.210] * (-234.787) (-238.583) [-235.830] (-234.821) -- 0:00:27
544000 -- (-235.441) (-234.184) [-235.179] (-234.982) * (-237.798) [-235.825] (-235.109) (-233.513) -- 0:00:27
544500 -- (-236.658) (-235.603) [-236.632] (-234.603) * (-234.919) [-236.070] (-236.245) (-235.457) -- 0:00:27
545000 -- [-234.529] (-238.854) (-235.036) (-235.781) * (-234.257) (-236.755) [-235.010] (-234.393) -- 0:00:27
Average standard deviation of split frequencies: 0.011871
545500 -- (-236.562) [-236.226] (-233.915) (-234.553) * [-238.747] (-236.516) (-240.841) (-235.347) -- 0:00:27
546000 -- (-238.601) [-234.061] (-236.862) (-234.842) * (-236.551) (-236.736) [-237.488] (-234.850) -- 0:00:27
546500 -- [-234.729] (-235.752) (-237.056) (-234.485) * (-235.874) (-235.801) [-236.710] (-239.462) -- 0:00:27
547000 -- (-234.508) (-234.126) (-240.522) [-234.718] * (-237.452) (-235.746) (-234.243) [-236.542] -- 0:00:27
547500 -- (-242.192) (-234.165) [-234.729] (-234.793) * [-238.272] (-235.594) (-235.358) (-236.492) -- 0:00:27
548000 -- [-233.537] (-236.222) (-233.890) (-237.282) * (-236.592) (-234.941) [-234.962] (-235.170) -- 0:00:27
548500 -- [-233.941] (-235.066) (-234.135) (-238.244) * (-235.982) (-235.363) (-237.416) [-235.853] -- 0:00:27
549000 -- [-233.178] (-238.932) (-237.962) (-234.251) * (-239.923) (-234.992) (-235.421) [-235.414] -- 0:00:27
549500 -- (-236.678) [-237.059] (-239.720) (-235.556) * (-236.362) (-234.820) [-234.934] (-235.496) -- 0:00:27
550000 -- (-235.805) (-235.712) (-236.194) [-234.943] * (-234.955) (-235.924) [-234.097] (-234.895) -- 0:00:27
Average standard deviation of split frequencies: 0.011396
550500 -- (-235.436) (-235.546) [-237.162] (-235.600) * (-235.495) [-233.365] (-234.967) (-236.531) -- 0:00:26
551000 -- [-234.499] (-236.163) (-237.663) (-237.966) * (-235.031) (-235.585) [-237.557] (-237.684) -- 0:00:26
551500 -- (-239.340) (-234.808) [-236.931] (-233.624) * (-237.695) [-234.767] (-235.301) (-240.016) -- 0:00:26
552000 -- (-240.121) [-234.058] (-239.533) (-234.335) * (-234.174) (-235.032) (-233.689) [-233.735] -- 0:00:26
552500 -- (-233.278) [-234.918] (-240.350) (-235.549) * (-237.218) (-235.007) (-236.833) [-238.988] -- 0:00:26
553000 -- (-233.034) [-234.114] (-239.438) (-236.502) * (-237.019) (-235.309) [-236.372] (-236.356) -- 0:00:26
553500 -- (-233.640) (-234.413) [-236.260] (-234.410) * [-234.288] (-235.590) (-234.697) (-236.105) -- 0:00:26
554000 -- [-233.260] (-234.558) (-239.170) (-234.411) * (-234.226) (-234.367) [-238.910] (-233.246) -- 0:00:26
554500 -- (-235.461) (-239.447) [-237.220] (-234.213) * (-235.150) (-235.310) (-238.154) [-240.371] -- 0:00:26
555000 -- (-236.687) (-238.946) (-233.295) [-236.495] * [-236.530] (-240.582) (-233.346) (-234.919) -- 0:00:26
Average standard deviation of split frequencies: 0.011234
555500 -- (-237.548) (-237.818) [-234.148] (-234.818) * (-234.577) (-235.302) [-235.794] (-233.018) -- 0:00:26
556000 -- [-233.643] (-237.577) (-236.327) (-234.346) * (-238.782) (-235.511) (-234.477) [-237.300] -- 0:00:26
556500 -- [-234.334] (-236.385) (-234.456) (-234.552) * (-235.193) [-235.301] (-238.685) (-234.691) -- 0:00:26
557000 -- (-239.237) (-234.215) [-236.533] (-234.782) * (-236.908) [-235.626] (-234.325) (-239.640) -- 0:00:26
557500 -- (-236.529) [-237.228] (-233.772) (-234.355) * [-233.540] (-238.784) (-235.293) (-233.313) -- 0:00:26
558000 -- (-236.134) [-234.982] (-235.529) (-235.619) * (-236.117) (-236.762) (-237.989) [-237.229] -- 0:00:26
558500 -- (-234.830) (-240.668) (-236.894) [-235.574] * [-241.937] (-236.087) (-233.263) (-234.721) -- 0:00:26
559000 -- [-234.334] (-243.551) (-233.953) (-235.926) * [-234.940] (-233.757) (-234.170) (-235.445) -- 0:00:26
559500 -- (-234.278) (-234.748) [-236.066] (-237.625) * [-233.772] (-238.843) (-234.486) (-239.225) -- 0:00:26
560000 -- (-234.669) (-234.773) (-235.062) [-234.327] * (-235.167) (-235.153) (-236.577) [-236.305] -- 0:00:26
Average standard deviation of split frequencies: 0.011719
560500 -- (-237.128) [-234.131] (-234.610) (-237.750) * (-234.942) (-236.622) [-233.748] (-235.565) -- 0:00:26
561000 -- (-237.070) [-241.668] (-235.599) (-236.251) * (-237.395) (-235.101) [-236.467] (-234.834) -- 0:00:26
561500 -- [-234.382] (-239.435) (-234.135) (-235.163) * (-236.884) (-234.579) (-234.049) [-234.074] -- 0:00:26
562000 -- [-235.973] (-236.179) (-235.057) (-238.954) * [-235.360] (-234.412) (-243.235) (-237.334) -- 0:00:26
562500 -- (-234.871) (-236.202) (-235.798) [-234.982] * [-234.445] (-235.347) (-240.833) (-234.997) -- 0:00:26
563000 -- (-233.692) [-235.144] (-235.378) (-233.719) * (-237.016) [-238.130] (-236.938) (-234.106) -- 0:00:26
563500 -- (-234.811) (-236.071) (-235.001) [-235.652] * [-233.653] (-238.162) (-234.132) (-237.596) -- 0:00:26
564000 -- (-234.295) (-235.109) (-236.113) [-233.918] * (-234.521) (-234.131) [-234.823] (-234.646) -- 0:00:26
564500 -- [-234.030] (-237.985) (-236.692) (-236.890) * (-233.054) (-233.625) (-237.073) [-233.262] -- 0:00:26
565000 -- [-233.684] (-234.093) (-238.028) (-235.325) * [-234.429] (-234.163) (-233.952) (-234.642) -- 0:00:26
Average standard deviation of split frequencies: 0.011504
565500 -- [-236.504] (-234.813) (-238.704) (-239.177) * [-234.474] (-235.114) (-236.716) (-233.889) -- 0:00:26
566000 -- (-236.980) (-236.673) (-236.399) [-235.202] * (-235.714) (-233.899) (-236.605) [-234.233] -- 0:00:26
566500 -- (-238.302) [-234.433] (-239.308) (-235.115) * (-235.983) (-233.823) (-238.909) [-235.043] -- 0:00:26
567000 -- [-235.805] (-237.350) (-233.488) (-235.992) * [-233.726] (-238.153) (-236.709) (-235.539) -- 0:00:25
567500 -- (-234.264) (-237.744) [-233.875] (-233.341) * (-235.690) [-233.909] (-239.643) (-235.993) -- 0:00:25
568000 -- (-236.602) [-233.904] (-235.138) (-234.578) * [-236.166] (-236.411) (-234.947) (-238.951) -- 0:00:25
568500 -- [-237.429] (-234.040) (-239.705) (-234.488) * (-237.370) [-238.088] (-236.232) (-235.121) -- 0:00:25
569000 -- (-234.785) (-236.109) (-238.314) [-234.900] * (-238.031) (-234.022) (-234.831) [-233.439] -- 0:00:25
569500 -- (-236.053) [-234.127] (-238.065) (-238.032) * [-236.540] (-235.277) (-236.914) (-233.690) -- 0:00:25
570000 -- [-234.236] (-236.083) (-240.538) (-236.552) * (-238.904) (-235.223) (-242.662) [-233.803] -- 0:00:25
Average standard deviation of split frequencies: 0.011203
570500 -- (-241.198) (-235.590) (-236.214) [-236.190] * (-237.108) (-235.855) (-237.832) [-237.171] -- 0:00:25
571000 -- (-233.572) [-236.814] (-237.497) (-233.521) * [-238.614] (-235.998) (-235.606) (-233.924) -- 0:00:25
571500 -- (-234.836) (-233.865) (-234.928) [-238.584] * (-236.109) (-234.867) [-233.532] (-236.622) -- 0:00:25
572000 -- [-235.784] (-242.996) (-233.833) (-237.330) * (-235.600) (-235.920) [-234.209] (-236.559) -- 0:00:25
572500 -- (-233.433) [-234.800] (-234.935) (-236.739) * (-233.252) (-236.201) (-233.601) [-233.975] -- 0:00:25
573000 -- [-234.620] (-236.028) (-237.368) (-233.806) * (-239.114) [-233.772] (-235.472) (-236.055) -- 0:00:25
573500 -- (-233.494) (-235.528) (-234.208) [-234.003] * [-233.644] (-235.839) (-237.162) (-238.495) -- 0:00:25
574000 -- [-233.531] (-235.074) (-233.103) (-237.964) * (-236.389) [-233.535] (-235.845) (-233.826) -- 0:00:25
574500 -- (-235.310) [-234.547] (-233.633) (-236.973) * [-234.307] (-234.538) (-236.498) (-236.291) -- 0:00:25
575000 -- (-235.218) [-233.733] (-233.648) (-236.099) * [-234.707] (-238.714) (-236.116) (-235.624) -- 0:00:25
Average standard deviation of split frequencies: 0.011355
575500 -- (-237.506) (-234.174) (-236.176) [-241.530] * (-239.218) (-236.383) [-236.232] (-239.470) -- 0:00:25
576000 -- (-235.840) [-236.007] (-234.860) (-233.689) * (-234.211) (-234.227) (-235.353) [-236.157] -- 0:00:25
576500 -- (-236.484) [-237.695] (-233.411) (-236.348) * (-234.726) (-234.561) (-235.943) [-235.786] -- 0:00:25
577000 -- (-235.622) (-234.364) (-234.031) [-233.760] * (-234.812) [-234.039] (-238.031) (-235.112) -- 0:00:25
577500 -- (-234.438) [-236.184] (-235.748) (-234.384) * (-239.186) [-234.644] (-235.472) (-234.853) -- 0:00:25
578000 -- (-233.957) (-232.993) (-235.421) [-234.033] * [-236.683] (-236.921) (-235.030) (-233.947) -- 0:00:25
578500 -- (-236.198) (-236.133) (-235.571) [-235.077] * [-235.953] (-237.744) (-236.421) (-233.513) -- 0:00:25
579000 -- (-235.192) (-238.349) (-235.914) [-233.603] * [-235.543] (-240.114) (-236.326) (-233.696) -- 0:00:25
579500 -- (-237.122) (-237.856) [-235.255] (-233.253) * [-235.908] (-236.261) (-237.503) (-236.267) -- 0:00:25
580000 -- (-240.102) [-236.063] (-235.933) (-235.258) * (-235.368) (-234.845) (-234.608) [-235.716] -- 0:00:25
Average standard deviation of split frequencies: 0.011264
580500 -- (-242.501) (-237.717) (-237.498) [-234.058] * (-235.278) [-234.031] (-236.564) (-236.655) -- 0:00:25
581000 -- [-233.132] (-240.523) (-237.544) (-234.882) * (-236.224) [-234.640] (-234.599) (-234.213) -- 0:00:25
581500 -- [-235.926] (-233.120) (-238.767) (-236.393) * (-236.842) [-234.711] (-233.421) (-234.412) -- 0:00:25
582000 -- (-240.245) [-234.779] (-234.904) (-242.500) * (-234.874) [-236.089] (-233.830) (-234.487) -- 0:00:25
582500 -- [-237.196] (-240.798) (-233.538) (-233.932) * [-235.440] (-235.304) (-235.829) (-237.478) -- 0:00:25
583000 -- (-236.371) (-236.658) (-234.033) [-236.880] * (-235.753) (-235.621) (-235.605) [-235.612] -- 0:00:25
583500 -- (-236.205) [-235.583] (-235.010) (-233.455) * (-234.173) (-236.292) (-236.845) [-234.240] -- 0:00:24
584000 -- [-233.479] (-234.941) (-234.506) (-234.651) * (-234.862) [-233.088] (-238.906) (-234.660) -- 0:00:24
584500 -- (-237.712) (-234.834) [-234.271] (-236.810) * [-235.830] (-238.485) (-233.377) (-235.973) -- 0:00:24
585000 -- (-237.980) (-234.808) (-235.668) [-235.936] * (-235.229) (-233.222) [-234.119] (-235.173) -- 0:00:24
Average standard deviation of split frequencies: 0.010860
585500 -- (-238.123) (-235.108) (-235.119) [-237.080] * (-236.528) (-238.299) [-233.381] (-233.902) -- 0:00:24
586000 -- (-234.123) (-234.225) [-234.588] (-234.129) * (-235.937) (-241.914) (-234.787) [-235.003] -- 0:00:24
586500 -- [-238.833] (-237.101) (-235.245) (-234.309) * (-238.092) (-239.282) [-234.261] (-233.468) -- 0:00:24
587000 -- (-235.466) [-236.261] (-235.089) (-235.508) * [-233.394] (-236.459) (-234.546) (-237.818) -- 0:00:24
587500 -- [-234.909] (-234.371) (-235.892) (-233.763) * (-233.883) [-236.251] (-235.698) (-233.469) -- 0:00:24
588000 -- [-234.017] (-234.065) (-235.312) (-236.885) * [-235.141] (-234.962) (-236.393) (-238.170) -- 0:00:24
588500 -- (-237.992) [-237.375] (-236.209) (-236.079) * (-234.202) (-235.207) [-238.197] (-236.466) -- 0:00:24
589000 -- [-233.518] (-234.572) (-236.290) (-234.516) * (-236.787) [-238.834] (-239.496) (-237.060) -- 0:00:24
589500 -- [-236.009] (-236.033) (-239.204) (-235.022) * (-236.171) [-235.553] (-234.396) (-234.584) -- 0:00:24
590000 -- (-237.174) (-238.825) [-235.337] (-235.189) * (-233.918) (-233.782) [-236.595] (-235.139) -- 0:00:24
Average standard deviation of split frequencies: 0.011123
590500 -- (-235.327) (-237.530) [-233.289] (-233.451) * (-233.901) (-235.763) [-233.716] (-234.927) -- 0:00:24
591000 -- (-234.815) (-236.183) [-234.914] (-236.230) * [-233.643] (-241.372) (-234.722) (-235.992) -- 0:00:24
591500 -- [-236.241] (-238.545) (-234.658) (-235.194) * [-234.091] (-237.506) (-237.147) (-234.401) -- 0:00:24
592000 -- [-238.071] (-236.432) (-238.626) (-237.445) * (-236.238) (-234.980) [-234.404] (-235.498) -- 0:00:24
592500 -- (-234.826) (-234.340) [-236.313] (-235.584) * (-237.332) (-234.867) [-234.189] (-233.547) -- 0:00:24
593000 -- [-233.990] (-235.589) (-233.840) (-236.821) * (-234.997) (-233.853) (-236.563) [-237.682] -- 0:00:24
593500 -- (-235.549) (-235.120) [-233.799] (-237.569) * [-233.749] (-239.327) (-238.654) (-235.971) -- 0:00:24
594000 -- (-235.200) (-233.345) [-233.803] (-236.764) * (-235.884) (-235.086) [-234.742] (-233.577) -- 0:00:24
594500 -- (-234.708) [-233.545] (-234.557) (-233.840) * (-235.227) (-235.943) (-236.121) [-233.663] -- 0:00:24
595000 -- [-234.102] (-233.095) (-234.775) (-237.879) * (-233.543) (-236.793) (-234.814) [-233.306] -- 0:00:24
Average standard deviation of split frequencies: 0.011320
595500 -- (-235.030) (-233.409) [-236.973] (-241.462) * (-233.829) (-235.602) [-236.285] (-234.202) -- 0:00:24
596000 -- [-234.227] (-234.313) (-236.298) (-237.753) * [-233.604] (-236.207) (-233.901) (-235.657) -- 0:00:24
596500 -- [-233.664] (-234.902) (-235.697) (-235.634) * (-233.522) (-235.571) [-233.728] (-234.125) -- 0:00:24
597000 -- (-238.315) (-238.014) (-234.155) [-232.933] * (-234.885) (-238.281) (-238.250) [-236.946] -- 0:00:24
597500 -- (-235.163) (-235.781) (-234.204) [-236.416] * [-236.084] (-234.483) (-235.466) (-236.398) -- 0:00:24
598000 -- [-236.411] (-237.183) (-238.568) (-235.640) * (-236.380) [-233.570] (-234.302) (-235.014) -- 0:00:24
598500 -- (-235.930) (-235.743) (-233.122) [-237.529] * (-236.845) [-235.713] (-234.909) (-235.288) -- 0:00:24
599000 -- [-233.769] (-237.108) (-234.874) (-234.712) * (-236.490) (-234.425) [-234.108] (-235.345) -- 0:00:24
599500 -- (-233.458) [-235.612] (-235.538) (-236.618) * (-236.480) (-233.314) (-234.845) [-235.538] -- 0:00:24
600000 -- (-236.866) [-237.388] (-234.894) (-237.280) * (-236.508) (-235.739) (-239.063) [-235.305] -- 0:00:24
Average standard deviation of split frequencies: 0.011183
600500 -- (-234.680) [-234.626] (-234.976) (-236.918) * (-241.221) (-233.285) [-234.117] (-233.054) -- 0:00:23
601000 -- (-235.057) [-236.017] (-234.230) (-237.068) * [-235.561] (-234.301) (-234.538) (-234.455) -- 0:00:23
601500 -- (-238.011) (-233.969) [-235.174] (-236.920) * [-233.344] (-234.356) (-234.959) (-233.872) -- 0:00:23
602000 -- [-233.924] (-235.224) (-234.704) (-236.377) * (-234.932) (-235.404) [-234.216] (-235.626) -- 0:00:23
602500 -- (-237.223) (-239.661) [-235.045] (-234.530) * (-235.628) (-234.187) [-235.607] (-235.928) -- 0:00:23
603000 -- (-235.839) (-235.631) [-235.057] (-234.209) * (-238.505) (-233.690) (-234.061) [-233.840] -- 0:00:23
603500 -- [-235.198] (-233.791) (-237.892) (-239.572) * (-235.796) (-239.371) (-233.270) [-235.940] -- 0:00:23
604000 -- (-241.175) [-235.827] (-234.963) (-236.316) * (-234.937) (-238.042) [-236.039] (-234.895) -- 0:00:23
604500 -- (-234.915) [-235.103] (-235.377) (-237.275) * (-237.501) [-236.353] (-236.503) (-235.565) -- 0:00:23
605000 -- [-235.050] (-235.240) (-235.855) (-235.026) * (-236.022) (-240.984) (-236.635) [-234.244] -- 0:00:23
Average standard deviation of split frequencies: 0.011377
605500 -- (-235.826) [-233.567] (-235.313) (-238.573) * [-236.826] (-237.881) (-235.971) (-234.932) -- 0:00:23
606000 -- (-233.835) (-235.785) [-235.635] (-235.902) * [-235.657] (-237.503) (-237.104) (-233.359) -- 0:00:23
606500 -- (-233.832) [-235.148] (-244.362) (-234.510) * [-235.103] (-236.889) (-235.655) (-236.264) -- 0:00:23
607000 -- (-235.695) [-236.805] (-237.805) (-233.876) * (-234.935) (-236.426) [-235.813] (-233.407) -- 0:00:23
607500 -- (-234.212) (-235.826) (-238.635) [-234.394] * (-237.335) (-235.570) [-234.805] (-239.022) -- 0:00:23
608000 -- (-236.574) (-235.037) (-235.860) [-234.745] * (-235.593) (-238.867) (-241.664) [-234.982] -- 0:00:23
608500 -- (-234.880) (-236.103) (-234.165) [-235.921] * [-235.141] (-237.386) (-235.689) (-237.588) -- 0:00:23
609000 -- (-233.730) (-236.007) [-238.859] (-236.241) * (-240.380) (-236.204) (-235.098) [-236.067] -- 0:00:23
609500 -- [-233.582] (-236.667) (-234.576) (-238.647) * (-237.320) [-234.450] (-234.726) (-237.008) -- 0:00:23
610000 -- [-234.378] (-233.947) (-236.600) (-236.586) * [-235.081] (-233.761) (-237.899) (-237.450) -- 0:00:23
Average standard deviation of split frequencies: 0.011772
610500 -- [-236.808] (-233.555) (-235.101) (-236.277) * (-237.337) (-235.897) (-233.574) [-234.637] -- 0:00:23
611000 -- [-234.401] (-233.786) (-239.602) (-236.193) * (-238.291) [-237.142] (-233.951) (-235.613) -- 0:00:23
611500 -- [-234.972] (-235.395) (-238.657) (-237.983) * [-236.293] (-233.757) (-234.893) (-234.139) -- 0:00:23
612000 -- [-236.283] (-239.984) (-234.776) (-236.144) * [-239.656] (-233.512) (-235.277) (-234.327) -- 0:00:23
612500 -- (-233.909) (-234.095) (-238.975) [-237.349] * (-238.607) (-235.427) (-236.430) [-233.360] -- 0:00:23
613000 -- [-234.250] (-237.404) (-236.153) (-237.334) * [-233.944] (-235.013) (-233.714) (-237.703) -- 0:00:23
613500 -- (-235.003) (-236.369) [-234.568] (-235.242) * (-237.718) [-233.957] (-233.573) (-234.753) -- 0:00:23
614000 -- [-238.772] (-235.240) (-235.183) (-234.889) * (-236.073) [-234.280] (-234.357) (-235.353) -- 0:00:23
614500 -- (-235.728) (-233.785) (-236.138) [-234.020] * (-235.432) (-240.069) (-235.038) [-237.398] -- 0:00:23
615000 -- (-237.593) [-235.387] (-236.049) (-238.150) * (-238.400) (-234.915) (-236.481) [-234.224] -- 0:00:23
Average standard deviation of split frequencies: 0.011718
615500 -- [-236.361] (-233.870) (-233.907) (-234.814) * (-236.523) [-234.433] (-234.176) (-234.660) -- 0:00:23
616000 -- [-234.624] (-235.039) (-236.141) (-238.006) * (-237.694) (-235.964) [-233.864] (-237.625) -- 0:00:23
616500 -- [-235.329] (-234.598) (-235.522) (-234.728) * (-238.306) [-233.688] (-235.742) (-235.251) -- 0:00:23
617000 -- (-234.672) (-236.471) (-235.640) [-234.279] * [-236.871] (-235.496) (-233.966) (-234.808) -- 0:00:22
617500 -- [-234.319] (-237.041) (-234.569) (-236.061) * [-235.520] (-235.227) (-239.543) (-234.773) -- 0:00:22
618000 -- (-233.693) (-238.558) [-233.762] (-236.399) * (-235.056) (-233.905) [-236.749] (-233.615) -- 0:00:22
618500 -- [-234.558] (-234.419) (-235.116) (-237.599) * (-238.113) [-236.693] (-234.034) (-234.093) -- 0:00:22
619000 -- (-235.771) (-238.648) [-235.767] (-235.671) * (-236.487) (-237.722) [-234.169] (-234.792) -- 0:00:22
619500 -- (-235.236) (-234.879) [-234.140] (-236.448) * [-235.448] (-235.234) (-235.108) (-238.901) -- 0:00:22
620000 -- (-234.934) (-235.209) [-234.689] (-236.591) * (-234.587) [-235.943] (-236.173) (-234.453) -- 0:00:22
Average standard deviation of split frequencies: 0.011535
620500 -- (-237.142) (-236.389) [-232.961] (-234.437) * (-242.328) (-234.195) (-237.251) [-235.350] -- 0:00:22
621000 -- (-235.611) (-233.946) (-234.923) [-237.591] * (-238.557) (-234.050) [-234.131] (-234.556) -- 0:00:22
621500 -- (-236.061) (-237.394) (-234.817) [-233.575] * (-241.421) (-235.428) [-234.976] (-234.720) -- 0:00:22
622000 -- (-236.151) [-235.610] (-235.417) (-235.522) * (-234.779) (-237.257) [-234.463] (-238.437) -- 0:00:22
622500 -- (-233.930) (-235.898) (-235.658) [-234.266] * [-236.083] (-236.404) (-238.402) (-234.330) -- 0:00:22
623000 -- (-234.373) (-235.964) (-233.324) [-238.318] * [-236.115] (-236.965) (-237.365) (-234.482) -- 0:00:22
623500 -- [-235.834] (-234.472) (-233.886) (-234.326) * [-234.723] (-236.027) (-240.113) (-235.592) -- 0:00:22
624000 -- [-237.129] (-233.744) (-235.549) (-233.556) * (-238.940) [-234.190] (-236.076) (-235.026) -- 0:00:22
624500 -- (-235.953) (-234.054) (-234.772) [-233.611] * (-239.066) (-233.308) (-239.234) [-239.892] -- 0:00:22
625000 -- (-234.643) (-233.748) (-235.553) [-235.793] * (-236.972) (-234.542) (-243.847) [-233.435] -- 0:00:22
Average standard deviation of split frequencies: 0.011719
625500 -- [-233.905] (-235.051) (-234.980) (-237.324) * [-237.198] (-235.563) (-237.058) (-234.986) -- 0:00:22
626000 -- (-237.119) [-233.748] (-233.279) (-236.342) * (-234.736) [-241.292] (-236.637) (-235.132) -- 0:00:22
626500 -- [-236.713] (-237.813) (-239.081) (-235.404) * (-236.593) [-237.595] (-237.346) (-234.021) -- 0:00:22
627000 -- [-235.878] (-237.616) (-235.187) (-233.745) * (-234.924) [-234.736] (-235.425) (-233.864) -- 0:00:22
627500 -- (-234.957) (-240.119) [-235.935] (-236.295) * [-234.788] (-244.714) (-234.903) (-234.779) -- 0:00:22
628000 -- [-234.814] (-234.972) (-234.353) (-236.284) * [-243.285] (-239.801) (-237.758) (-236.537) -- 0:00:22
628500 -- (-233.642) (-241.893) [-234.829] (-236.336) * (-242.894) (-234.560) (-236.535) [-234.384] -- 0:00:22
629000 -- [-233.708] (-239.017) (-234.734) (-233.704) * [-236.024] (-237.143) (-234.302) (-237.857) -- 0:00:22
629500 -- (-237.537) (-235.623) (-236.993) [-234.233] * (-235.384) (-234.642) (-233.941) [-236.136] -- 0:00:22
630000 -- [-235.245] (-236.392) (-238.626) (-234.536) * (-234.908) (-234.959) (-233.573) [-237.569] -- 0:00:22
Average standard deviation of split frequencies: 0.011539
630500 -- [-237.177] (-235.167) (-233.939) (-234.604) * (-237.176) (-233.452) (-234.633) [-237.567] -- 0:00:22
631000 -- (-234.419) [-235.923] (-237.852) (-235.715) * (-234.263) (-238.691) (-234.021) [-234.785] -- 0:00:22
631500 -- (-235.323) (-233.872) [-238.577] (-235.413) * (-233.129) [-233.969] (-236.131) (-237.696) -- 0:00:22
632000 -- (-237.795) [-234.031] (-236.965) (-234.681) * (-233.315) (-234.771) [-239.395] (-235.550) -- 0:00:22
632500 -- (-235.956) (-234.241) [-235.688] (-234.008) * [-235.663] (-234.201) (-237.658) (-235.409) -- 0:00:22
633000 -- (-235.803) (-235.788) (-235.193) [-236.282] * [-240.806] (-236.501) (-234.153) (-236.537) -- 0:00:22
633500 -- [-234.928] (-234.602) (-243.159) (-235.910) * (-235.954) [-234.269] (-235.560) (-234.491) -- 0:00:21
634000 -- [-235.107] (-234.531) (-237.003) (-234.536) * (-235.013) (-235.745) (-234.128) [-235.351] -- 0:00:21
634500 -- [-235.676] (-240.629) (-234.548) (-233.523) * [-235.006] (-237.568) (-233.567) (-240.094) -- 0:00:21
635000 -- (-237.419) [-234.036] (-233.895) (-235.748) * [-234.970] (-234.976) (-235.679) (-237.919) -- 0:00:21
Average standard deviation of split frequencies: 0.011442
635500 -- (-234.993) (-234.490) (-238.643) [-237.336] * (-236.274) (-240.385) [-234.368] (-234.550) -- 0:00:21
636000 -- [-236.351] (-238.279) (-235.869) (-236.494) * [-239.983] (-236.151) (-235.917) (-236.350) -- 0:00:21
636500 -- [-238.029] (-236.169) (-234.219) (-236.102) * [-236.996] (-239.654) (-233.609) (-234.119) -- 0:00:21
637000 -- (-237.915) [-237.818] (-234.461) (-234.336) * [-236.497] (-233.933) (-233.778) (-235.532) -- 0:00:21
637500 -- (-239.634) (-235.955) (-234.156) [-235.010] * [-235.555] (-234.597) (-234.813) (-234.087) -- 0:00:21
638000 -- (-235.601) (-235.815) (-235.460) [-236.652] * (-236.513) (-234.827) (-234.270) [-233.978] -- 0:00:21
638500 -- (-233.610) (-236.037) [-234.163] (-237.110) * [-234.264] (-236.160) (-237.960) (-234.114) -- 0:00:21
639000 -- (-235.952) (-235.624) (-237.308) [-234.605] * (-234.150) (-236.797) (-234.720) [-233.636] -- 0:00:21
639500 -- (-236.825) [-237.358] (-238.101) (-236.928) * [-234.565] (-234.642) (-235.050) (-236.139) -- 0:00:21
640000 -- [-235.412] (-235.338) (-234.435) (-241.601) * (-237.452) (-236.557) [-236.066] (-235.548) -- 0:00:21
Average standard deviation of split frequencies: 0.011543
640500 -- (-238.401) (-235.486) (-235.693) [-235.686] * (-234.211) [-234.790] (-237.083) (-235.189) -- 0:00:21
641000 -- (-236.479) (-237.813) (-235.576) [-234.914] * (-234.706) (-235.226) (-236.067) [-233.706] -- 0:00:21
641500 -- (-241.282) (-237.058) [-235.239] (-241.364) * (-234.389) (-234.281) (-236.114) [-233.369] -- 0:00:21
642000 -- (-237.824) (-235.106) [-233.153] (-234.024) * (-238.731) (-233.598) [-234.096] (-239.487) -- 0:00:21
642500 -- (-234.942) (-234.027) (-233.998) [-238.501] * (-233.961) (-234.257) (-236.337) [-236.415] -- 0:00:21
643000 -- (-234.546) (-237.193) [-235.635] (-236.308) * (-239.468) [-233.406] (-234.139) (-236.829) -- 0:00:21
643500 -- [-233.517] (-236.262) (-239.683) (-245.489) * (-234.527) [-236.336] (-234.779) (-235.527) -- 0:00:21
644000 -- (-235.365) [-235.254] (-233.953) (-234.124) * (-239.711) (-235.968) [-236.207] (-235.126) -- 0:00:21
644500 -- (-233.927) (-234.537) (-235.129) [-235.376] * (-234.835) (-234.237) (-233.959) [-236.836] -- 0:00:21
645000 -- [-233.691] (-233.669) (-236.141) (-233.953) * (-233.731) [-233.881] (-235.751) (-235.536) -- 0:00:21
Average standard deviation of split frequencies: 0.011356
645500 -- (-235.381) (-234.853) [-234.571] (-239.231) * [-234.316] (-237.707) (-236.924) (-237.211) -- 0:00:21
646000 -- (-238.107) (-236.695) (-236.447) [-237.334] * [-236.024] (-237.821) (-237.385) (-234.206) -- 0:00:21
646500 -- [-234.152] (-237.959) (-239.268) (-235.092) * (-237.580) (-237.668) (-234.083) [-236.369] -- 0:00:21
647000 -- (-233.627) (-233.948) (-234.674) [-234.480] * (-239.013) [-236.955] (-237.621) (-235.157) -- 0:00:21
647500 -- (-235.376) (-233.709) [-236.259] (-233.633) * [-237.480] (-233.657) (-238.003) (-235.445) -- 0:00:21
648000 -- (-237.066) [-236.284] (-233.902) (-235.766) * (-234.906) (-234.682) (-233.338) [-233.153] -- 0:00:21
648500 -- (-238.215) [-235.569] (-239.917) (-234.140) * (-237.864) (-234.085) [-233.381] (-237.809) -- 0:00:21
649000 -- (-235.079) [-234.557] (-234.907) (-234.963) * (-235.437) (-234.530) (-237.418) [-235.570] -- 0:00:21
649500 -- [-236.184] (-235.090) (-239.461) (-234.926) * (-233.875) (-234.359) (-235.039) [-236.341] -- 0:00:21
650000 -- (-235.206) [-236.537] (-234.572) (-238.032) * (-233.850) (-234.995) [-234.778] (-236.699) -- 0:00:21
Average standard deviation of split frequencies: 0.011275
650500 -- (-233.349) (-233.441) [-235.525] (-237.146) * (-237.055) (-233.915) (-242.776) [-235.461] -- 0:00:20
651000 -- [-238.379] (-234.676) (-234.317) (-234.830) * (-235.028) (-237.439) (-234.275) [-233.550] -- 0:00:20
651500 -- (-232.992) [-235.515] (-235.712) (-235.490) * [-237.748] (-239.502) (-235.178) (-235.650) -- 0:00:20
652000 -- (-234.666) [-234.038] (-238.674) (-235.779) * [-235.977] (-239.787) (-234.661) (-233.290) -- 0:00:20
652500 -- [-233.842] (-237.411) (-238.742) (-237.102) * (-238.029) (-242.729) [-237.265] (-235.141) -- 0:00:20
653000 -- (-235.717) [-235.919] (-235.449) (-235.166) * (-238.596) (-238.205) [-236.846] (-234.882) -- 0:00:20
653500 -- (-240.323) [-235.162] (-239.090) (-235.269) * (-234.501) (-235.634) (-234.114) [-235.854] -- 0:00:20
654000 -- [-235.702] (-238.206) (-234.246) (-235.380) * (-235.593) (-233.251) [-237.883] (-234.344) -- 0:00:20
654500 -- [-236.821] (-240.428) (-233.959) (-233.526) * (-238.887) [-234.322] (-236.486) (-233.559) -- 0:00:20
655000 -- (-234.527) [-234.602] (-236.486) (-236.348) * (-235.236) (-234.516) (-237.391) [-236.614] -- 0:00:20
Average standard deviation of split frequencies: 0.011049
655500 -- (-235.142) [-234.328] (-234.270) (-237.684) * (-236.351) (-233.571) (-236.304) [-234.785] -- 0:00:20
656000 -- (-237.142) (-234.175) (-234.019) [-233.637] * (-237.831) (-235.310) (-234.121) [-234.291] -- 0:00:20
656500 -- (-235.324) (-234.202) (-237.593) [-234.799] * (-236.018) (-235.110) (-237.342) [-236.417] -- 0:00:20
657000 -- (-235.017) [-236.099] (-236.254) (-237.106) * (-234.905) (-235.931) (-236.392) [-235.758] -- 0:00:20
657500 -- [-233.320] (-233.797) (-236.543) (-237.557) * (-234.714) (-235.161) [-236.292] (-234.954) -- 0:00:20
658000 -- (-237.937) [-239.747] (-236.484) (-234.746) * (-238.848) (-236.057) (-233.713) [-234.435] -- 0:00:20
658500 -- [-234.189] (-236.203) (-233.520) (-235.495) * (-238.043) [-233.542] (-233.447) (-232.985) -- 0:00:20
659000 -- [-234.277] (-235.042) (-233.542) (-234.616) * (-238.056) (-234.671) [-234.818] (-234.748) -- 0:00:20
659500 -- [-238.255] (-237.171) (-235.913) (-236.927) * (-235.415) (-234.783) [-235.592] (-237.395) -- 0:00:20
660000 -- (-234.414) (-236.636) (-234.439) [-236.420] * (-236.174) (-236.528) [-233.979] (-239.343) -- 0:00:20
Average standard deviation of split frequencies: 0.011015
660500 -- (-233.471) (-240.259) [-237.705] (-233.411) * (-233.913) (-240.116) [-235.250] (-235.899) -- 0:00:20
661000 -- [-233.029] (-238.163) (-234.492) (-237.020) * (-236.945) (-237.168) (-235.039) [-236.023] -- 0:00:20
661500 -- (-233.198) (-239.387) [-236.209] (-235.343) * [-234.133] (-238.240) (-234.902) (-234.559) -- 0:00:20
662000 -- (-239.017) (-236.058) [-235.169] (-240.281) * (-240.347) (-234.539) [-235.718] (-234.314) -- 0:00:20
662500 -- [-235.622] (-234.501) (-234.858) (-237.149) * (-234.147) [-238.523] (-234.570) (-235.296) -- 0:00:20
663000 -- (-241.290) (-234.161) [-237.959] (-236.539) * (-236.510) (-237.361) [-235.377] (-237.173) -- 0:00:20
663500 -- (-234.625) [-233.364] (-234.573) (-234.120) * (-236.857) (-235.044) [-239.780] (-235.006) -- 0:00:20
664000 -- (-235.709) (-233.744) [-234.118] (-235.330) * (-239.034) [-234.793] (-236.822) (-234.685) -- 0:00:20
664500 -- (-234.247) (-233.645) [-237.552] (-238.087) * (-237.815) (-235.445) [-235.744] (-237.472) -- 0:00:20
665000 -- [-234.765] (-235.111) (-239.232) (-235.781) * (-235.026) (-238.799) [-233.083] (-234.019) -- 0:00:20
Average standard deviation of split frequencies: 0.011369
665500 -- (-234.653) [-234.495] (-237.408) (-233.747) * (-235.070) (-236.537) [-235.010] (-233.320) -- 0:00:20
666000 -- (-234.671) (-236.357) (-234.367) [-233.703] * [-237.527] (-234.983) (-234.286) (-234.031) -- 0:00:20
666500 -- (-233.786) (-234.453) (-234.704) [-234.606] * [-234.834] (-237.307) (-234.495) (-237.418) -- 0:00:20
667000 -- (-234.665) (-233.546) [-234.407] (-236.150) * (-237.604) (-233.441) [-234.732] (-234.751) -- 0:00:19
667500 -- (-235.065) (-233.873) (-235.966) [-239.279] * (-239.015) (-238.868) (-236.228) [-235.525] -- 0:00:19
668000 -- (-236.177) (-233.951) [-236.493] (-238.019) * (-235.865) [-236.494] (-236.687) (-240.800) -- 0:00:19
668500 -- [-238.348] (-233.632) (-234.694) (-235.210) * [-234.577] (-235.080) (-233.992) (-235.496) -- 0:00:19
669000 -- (-237.513) (-233.298) [-236.229] (-233.869) * (-235.328) [-233.347] (-237.095) (-235.146) -- 0:00:19
669500 -- [-237.164] (-234.073) (-235.827) (-239.636) * (-237.743) (-238.580) (-239.413) [-235.612] -- 0:00:19
670000 -- [-235.412] (-233.429) (-238.387) (-235.704) * (-235.146) (-237.911) (-235.035) [-237.566] -- 0:00:19
Average standard deviation of split frequencies: 0.011686
670500 -- (-235.246) (-234.995) (-237.179) [-235.587] * (-234.603) (-235.147) [-233.171] (-234.760) -- 0:00:19
671000 -- (-237.628) [-233.676] (-234.992) (-237.062) * (-234.021) (-236.673) [-234.638] (-238.146) -- 0:00:19
671500 -- [-236.173] (-237.153) (-235.038) (-235.260) * (-234.205) (-234.254) [-236.484] (-235.193) -- 0:00:19
672000 -- (-235.002) (-235.995) [-233.380] (-233.399) * (-236.558) [-234.788] (-236.953) (-239.409) -- 0:00:19
672500 -- (-237.444) (-236.005) (-234.268) [-234.900] * (-237.911) (-238.967) (-241.996) [-234.105] -- 0:00:19
673000 -- [-239.321] (-237.044) (-234.120) (-234.606) * (-234.158) (-235.606) (-243.218) [-234.085] -- 0:00:19
673500 -- (-234.639) [-238.576] (-235.619) (-233.824) * (-236.531) [-233.797] (-234.824) (-235.039) -- 0:00:19
674000 -- (-233.137) (-240.091) [-233.361] (-237.127) * [-235.049] (-234.755) (-236.128) (-236.543) -- 0:00:19
674500 -- (-237.547) (-235.676) [-234.047] (-233.843) * [-236.772] (-235.728) (-235.748) (-235.331) -- 0:00:19
675000 -- (-234.919) (-234.802) [-234.321] (-235.078) * (-234.932) [-235.555] (-234.090) (-238.722) -- 0:00:19
Average standard deviation of split frequencies: 0.011724
675500 -- (-237.336) (-233.455) (-233.723) [-234.563] * [-233.573] (-241.177) (-234.928) (-237.156) -- 0:00:19
676000 -- [-234.701] (-235.782) (-233.670) (-236.114) * (-238.313) (-235.046) [-235.330] (-235.637) -- 0:00:19
676500 -- (-234.371) (-233.865) (-234.690) [-237.538] * (-234.718) [-239.123] (-234.922) (-236.438) -- 0:00:19
677000 -- (-236.160) (-236.367) (-234.966) [-235.139] * (-234.836) [-235.412] (-237.289) (-236.625) -- 0:00:19
677500 -- (-234.659) (-236.284) (-236.089) [-234.182] * (-240.314) (-233.782) [-234.883] (-236.971) -- 0:00:19
678000 -- (-233.899) [-234.412] (-238.555) (-234.419) * (-240.569) (-235.095) (-235.862) [-234.581] -- 0:00:19
678500 -- (-234.915) (-235.264) [-234.818] (-237.477) * (-239.413) (-233.781) [-237.753] (-233.182) -- 0:00:19
679000 -- (-235.946) (-234.380) (-233.310) [-234.382] * (-239.112) (-244.165) (-235.392) [-241.664] -- 0:00:19
679500 -- (-237.848) (-236.972) (-237.243) [-233.780] * [-233.999] (-236.593) (-235.153) (-237.884) -- 0:00:19
680000 -- (-235.361) [-234.503] (-237.584) (-236.778) * (-235.639) (-237.693) (-233.848) [-237.018] -- 0:00:19
Average standard deviation of split frequencies: 0.011687
680500 -- [-236.490] (-234.124) (-239.449) (-235.378) * (-234.206) [-233.957] (-234.909) (-236.878) -- 0:00:19
681000 -- [-238.510] (-235.987) (-234.883) (-234.338) * (-233.914) [-234.553] (-235.773) (-233.211) -- 0:00:19
681500 -- (-235.124) (-235.434) [-233.513] (-233.595) * [-235.198] (-234.456) (-239.091) (-234.134) -- 0:00:19
682000 -- (-235.331) (-233.528) [-233.429] (-237.065) * (-234.582) [-233.636] (-236.721) (-233.930) -- 0:00:19
682500 -- (-236.078) (-234.834) (-233.977) [-234.808] * [-237.536] (-241.719) (-239.210) (-233.508) -- 0:00:19
683000 -- (-237.164) (-235.945) [-233.659] (-237.644) * (-235.329) (-237.256) [-239.337] (-235.320) -- 0:00:19
683500 -- (-237.396) (-234.106) (-235.339) [-234.763] * (-236.202) [-234.212] (-236.808) (-233.249) -- 0:00:18
684000 -- (-234.725) (-234.110) [-240.990] (-237.922) * [-233.565] (-234.224) (-235.765) (-236.017) -- 0:00:18
684500 -- [-234.580] (-233.645) (-237.843) (-235.367) * (-233.373) (-233.361) (-236.903) [-235.542] -- 0:00:18
685000 -- (-234.609) (-238.861) [-235.400] (-237.205) * (-234.894) [-233.926] (-235.796) (-240.130) -- 0:00:18
Average standard deviation of split frequencies: 0.011682
685500 -- [-234.718] (-235.667) (-236.443) (-234.517) * (-235.096) (-233.960) (-236.298) [-239.672] -- 0:00:18
686000 -- (-237.331) [-244.840] (-236.561) (-233.985) * [-235.566] (-233.657) (-234.055) (-236.662) -- 0:00:18
686500 -- [-234.792] (-242.925) (-235.807) (-234.532) * (-235.520) (-236.233) [-234.469] (-237.810) -- 0:00:18
687000 -- (-236.731) [-236.979] (-237.302) (-236.949) * (-240.682) (-233.784) [-234.657] (-234.378) -- 0:00:18
687500 -- (-237.633) [-233.899] (-233.975) (-234.389) * (-235.570) [-233.451] (-235.894) (-234.619) -- 0:00:18
688000 -- (-236.615) [-236.127] (-238.410) (-235.038) * [-235.031] (-233.784) (-234.599) (-237.086) -- 0:00:18
688500 -- (-235.488) (-235.263) [-235.526] (-235.069) * (-234.996) [-233.955] (-234.618) (-236.630) -- 0:00:18
689000 -- (-237.230) (-236.610) [-236.085] (-234.876) * (-236.241) (-236.779) (-234.791) [-234.314] -- 0:00:18
689500 -- (-241.336) [-237.578] (-234.389) (-235.799) * (-236.327) (-233.385) (-235.281) [-235.151] -- 0:00:18
690000 -- (-238.157) (-236.027) [-234.215] (-234.651) * (-237.761) [-234.908] (-237.141) (-233.494) -- 0:00:18
Average standard deviation of split frequencies: 0.011262
690500 -- [-234.881] (-235.870) (-234.751) (-236.533) * (-236.272) (-234.966) [-234.957] (-233.583) -- 0:00:18
691000 -- (-234.245) (-235.156) [-233.984] (-236.617) * [-233.941] (-235.116) (-234.679) (-243.496) -- 0:00:18
691500 -- (-233.621) (-236.833) [-234.683] (-235.260) * (-233.397) (-236.380) (-237.234) [-233.670] -- 0:00:18
692000 -- [-234.711] (-242.823) (-237.968) (-234.790) * (-234.721) (-235.855) (-235.360) [-234.371] -- 0:00:18
692500 -- (-233.809) (-237.248) (-238.139) [-233.085] * (-234.733) [-234.674] (-235.114) (-235.639) -- 0:00:18
693000 -- [-236.454] (-237.005) (-239.604) (-235.758) * (-236.097) (-235.929) (-236.180) [-234.957] -- 0:00:18
693500 -- (-235.904) (-234.324) (-237.031) [-233.381] * [-236.328] (-235.325) (-236.641) (-235.971) -- 0:00:18
694000 -- (-235.872) (-235.601) (-234.850) [-234.492] * [-235.553] (-237.930) (-236.664) (-236.916) -- 0:00:18
694500 -- [-233.235] (-235.972) (-235.810) (-234.762) * (-234.940) [-238.553] (-238.655) (-236.937) -- 0:00:18
695000 -- (-238.102) [-233.982] (-237.489) (-235.616) * [-233.256] (-238.487) (-234.109) (-235.202) -- 0:00:18
Average standard deviation of split frequencies: 0.010752
695500 -- (-235.964) (-233.136) (-234.950) [-235.871] * (-236.252) [-233.718] (-233.531) (-234.710) -- 0:00:18
696000 -- [-236.584] (-234.502) (-235.320) (-235.490) * (-234.227) [-233.795] (-233.851) (-234.355) -- 0:00:18
696500 -- (-235.669) (-236.176) (-233.235) [-236.686] * (-233.198) [-234.083] (-237.027) (-234.463) -- 0:00:18
697000 -- (-236.586) (-236.025) [-235.878] (-235.176) * [-237.406] (-233.123) (-236.102) (-235.663) -- 0:00:18
697500 -- (-237.831) [-235.191] (-235.851) (-234.346) * (-237.619) [-232.972] (-234.663) (-234.541) -- 0:00:18
698000 -- (-234.354) (-238.198) (-236.527) [-234.358] * [-236.813] (-233.688) (-234.763) (-233.688) -- 0:00:18
698500 -- [-237.280] (-238.263) (-233.349) (-234.232) * (-235.595) (-235.008) (-236.168) [-233.471] -- 0:00:18
699000 -- [-233.766] (-238.212) (-237.607) (-233.293) * [-234.166] (-234.515) (-236.117) (-235.622) -- 0:00:18
699500 -- (-236.018) (-234.166) [-237.228] (-233.623) * [-236.243] (-235.439) (-236.259) (-235.061) -- 0:00:18
700000 -- (-236.680) [-235.297] (-237.846) (-234.569) * [-234.384] (-236.539) (-235.092) (-237.310) -- 0:00:18
Average standard deviation of split frequencies: 0.010975
700500 -- (-234.063) (-234.971) [-236.404] (-238.622) * (-236.988) (-234.076) [-235.711] (-234.753) -- 0:00:17
701000 -- (-235.451) (-235.739) (-233.558) [-234.860] * (-237.112) [-233.921] (-236.825) (-236.209) -- 0:00:17
701500 -- (-234.966) (-233.332) (-235.368) [-235.304] * [-238.479] (-234.732) (-237.831) (-236.225) -- 0:00:17
702000 -- (-235.316) [-233.731] (-235.903) (-235.508) * (-238.021) (-236.606) (-234.441) [-237.539] -- 0:00:17
702500 -- [-236.728] (-239.914) (-234.943) (-234.633) * (-235.462) [-236.953] (-234.605) (-239.236) -- 0:00:17
703000 -- (-237.238) [-236.005] (-236.907) (-237.528) * (-239.069) (-234.767) (-234.462) [-236.666] -- 0:00:17
703500 -- (-238.293) [-233.032] (-235.676) (-234.173) * (-235.824) (-233.723) (-233.484) [-234.934] -- 0:00:17
704000 -- [-238.782] (-234.132) (-237.623) (-236.755) * (-235.291) (-237.848) [-234.008] (-234.586) -- 0:00:17
704500 -- (-233.936) (-236.591) (-234.296) [-239.782] * (-238.697) (-236.050) [-233.628] (-238.338) -- 0:00:17
705000 -- (-237.372) [-238.460] (-233.715) (-238.597) * (-236.797) (-238.395) (-237.768) [-235.098] -- 0:00:17
Average standard deviation of split frequencies: 0.010809
705500 -- (-237.438) (-234.328) (-234.132) [-238.672] * [-233.264] (-235.221) (-233.232) (-234.326) -- 0:00:17
706000 -- (-235.811) (-234.584) [-236.399] (-234.667) * (-233.252) (-237.088) [-235.909] (-233.408) -- 0:00:17
706500 -- [-235.447] (-238.980) (-236.788) (-235.953) * (-236.918) (-233.501) [-234.177] (-234.841) -- 0:00:17
707000 -- [-234.522] (-235.863) (-237.747) (-235.333) * (-236.051) (-236.702) [-235.639] (-238.027) -- 0:00:17
707500 -- (-235.853) [-233.173] (-237.345) (-233.371) * [-238.406] (-239.241) (-233.530) (-236.547) -- 0:00:17
708000 -- [-234.771] (-233.696) (-234.479) (-239.376) * (-237.039) [-235.893] (-235.006) (-234.370) -- 0:00:17
708500 -- (-236.378) (-234.949) [-233.707] (-234.172) * (-239.134) (-234.065) [-234.107] (-234.430) -- 0:00:17
709000 -- [-234.644] (-233.280) (-235.932) (-235.488) * (-233.200) (-234.819) (-235.999) [-236.293] -- 0:00:17
709500 -- (-235.299) [-234.893] (-234.949) (-236.098) * (-236.871) (-234.371) [-236.145] (-234.547) -- 0:00:17
710000 -- (-233.065) [-233.273] (-233.436) (-233.472) * (-238.754) (-238.496) [-234.319] (-237.042) -- 0:00:17
Average standard deviation of split frequencies: 0.010655
710500 -- (-233.863) [-237.487] (-233.974) (-235.352) * (-234.749) (-237.357) (-238.261) [-234.794] -- 0:00:17
711000 -- (-235.297) (-236.337) [-235.090] (-236.245) * (-236.492) [-237.601] (-235.002) (-236.669) -- 0:00:17
711500 -- (-237.769) (-235.347) [-234.694] (-234.570) * (-233.483) (-236.893) (-233.837) [-235.078] -- 0:00:17
712000 -- (-239.099) [-237.757] (-235.350) (-235.869) * [-235.160] (-234.013) (-233.696) (-241.074) -- 0:00:17
712500 -- [-234.730] (-237.826) (-236.128) (-241.113) * [-235.217] (-233.910) (-235.694) (-235.897) -- 0:00:17
713000 -- (-235.479) (-233.208) [-234.282] (-236.650) * [-235.344] (-236.291) (-236.228) (-234.460) -- 0:00:17
713500 -- (-234.124) (-233.880) [-236.731] (-237.518) * (-238.107) (-239.494) (-237.645) [-239.913] -- 0:00:17
714000 -- (-233.672) (-237.277) [-234.010] (-235.880) * [-234.277] (-237.581) (-236.473) (-238.009) -- 0:00:17
714500 -- [-233.708] (-233.609) (-239.135) (-235.088) * (-235.959) (-236.947) [-234.779] (-237.847) -- 0:00:17
715000 -- (-234.262) [-235.020] (-233.989) (-235.638) * (-236.284) [-235.138] (-235.667) (-233.729) -- 0:00:17
Average standard deviation of split frequencies: 0.010946
715500 -- (-235.028) (-238.102) (-233.242) [-235.570] * (-238.470) [-234.290] (-239.175) (-235.303) -- 0:00:17
716000 -- (-234.210) [-233.875] (-233.224) (-235.704) * (-238.074) (-237.140) (-240.636) [-236.222] -- 0:00:17
716500 -- (-234.124) [-235.967] (-235.146) (-237.369) * (-235.942) (-234.928) (-233.819) [-235.300] -- 0:00:17
717000 -- (-235.950) (-246.617) [-234.439] (-239.457) * (-235.318) (-235.038) [-236.906] (-235.580) -- 0:00:16
717500 -- [-240.134] (-241.373) (-238.888) (-234.433) * (-233.772) [-236.252] (-235.157) (-233.721) -- 0:00:16
718000 -- (-236.061) [-235.254] (-236.283) (-234.335) * (-236.237) (-235.404) (-237.364) [-233.821] -- 0:00:16
718500 -- (-234.887) [-233.757] (-235.565) (-234.614) * [-235.168] (-234.294) (-235.283) (-238.957) -- 0:00:16
719000 -- [-233.921] (-235.059) (-234.516) (-233.860) * (-234.275) [-235.082] (-235.255) (-235.664) -- 0:00:16
719500 -- (-235.393) [-235.369] (-234.512) (-234.638) * (-233.826) [-234.550] (-234.752) (-238.780) -- 0:00:16
720000 -- [-234.896] (-234.925) (-235.628) (-234.476) * (-236.063) (-235.388) [-236.093] (-236.837) -- 0:00:16
Average standard deviation of split frequencies: 0.010507
720500 -- (-235.141) (-235.891) (-235.661) [-235.198] * [-236.501] (-237.906) (-234.951) (-235.777) -- 0:00:16
721000 -- (-235.904) (-236.326) (-236.480) [-237.031] * (-235.894) [-235.663] (-235.118) (-235.109) -- 0:00:16
721500 -- (-237.700) (-239.299) [-234.747] (-234.050) * (-234.944) [-235.326] (-238.109) (-234.618) -- 0:00:16
722000 -- [-236.144] (-234.048) (-235.932) (-237.742) * [-234.576] (-239.237) (-234.293) (-238.002) -- 0:00:16
722500 -- (-237.552) (-234.455) (-236.745) [-236.896] * (-234.578) (-236.265) (-234.838) [-233.793] -- 0:00:16
723000 -- (-235.818) (-235.780) (-237.609) [-234.224] * [-234.229] (-236.838) (-233.885) (-234.523) -- 0:00:16
723500 -- [-235.251] (-238.728) (-237.203) (-235.195) * (-233.526) [-236.114] (-234.963) (-235.778) -- 0:00:16
724000 -- [-235.284] (-237.809) (-233.555) (-235.047) * (-234.442) [-241.538] (-235.502) (-234.088) -- 0:00:16
724500 -- (-235.662) (-237.049) [-233.736] (-240.201) * (-234.818) (-239.962) (-235.882) [-234.631] -- 0:00:16
725000 -- (-235.823) (-238.290) [-234.040] (-240.426) * (-233.406) (-233.158) [-233.798] (-236.487) -- 0:00:16
Average standard deviation of split frequencies: 0.010267
725500 -- (-234.670) [-233.936] (-235.375) (-242.826) * [-235.776] (-236.090) (-240.421) (-236.708) -- 0:00:16
726000 -- [-233.319] (-235.005) (-236.863) (-238.147) * (-234.922) [-234.353] (-239.936) (-234.590) -- 0:00:16
726500 -- (-233.690) (-238.366) (-233.262) [-236.997] * (-235.849) (-234.141) (-236.539) [-234.169] -- 0:00:16
727000 -- [-235.745] (-233.957) (-240.590) (-236.124) * [-233.589] (-233.852) (-233.950) (-236.495) -- 0:00:16
727500 -- (-235.649) [-234.841] (-235.211) (-241.862) * (-237.218) [-234.322] (-235.431) (-237.632) -- 0:00:16
728000 -- (-237.381) [-237.227] (-236.373) (-237.177) * (-235.580) [-236.371] (-233.169) (-234.820) -- 0:00:16
728500 -- (-238.355) (-240.851) [-236.875] (-236.861) * [-236.181] (-234.411) (-233.422) (-235.066) -- 0:00:16
729000 -- (-234.097) [-235.665] (-235.894) (-234.882) * [-234.168] (-236.002) (-235.163) (-235.636) -- 0:00:16
729500 -- (-234.286) [-234.702] (-235.010) (-234.978) * (-235.735) (-234.272) [-235.957] (-234.157) -- 0:00:16
730000 -- (-233.376) [-233.696] (-236.804) (-234.274) * (-235.784) (-235.956) [-237.878] (-233.632) -- 0:00:16
Average standard deviation of split frequencies: 0.010605
730500 -- (-237.209) (-234.967) [-234.901] (-234.972) * (-237.122) (-234.477) [-236.906] (-233.788) -- 0:00:16
731000 -- (-235.884) (-236.591) (-238.157) [-236.020] * (-240.221) [-236.988] (-235.783) (-233.614) -- 0:00:16
731500 -- (-236.241) (-234.196) (-236.343) [-237.357] * [-237.392] (-240.647) (-233.418) (-238.175) -- 0:00:16
732000 -- (-235.053) [-235.010] (-236.364) (-236.360) * (-236.250) (-240.335) [-236.028] (-234.404) -- 0:00:16
732500 -- (-237.943) (-234.986) (-234.619) [-235.994] * (-233.260) (-235.632) (-233.988) [-233.960] -- 0:00:16
733000 -- [-233.785] (-238.739) (-234.325) (-235.134) * (-233.465) (-236.852) (-236.405) [-238.758] -- 0:00:16
733500 -- (-234.934) (-237.543) (-236.704) [-235.456] * (-233.770) (-237.007) (-236.623) [-234.317] -- 0:00:15
734000 -- (-237.505) (-236.865) (-234.255) [-234.497] * (-237.509) (-234.225) (-234.352) [-233.422] -- 0:00:15
734500 -- (-239.517) [-236.719] (-233.750) (-235.401) * (-233.432) [-234.852] (-243.023) (-234.377) -- 0:00:15
735000 -- (-235.310) (-234.408) (-235.238) [-233.465] * (-236.318) (-239.202) [-237.780] (-234.412) -- 0:00:15
Average standard deviation of split frequencies: 0.010328
735500 -- (-236.300) (-235.028) [-239.066] (-234.535) * [-235.034] (-237.114) (-235.276) (-237.010) -- 0:00:15
736000 -- (-233.898) (-236.735) [-237.152] (-237.299) * [-233.865] (-234.267) (-234.246) (-234.430) -- 0:00:15
736500 -- [-234.254] (-234.153) (-234.921) (-237.232) * (-236.697) (-235.045) [-235.453] (-237.248) -- 0:00:15
737000 -- (-236.205) [-233.795] (-233.646) (-234.180) * (-237.390) (-234.884) [-233.514] (-233.977) -- 0:00:15
737500 -- [-235.610] (-237.437) (-233.830) (-234.288) * (-234.278) (-234.657) [-236.931] (-237.420) -- 0:00:15
738000 -- (-235.551) (-233.631) [-238.810] (-238.388) * (-234.806) [-233.510] (-237.277) (-235.899) -- 0:00:15
738500 -- [-237.391] (-236.575) (-236.024) (-239.235) * (-235.869) (-234.165) (-236.487) [-235.819] -- 0:00:15
739000 -- (-234.276) [-236.043] (-235.908) (-236.695) * (-236.501) [-234.320] (-235.639) (-236.200) -- 0:00:15
739500 -- (-237.652) [-234.849] (-236.755) (-240.153) * (-240.709) (-237.047) [-236.342] (-234.515) -- 0:00:15
740000 -- (-234.232) (-233.751) (-237.449) [-241.522] * (-240.653) (-233.737) [-234.789] (-234.901) -- 0:00:15
Average standard deviation of split frequencies: 0.009706
740500 -- [-237.182] (-238.712) (-236.651) (-234.843) * (-237.336) (-234.465) (-234.351) [-238.297] -- 0:00:15
741000 -- [-234.770] (-237.041) (-235.839) (-235.980) * [-234.802] (-234.327) (-236.480) (-235.713) -- 0:00:15
741500 -- [-237.662] (-236.258) (-234.714) (-241.085) * [-238.657] (-234.784) (-235.411) (-237.713) -- 0:00:15
742000 -- (-240.641) (-235.180) (-234.218) [-234.471] * (-234.761) [-234.383] (-235.194) (-239.552) -- 0:00:15
742500 -- [-236.225] (-237.527) (-235.534) (-236.331) * (-237.015) (-235.938) [-233.564] (-238.568) -- 0:00:15
743000 -- (-235.578) [-234.338] (-242.048) (-237.445) * (-236.965) (-233.035) (-234.776) [-236.005] -- 0:00:15
743500 -- [-236.247] (-236.366) (-238.435) (-237.588) * (-237.346) (-233.962) [-234.087] (-234.500) -- 0:00:15
744000 -- (-235.341) (-237.172) [-239.193] (-233.745) * (-236.783) [-234.565] (-233.906) (-233.833) -- 0:00:15
744500 -- (-234.950) [-236.137] (-233.068) (-234.306) * [-233.853] (-234.445) (-233.660) (-234.665) -- 0:00:15
745000 -- [-236.905] (-236.690) (-234.252) (-234.590) * (-234.173) (-234.432) (-235.317) [-233.510] -- 0:00:15
Average standard deviation of split frequencies: 0.009597
745500 -- (-234.669) (-237.149) [-234.677] (-234.518) * (-233.804) (-237.354) (-238.644) [-236.064] -- 0:00:15
746000 -- [-234.563] (-237.071) (-236.561) (-235.897) * [-236.174] (-235.487) (-235.790) (-238.592) -- 0:00:15
746500 -- (-238.166) [-239.783] (-240.738) (-238.658) * [-235.212] (-234.193) (-234.564) (-237.470) -- 0:00:15
747000 -- (-236.000) [-238.675] (-234.872) (-235.562) * (-234.976) (-234.804) (-235.190) [-234.612] -- 0:00:15
747500 -- (-234.405) (-236.855) (-235.778) [-234.842] * (-236.989) [-235.732] (-235.241) (-236.804) -- 0:00:15
748000 -- (-235.201) (-238.154) (-233.199) [-234.930] * [-239.640] (-236.032) (-237.695) (-234.112) -- 0:00:15
748500 -- [-235.541] (-235.658) (-233.993) (-237.179) * (-237.621) [-242.172] (-243.206) (-236.774) -- 0:00:15
749000 -- [-236.857] (-234.679) (-234.913) (-236.451) * (-244.624) (-236.142) [-234.467] (-240.396) -- 0:00:15
749500 -- (-236.923) (-236.834) [-234.263] (-241.179) * (-237.708) [-235.857] (-235.031) (-234.528) -- 0:00:15
750000 -- [-234.109] (-237.760) (-233.898) (-237.935) * [-234.259] (-233.774) (-238.004) (-235.246) -- 0:00:15
Average standard deviation of split frequencies: 0.009537
750500 -- (-235.809) (-234.497) (-235.246) [-234.590] * (-235.049) (-234.513) (-234.216) [-235.839] -- 0:00:14
751000 -- (-241.737) (-234.230) (-234.323) [-236.581] * (-234.590) [-234.587] (-235.037) (-237.004) -- 0:00:14
751500 -- (-237.038) [-234.468] (-233.697) (-233.512) * (-236.618) (-235.719) (-236.875) [-235.249] -- 0:00:14
752000 -- (-237.378) (-234.834) [-235.271] (-234.230) * (-237.832) (-235.694) [-233.782] (-237.001) -- 0:00:14
752500 -- [-235.945] (-234.632) (-239.549) (-237.458) * (-234.404) [-233.677] (-239.947) (-238.213) -- 0:00:14
753000 -- (-236.672) (-234.221) (-238.728) [-235.071] * [-234.629] (-241.377) (-235.042) (-236.405) -- 0:00:14
753500 -- (-234.162) [-233.654] (-237.004) (-236.844) * (-235.093) [-240.525] (-234.009) (-234.662) -- 0:00:14
754000 -- (-235.115) (-235.527) [-235.747] (-241.747) * [-236.417] (-237.172) (-233.846) (-233.491) -- 0:00:14
754500 -- (-235.504) (-235.426) [-233.351] (-236.531) * (-235.481) [-240.740] (-234.457) (-236.798) -- 0:00:14
755000 -- (-235.625) (-236.369) (-236.077) [-235.339] * (-235.917) (-238.176) (-233.055) [-235.268] -- 0:00:14
Average standard deviation of split frequencies: 0.009470
755500 -- [-235.643] (-237.811) (-236.725) (-237.570) * [-234.913] (-238.119) (-233.493) (-235.078) -- 0:00:14
756000 -- [-236.511] (-236.193) (-234.212) (-235.410) * (-239.170) (-238.094) (-234.260) [-237.844] -- 0:00:14
756500 -- (-233.474) [-233.966] (-235.493) (-234.022) * [-236.294] (-233.943) (-234.420) (-233.342) -- 0:00:14
757000 -- [-233.304] (-240.461) (-234.288) (-233.911) * (-234.404) (-234.578) [-234.022] (-234.410) -- 0:00:14
757500 -- (-238.634) (-234.565) (-234.167) [-236.856] * (-235.695) (-234.370) [-234.156] (-235.629) -- 0:00:14
758000 -- [-234.141] (-237.774) (-236.055) (-235.846) * (-236.233) (-234.473) [-234.559] (-235.409) -- 0:00:14
758500 -- [-234.198] (-235.349) (-234.043) (-234.939) * [-233.541] (-235.187) (-235.168) (-235.198) -- 0:00:14
759000 -- (-234.797) [-237.323] (-235.032) (-234.432) * (-234.063) [-234.222] (-236.862) (-236.047) -- 0:00:14
759500 -- [-235.814] (-233.537) (-237.808) (-236.829) * (-235.211) [-235.387] (-235.459) (-238.395) -- 0:00:14
760000 -- (-237.867) [-234.782] (-233.908) (-234.269) * (-236.218) (-235.971) [-234.753] (-235.206) -- 0:00:14
Average standard deviation of split frequencies: 0.009180
760500 -- [-234.079] (-235.604) (-233.933) (-235.233) * (-237.097) (-236.754) (-234.757) [-234.370] -- 0:00:14
761000 -- (-236.809) [-234.687] (-234.869) (-238.834) * [-235.947] (-235.416) (-237.289) (-238.267) -- 0:00:14
761500 -- (-237.571) (-235.001) [-233.958] (-236.134) * (-236.963) (-239.005) [-236.198] (-236.515) -- 0:00:14
762000 -- (-234.600) [-236.729] (-234.598) (-236.380) * (-235.108) [-237.326] (-234.138) (-236.849) -- 0:00:14
762500 -- (-236.013) (-235.339) [-235.718] (-234.178) * (-235.450) (-233.874) (-233.871) [-235.677] -- 0:00:14
763000 -- (-236.038) (-237.200) (-236.729) [-235.668] * (-234.577) (-235.815) (-235.411) [-234.749] -- 0:00:14
763500 -- (-233.885) [-234.219] (-237.503) (-235.753) * (-235.657) (-236.252) [-234.849] (-233.592) -- 0:00:14
764000 -- (-233.738) (-234.719) [-234.541] (-234.572) * (-237.377) [-234.816] (-234.460) (-235.177) -- 0:00:14
764500 -- (-235.466) (-235.859) (-237.366) [-235.638] * [-236.258] (-234.964) (-233.144) (-234.058) -- 0:00:14
765000 -- (-235.673) (-237.503) (-237.627) [-236.797] * (-238.198) (-237.391) (-237.463) [-235.181] -- 0:00:14
Average standard deviation of split frequencies: 0.009000
765500 -- (-236.646) [-234.572] (-234.117) (-235.179) * (-234.039) (-235.413) (-236.503) [-234.798] -- 0:00:14
766000 -- (-237.378) (-237.325) [-235.913] (-235.637) * (-234.778) (-235.343) [-234.753] (-237.570) -- 0:00:14
766500 -- (-236.193) (-234.214) (-235.922) [-234.712] * (-236.575) (-233.279) (-236.651) [-234.072] -- 0:00:14
767000 -- (-239.496) (-233.369) (-236.347) [-234.139] * (-233.978) (-235.889) [-235.018] (-236.643) -- 0:00:13
767500 -- (-233.602) (-233.491) (-236.975) [-236.363] * [-234.322] (-236.383) (-239.332) (-236.652) -- 0:00:13
768000 -- [-235.734] (-233.822) (-241.309) (-233.516) * (-236.221) (-237.407) [-235.834] (-233.840) -- 0:00:13
768500 -- (-238.578) (-233.632) (-233.732) [-233.583] * (-234.727) (-238.738) (-236.131) [-235.021] -- 0:00:13
769000 -- (-237.544) (-236.984) [-235.067] (-232.970) * [-235.292] (-237.548) (-233.748) (-237.904) -- 0:00:13
769500 -- (-236.383) [-237.295] (-235.761) (-235.336) * [-233.334] (-237.474) (-235.911) (-238.942) -- 0:00:13
770000 -- (-235.264) (-235.061) (-234.066) [-233.151] * [-236.095] (-236.144) (-234.095) (-239.664) -- 0:00:13
Average standard deviation of split frequencies: 0.009061
770500 -- [-233.641] (-236.026) (-234.627) (-238.322) * (-238.705) (-238.671) [-233.422] (-238.317) -- 0:00:13
771000 -- (-242.577) (-237.053) [-235.580] (-239.646) * (-234.495) (-235.665) (-238.738) [-239.221] -- 0:00:13
771500 -- (-237.352) (-236.584) [-237.073] (-236.009) * (-234.992) (-238.792) [-233.726] (-251.172) -- 0:00:13
772000 -- (-236.388) (-236.750) [-235.676] (-238.516) * (-239.064) [-234.325] (-239.352) (-238.540) -- 0:00:13
772500 -- [-236.199] (-235.095) (-234.898) (-237.819) * [-236.360] (-237.957) (-241.246) (-233.809) -- 0:00:13
773000 -- (-234.190) [-234.554] (-234.810) (-238.132) * [-235.685] (-238.490) (-240.443) (-236.214) -- 0:00:13
773500 -- (-235.839) [-234.866] (-235.626) (-233.089) * (-236.659) [-234.350] (-234.566) (-234.107) -- 0:00:13
774000 -- (-235.335) (-234.747) [-236.845] (-233.199) * [-233.627] (-234.313) (-234.189) (-234.821) -- 0:00:13
774500 -- (-241.405) [-234.526] (-234.480) (-235.225) * (-235.147) [-235.997] (-237.410) (-234.232) -- 0:00:13
775000 -- (-237.158) [-233.769] (-235.035) (-240.377) * (-234.777) (-235.482) (-236.626) [-236.367] -- 0:00:13
Average standard deviation of split frequencies: 0.009302
775500 -- [-237.419] (-237.723) (-243.986) (-233.318) * (-235.835) (-235.652) [-236.028] (-238.980) -- 0:00:13
776000 -- [-236.950] (-237.755) (-239.588) (-233.905) * (-234.629) (-236.842) (-241.676) [-234.007] -- 0:00:13
776500 -- (-233.563) (-237.456) (-234.950) [-233.273] * (-235.027) (-235.245) (-236.926) [-236.146] -- 0:00:13
777000 -- (-235.460) (-234.599) (-239.233) [-235.484] * [-235.271] (-234.236) (-234.994) (-236.036) -- 0:00:13
777500 -- (-234.131) [-234.247] (-235.353) (-233.743) * (-233.503) (-236.557) [-233.868] (-239.114) -- 0:00:13
778000 -- (-234.749) [-234.702] (-237.070) (-233.621) * (-235.257) [-235.137] (-236.647) (-237.024) -- 0:00:13
778500 -- [-236.163] (-235.062) (-237.704) (-234.977) * (-234.180) (-234.013) [-234.549] (-233.839) -- 0:00:13
779000 -- (-238.129) (-236.201) (-235.738) [-234.796] * (-234.606) (-235.296) (-233.961) [-238.268] -- 0:00:13
779500 -- (-242.779) (-235.259) [-235.906] (-235.625) * (-234.180) [-235.124] (-235.188) (-233.817) -- 0:00:13
780000 -- (-234.819) [-236.639] (-236.243) (-234.770) * [-236.135] (-236.363) (-235.818) (-236.429) -- 0:00:13
Average standard deviation of split frequencies: 0.009548
780500 -- [-235.112] (-242.079) (-234.513) (-238.799) * (-237.436) [-244.730] (-233.794) (-235.706) -- 0:00:13
781000 -- (-233.729) [-234.215] (-233.317) (-235.093) * (-234.150) [-243.566] (-235.788) (-235.181) -- 0:00:13
781500 -- (-235.013) (-233.570) [-234.840] (-240.308) * (-236.065) (-235.935) (-234.850) [-233.635] -- 0:00:13
782000 -- (-235.647) (-234.501) (-236.746) [-233.944] * (-237.237) (-235.658) (-235.425) [-238.813] -- 0:00:13
782500 -- (-234.266) (-233.537) (-233.454) [-234.916] * (-238.694) (-233.278) (-235.840) [-235.910] -- 0:00:13
783000 -- (-233.809) [-235.297] (-234.892) (-235.004) * (-241.259) [-234.580] (-236.550) (-235.862) -- 0:00:13
783500 -- [-234.556] (-237.566) (-234.462) (-234.697) * (-235.584) (-235.417) (-235.199) [-236.270] -- 0:00:12
784000 -- (-233.974) (-234.073) [-236.322] (-233.531) * (-239.020) (-234.690) [-233.401] (-235.520) -- 0:00:12
784500 -- (-238.118) (-239.603) (-233.873) [-235.583] * (-234.827) (-235.811) (-233.358) [-235.429] -- 0:00:12
785000 -- (-235.199) [-235.899] (-235.291) (-235.988) * (-235.163) (-234.860) [-234.494] (-233.571) -- 0:00:12
Average standard deviation of split frequencies: 0.008996
785500 -- [-233.392] (-234.376) (-238.753) (-234.257) * [-234.967] (-236.415) (-237.089) (-236.652) -- 0:00:12
786000 -- [-234.253] (-238.549) (-236.271) (-234.013) * (-235.144) (-235.510) (-233.773) [-233.867] -- 0:00:12
786500 -- (-234.365) (-236.320) [-236.989] (-233.801) * (-233.438) (-237.184) [-233.321] (-237.703) -- 0:00:12
787000 -- (-233.371) [-233.795] (-237.115) (-235.183) * [-233.672] (-235.588) (-234.963) (-235.166) -- 0:00:12
787500 -- [-236.212] (-235.745) (-237.960) (-234.226) * (-236.101) (-236.039) [-237.694] (-236.111) -- 0:00:12
788000 -- (-236.358) [-236.031] (-235.678) (-235.290) * (-238.268) [-234.078] (-237.857) (-236.604) -- 0:00:12
788500 -- (-236.279) (-233.379) [-237.546] (-236.049) * (-234.924) [-233.636] (-236.552) (-235.664) -- 0:00:12
789000 -- (-238.003) [-235.607] (-237.436) (-234.288) * (-237.290) (-236.058) [-235.362] (-236.949) -- 0:00:12
789500 -- (-239.757) (-234.683) (-235.161) [-233.854] * (-233.864) [-233.507] (-235.843) (-235.895) -- 0:00:12
790000 -- (-237.787) [-239.104] (-235.638) (-236.627) * (-239.322) [-233.723] (-234.825) (-236.488) -- 0:00:12
Average standard deviation of split frequencies: 0.009204
790500 -- (-242.932) [-233.717] (-234.836) (-236.569) * (-234.567) (-239.267) [-239.621] (-238.050) -- 0:00:12
791000 -- (-235.593) (-237.603) [-234.651] (-234.861) * (-238.624) [-237.239] (-234.152) (-233.980) -- 0:00:12
791500 -- [-235.511] (-240.409) (-234.696) (-238.270) * [-235.665] (-234.883) (-239.871) (-235.267) -- 0:00:12
792000 -- (-238.051) (-237.739) (-233.790) [-235.203] * (-236.283) (-235.901) (-234.608) [-235.229] -- 0:00:12
792500 -- (-234.487) (-240.382) (-233.618) [-235.351] * (-234.461) (-236.130) (-234.563) [-233.436] -- 0:00:12
793000 -- (-235.161) [-237.720] (-236.035) (-234.447) * (-235.772) (-234.713) [-234.606] (-234.566) -- 0:00:12
793500 -- (-233.501) (-235.575) [-235.023] (-234.886) * [-235.066] (-234.422) (-233.555) (-235.235) -- 0:00:12
794000 -- (-233.973) [-234.724] (-236.493) (-234.879) * (-235.587) (-238.888) [-234.272] (-233.878) -- 0:00:12
794500 -- (-234.641) (-234.390) [-233.894] (-234.224) * [-240.080] (-237.279) (-235.344) (-236.126) -- 0:00:12
795000 -- [-236.124] (-238.707) (-235.969) (-239.466) * (-238.018) (-236.524) [-233.424] (-241.016) -- 0:00:12
Average standard deviation of split frequencies: 0.008735
795500 -- (-237.450) (-237.045) (-234.477) [-236.894] * [-235.193] (-234.499) (-235.608) (-235.020) -- 0:00:12
796000 -- (-238.379) [-234.536] (-238.429) (-234.915) * (-240.836) (-238.239) (-235.620) [-235.208] -- 0:00:12
796500 -- (-237.731) (-235.516) (-237.269) [-234.314] * (-234.985) (-235.742) [-237.165] (-234.622) -- 0:00:12
797000 -- (-239.923) (-236.307) [-234.936] (-235.997) * (-235.363) [-234.358] (-236.023) (-236.595) -- 0:00:12
797500 -- (-235.779) [-237.916] (-234.927) (-233.687) * (-238.898) (-233.185) (-234.784) [-234.312] -- 0:00:12
798000 -- (-234.206) (-234.188) [-234.199] (-236.126) * (-235.497) (-234.713) (-234.645) [-236.522] -- 0:00:12
798500 -- (-234.674) [-234.468] (-234.676) (-236.697) * (-234.713) (-235.878) [-233.539] (-235.024) -- 0:00:12
799000 -- (-234.067) (-238.242) [-236.054] (-235.991) * (-234.823) [-236.723] (-234.154) (-233.942) -- 0:00:12
799500 -- [-233.251] (-236.460) (-233.716) (-238.317) * (-234.899) [-235.817] (-236.828) (-236.241) -- 0:00:12
800000 -- [-236.309] (-238.819) (-236.160) (-236.821) * [-235.304] (-234.453) (-234.692) (-233.787) -- 0:00:12
Average standard deviation of split frequencies: 0.008868
800500 -- [-235.029] (-233.524) (-235.000) (-240.910) * (-235.607) (-234.020) [-233.871] (-236.298) -- 0:00:11
801000 -- [-234.458] (-233.656) (-235.014) (-236.200) * (-234.534) (-233.131) (-236.902) [-235.038] -- 0:00:11
801500 -- [-234.633] (-234.417) (-236.520) (-234.056) * [-233.984] (-234.072) (-239.857) (-237.257) -- 0:00:11
802000 -- (-235.349) [-234.600] (-233.088) (-235.871) * (-238.137) (-235.541) [-236.335] (-240.853) -- 0:00:11
802500 -- (-234.519) [-235.557] (-236.110) (-235.378) * [-236.138] (-234.530) (-240.282) (-237.596) -- 0:00:11
803000 -- (-236.496) [-233.349] (-236.859) (-237.862) * (-235.113) (-235.097) (-233.959) [-234.145] -- 0:00:11
803500 -- [-236.731] (-236.649) (-236.744) (-235.522) * (-235.804) [-236.526] (-233.210) (-235.850) -- 0:00:11
804000 -- [-239.349] (-234.086) (-239.187) (-233.355) * (-241.850) (-236.805) [-233.762] (-237.531) -- 0:00:11
804500 -- (-234.472) (-239.132) [-238.487] (-233.870) * (-234.968) (-237.251) [-235.328] (-240.553) -- 0:00:11
805000 -- (-234.552) (-234.896) [-233.896] (-234.608) * [-241.029] (-239.484) (-235.020) (-236.672) -- 0:00:11
Average standard deviation of split frequencies: 0.009248
805500 -- [-236.698] (-234.549) (-233.834) (-234.993) * (-241.918) [-233.362] (-237.510) (-237.233) -- 0:00:11
806000 -- [-239.867] (-234.837) (-234.399) (-236.515) * (-234.170) (-235.917) (-238.829) [-234.716] -- 0:00:11
806500 -- (-238.504) [-233.679] (-236.054) (-241.266) * (-234.398) (-233.668) (-239.087) [-234.365] -- 0:00:11
807000 -- [-239.061] (-236.412) (-235.593) (-234.803) * [-234.851] (-235.202) (-235.226) (-234.099) -- 0:00:11
807500 -- [-233.983] (-237.116) (-236.567) (-233.480) * (-239.398) (-234.695) [-236.881] (-235.017) -- 0:00:11
808000 -- (-235.995) (-239.098) [-235.168] (-233.295) * (-235.814) (-235.719) [-234.717] (-234.497) -- 0:00:11
808500 -- (-233.445) [-235.459] (-234.334) (-234.159) * (-233.454) [-234.623] (-236.783) (-238.090) -- 0:00:11
809000 -- [-235.084] (-235.158) (-233.554) (-233.795) * (-233.800) (-233.893) (-235.598) [-236.322] -- 0:00:11
809500 -- (-234.603) (-234.311) [-233.419] (-237.673) * (-235.004) (-238.913) (-237.942) [-233.748] -- 0:00:11
810000 -- (-234.624) (-243.316) (-233.233) [-235.129] * (-234.038) [-234.424] (-236.544) (-235.439) -- 0:00:11
Average standard deviation of split frequencies: 0.009050
810500 -- (-235.393) (-236.315) (-233.726) [-235.096] * (-243.554) [-233.258] (-233.128) (-234.529) -- 0:00:11
811000 -- (-237.257) (-237.557) [-234.336] (-234.569) * (-235.930) [-235.439] (-233.314) (-236.890) -- 0:00:11
811500 -- [-234.403] (-235.344) (-235.124) (-234.768) * (-234.989) (-237.721) (-233.845) [-235.155] -- 0:00:11
812000 -- [-240.731] (-234.222) (-234.849) (-234.840) * (-234.443) [-235.178] (-235.309) (-237.629) -- 0:00:11
812500 -- (-234.002) (-238.773) (-234.187) [-234.928] * [-234.092] (-235.306) (-234.432) (-237.360) -- 0:00:11
813000 -- (-234.970) (-234.453) (-235.150) [-234.521] * [-235.782] (-236.087) (-235.263) (-236.348) -- 0:00:11
813500 -- (-239.599) (-237.275) [-234.368] (-235.537) * (-235.157) (-234.948) (-238.834) [-237.596] -- 0:00:11
814000 -- (-236.734) [-237.236] (-235.063) (-236.385) * (-235.006) (-236.979) [-234.188] (-238.189) -- 0:00:11
814500 -- [-237.879] (-234.650) (-238.612) (-239.653) * [-235.649] (-233.964) (-237.392) (-237.247) -- 0:00:11
815000 -- (-234.322) (-234.018) (-234.237) [-235.381] * (-237.071) [-235.457] (-234.661) (-234.226) -- 0:00:11
Average standard deviation of split frequencies: 0.009135
815500 -- (-234.541) (-236.342) [-238.419] (-234.516) * (-240.693) (-238.030) (-233.452) [-233.412] -- 0:00:11
816000 -- (-233.566) [-235.653] (-236.395) (-237.558) * (-237.627) (-237.739) (-235.607) [-234.121] -- 0:00:11
816500 -- [-235.050] (-237.571) (-236.159) (-236.809) * [-235.185] (-237.796) (-234.624) (-234.998) -- 0:00:11
817000 -- (-243.339) (-236.007) [-238.437] (-236.855) * (-235.659) (-234.092) (-233.801) [-235.727] -- 0:00:10
817500 -- (-238.848) [-233.862] (-237.535) (-234.300) * (-237.962) (-240.004) (-233.609) [-235.640] -- 0:00:10
818000 -- (-238.435) (-237.408) (-233.965) [-235.515] * [-237.702] (-238.499) (-234.909) (-234.167) -- 0:00:10
818500 -- (-236.093) (-233.127) (-235.975) [-233.016] * (-238.183) (-236.615) (-234.988) [-233.466] -- 0:00:10
819000 -- (-235.095) (-235.957) [-234.005] (-237.629) * (-235.822) (-236.737) (-235.774) [-234.212] -- 0:00:10
819500 -- (-234.166) [-233.470] (-237.551) (-235.375) * (-235.029) [-234.042] (-240.383) (-235.047) -- 0:00:10
820000 -- (-234.432) [-232.937] (-243.407) (-234.450) * (-234.199) (-235.186) [-235.235] (-237.791) -- 0:00:10
Average standard deviation of split frequencies: 0.008796
820500 -- [-233.449] (-236.460) (-237.877) (-234.772) * (-234.642) (-234.620) [-235.281] (-238.486) -- 0:00:10
821000 -- (-235.136) [-234.283] (-234.556) (-233.543) * (-234.778) (-237.423) [-235.047] (-236.205) -- 0:00:10
821500 -- (-237.721) [-237.334] (-234.473) (-233.329) * (-236.241) [-233.600] (-233.179) (-235.040) -- 0:00:10
822000 -- (-234.348) (-235.914) (-234.298) [-234.225] * [-235.464] (-234.254) (-233.983) (-235.817) -- 0:00:10
822500 -- [-233.620] (-237.575) (-234.923) (-234.092) * (-235.125) (-234.909) [-234.079] (-234.783) -- 0:00:10
823000 -- (-233.987) [-233.990] (-233.652) (-234.964) * (-234.979) (-233.970) (-234.857) [-234.853] -- 0:00:10
823500 -- (-236.800) (-235.046) (-236.624) [-234.479] * (-235.192) (-234.220) (-234.754) [-234.414] -- 0:00:10
824000 -- (-235.136) (-237.020) (-235.844) [-234.340] * [-236.408] (-234.248) (-236.400) (-235.415) -- 0:00:10
824500 -- (-235.911) (-233.534) [-233.845] (-234.334) * (-233.972) (-235.446) [-236.989] (-234.947) -- 0:00:10
825000 -- (-233.923) (-239.279) [-234.774] (-234.943) * (-235.902) (-238.327) (-237.310) [-235.756] -- 0:00:10
Average standard deviation of split frequencies: 0.008953
825500 -- (-233.000) [-233.074] (-235.331) (-239.728) * (-235.545) (-233.808) [-235.760] (-237.733) -- 0:00:10
826000 -- (-234.146) (-233.440) [-234.589] (-235.887) * (-239.029) [-234.047] (-241.673) (-233.206) 