--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:53:53 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0525/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -234.64 -238.51
2 -234.63 -238.64
--------------------------------------
TOTAL -234.64 -238.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890759 0.093035 0.373417 1.515343 0.855872 1501.00 1501.00 1.000
r(A<->C){all} 0.163547 0.021189 0.000030 0.477694 0.120179 139.96 175.00 1.003
r(A<->G){all} 0.169576 0.022093 0.000038 0.473322 0.127536 213.96 215.36 1.000
r(A<->T){all} 0.171954 0.020561 0.000073 0.464065 0.133910 166.40 218.23 1.000
r(C<->G){all} 0.160595 0.019227 0.000011 0.443425 0.123870 291.16 396.32 1.001
r(C<->T){all} 0.171234 0.020441 0.000216 0.458397 0.135919 300.04 311.01 1.000
r(G<->T){all} 0.163093 0.018908 0.000037 0.440438 0.127398 202.54 217.82 1.000
pi(A){all} 0.136184 0.000695 0.087296 0.188564 0.135216 1316.51 1394.38 1.001
pi(C){all} 0.280537 0.001168 0.216484 0.347255 0.280108 976.58 1082.87 1.000
pi(G){all} 0.331519 0.001300 0.259578 0.398590 0.330319 1192.81 1279.22 1.000
pi(T){all} 0.251760 0.001055 0.191203 0.318041 0.252001 779.19 1054.80 1.000
alpha{1,2} 0.407429 0.234626 0.000111 1.363863 0.237115 1285.23 1315.56 1.000
alpha{3} 0.449963 0.225913 0.000185 1.421668 0.287054 1247.09 1374.05 1.000
pinvar{all} 0.990120 0.000142 0.968609 0.999994 0.993812 1081.51 1162.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -229.270025
Model 2: PositiveSelection -229.270011
Model 0: one-ratio -229.27003
Model 7: beta -229.270022
Model 8: beta&w>1 -229.270011
Model 0 vs 1 9.999999974752427E-6
Model 2 vs 1 2.7999999986150215E-5
Model 8 vs 7 2.200000000129876E-5
>C1
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C2
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C3
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C4
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C5
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C6
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=58
C1 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C2 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C3 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C4 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C5 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C6 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
**************************************************
C1 LDVPQPAP
C2 LDVPQPAP
C3 LDVPQPAP
C4 LDVPQPAP
C5 LDVPQPAP
C6 LDVPQPAP
********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 58 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 58 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1740]--->[1740]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.442 Mb, Max= 30.575 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C2 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C3 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C4 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C5 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
C6 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
**************************************************
C1 LDVPQPAP
C2 LDVPQPAP
C3 LDVPQPAP
C4 LDVPQPAP
C5 LDVPQPAP
C6 LDVPQPAP
********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C2 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C3 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C4 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C5 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
C6 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
**************************************************
C1 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C2 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C3 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C4 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C5 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
C6 CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
**************************************************
C1 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C2 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C3 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C4 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C5 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
C6 GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
**************************************************
C1 TTGGATGTCCCGCAGCCTGCCCCC
C2 TTGGATGTCCCGCAGCCTGCCCCC
C3 TTGGATGTCCCGCAGCCTGCCCCC
C4 TTGGATGTCCCGCAGCCTGCCCCC
C5 TTGGATGTCCCGCAGCCTGCCCCC
C6 TTGGATGTCCCGCAGCCTGCCCCC
************************
>C1
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C2
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C3
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C4
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C5
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C6
GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT
CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC
GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC
TTGGATGTCCCGCAGCCTGCCCCC
>C1
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C2
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C3
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C4
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C5
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
>C6
VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
LDVPQPAP
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 174 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579801950
Setting output file names to "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1550866114
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1247554456
Seed = 700052954
Swapseed = 1579801950
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -389.420317 -- -24.965149
Chain 2 -- -389.420340 -- -24.965149
Chain 3 -- -389.420340 -- -24.965149
Chain 4 -- -389.420317 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -389.420317 -- -24.965149
Chain 2 -- -389.420340 -- -24.965149
Chain 3 -- -389.420317 -- -24.965149
Chain 4 -- -389.420317 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-389.420] (-389.420) (-389.420) (-389.420) * [-389.420] (-389.420) (-389.420) (-389.420)
500 -- (-242.252) (-254.459) (-244.849) [-243.609] * (-255.403) (-245.108) [-241.009] (-246.278) -- 0:00:00
1000 -- (-244.051) (-254.750) [-243.094] (-238.809) * (-250.148) [-245.773] (-238.792) (-239.452) -- 0:00:00
1500 -- [-242.818] (-240.220) (-238.990) (-246.346) * (-248.700) (-245.058) [-240.482] (-243.622) -- 0:00:00
2000 -- [-243.234] (-243.934) (-246.090) (-243.459) * (-247.799) (-243.011) [-247.407] (-247.026) -- 0:00:00
2500 -- (-238.278) (-245.101) (-247.105) [-239.826] * (-239.952) (-242.914) (-242.086) [-242.598] -- 0:06:39
3000 -- (-240.668) [-244.953] (-241.705) (-240.294) * [-241.096] (-240.898) (-244.507) (-247.328) -- 0:05:32
3500 -- (-243.107) (-243.900) [-245.657] (-242.497) * [-238.907] (-246.361) (-240.643) (-244.241) -- 0:04:44
4000 -- (-246.190) (-245.656) (-244.785) [-243.762] * (-248.555) [-241.278] (-242.057) (-243.845) -- 0:04:09
4500 -- (-241.717) (-248.719) [-241.525] (-246.387) * (-246.941) (-245.478) [-243.200] (-247.351) -- 0:03:41
5000 -- [-246.386] (-241.751) (-243.833) (-238.499) * [-240.361] (-252.157) (-242.446) (-246.854) -- 0:03:19
Average standard deviation of split frequencies: 0.099995
5500 -- [-244.229] (-256.754) (-255.362) (-246.164) * (-243.297) [-241.482] (-246.780) (-241.429) -- 0:03:00
6000 -- (-245.680) (-247.324) [-241.918] (-247.280) * [-238.179] (-255.321) (-252.751) (-250.891) -- 0:02:45
6500 -- (-242.066) [-247.786] (-242.256) (-246.284) * [-243.447] (-243.390) (-244.140) (-247.446) -- 0:02:32
7000 -- (-241.377) (-245.428) [-245.465] (-243.349) * (-243.335) (-248.548) (-244.626) [-246.582] -- 0:02:21
7500 -- (-240.527) [-243.460] (-245.565) (-251.010) * (-250.626) [-241.435] (-244.564) (-242.631) -- 0:02:12
8000 -- (-246.122) (-245.270) [-241.017] (-251.630) * (-247.704) [-243.487] (-246.360) (-252.176) -- 0:02:04
8500 -- (-250.006) (-246.773) [-247.989] (-236.751) * (-249.783) [-242.441] (-249.146) (-251.569) -- 0:01:56
9000 -- (-242.107) (-259.490) [-246.223] (-233.225) * [-243.385] (-253.884) (-253.287) (-251.512) -- 0:01:50
9500 -- (-246.800) (-243.821) (-249.034) [-233.826] * [-247.147] (-240.802) (-248.054) (-245.125) -- 0:01:44
10000 -- [-243.652] (-240.231) (-245.076) (-233.433) * (-254.017) (-236.719) [-248.284] (-249.811) -- 0:01:39
Average standard deviation of split frequencies: 0.077340
10500 -- (-241.600) (-235.544) (-237.607) [-233.359] * (-259.050) (-236.352) (-241.438) [-248.999] -- 0:01:34
11000 -- (-242.663) (-233.601) (-245.561) [-235.282] * (-244.237) (-235.910) [-243.309] (-242.045) -- 0:01:29
11500 -- (-245.825) (-238.148) (-243.376) [-234.626] * (-243.786) [-234.000] (-241.449) (-244.733) -- 0:01:25
12000 -- (-243.360) (-236.572) [-248.010] (-233.973) * (-251.621) (-236.548) [-241.565] (-243.176) -- 0:01:22
12500 -- (-247.665) [-235.403] (-248.922) (-233.856) * (-243.203) (-234.761) (-243.419) [-240.201] -- 0:01:19
13000 -- [-245.946] (-234.514) (-249.783) (-233.594) * (-236.874) [-237.813] (-243.079) (-241.046) -- 0:01:15
13500 -- (-240.119) [-234.020] (-248.438) (-234.336) * (-246.045) (-236.553) (-243.254) [-243.275] -- 0:01:13
14000 -- (-248.492) (-235.591) (-240.136) [-236.563] * [-247.595] (-234.909) (-245.203) (-243.288) -- 0:01:10
14500 -- [-241.410] (-234.826) (-246.795) (-237.075) * (-246.047) [-235.076] (-243.600) (-247.045) -- 0:01:07
15000 -- (-247.392) (-236.201) [-251.712] (-235.184) * (-253.612) [-235.463] (-240.664) (-247.910) -- 0:01:05
Average standard deviation of split frequencies: 0.064818
15500 -- [-243.236] (-237.802) (-242.326) (-235.263) * (-248.839) [-239.177] (-244.849) (-256.912) -- 0:01:03
16000 -- (-244.997) [-236.346] (-240.626) (-233.740) * [-246.342] (-234.198) (-253.767) (-247.937) -- 0:01:01
16500 -- (-243.015) (-234.284) (-236.776) [-236.828] * (-243.054) [-236.006] (-250.468) (-249.386) -- 0:00:59
17000 -- (-248.046) (-239.891) (-235.758) [-236.314] * (-249.577) (-233.608) (-252.478) [-249.008] -- 0:00:57
17500 -- [-247.230] (-233.862) (-235.291) (-236.264) * (-244.935) (-236.928) (-246.649) [-250.964] -- 0:00:56
18000 -- (-245.874) (-233.484) (-234.828) [-233.663] * (-244.163) (-235.345) [-244.109] (-245.610) -- 0:00:54
18500 -- (-244.347) (-235.522) (-235.955) [-234.697] * [-238.834] (-237.692) (-244.059) (-253.502) -- 0:00:53
19000 -- (-249.830) (-234.758) (-235.978) [-234.809] * [-233.866] (-236.937) (-250.789) (-247.196) -- 0:01:43
19500 -- (-254.412) (-235.622) [-235.897] (-233.849) * [-234.271] (-237.340) (-250.403) (-236.775) -- 0:01:40
20000 -- (-235.995) (-234.413) (-236.179) [-233.475] * [-233.221] (-233.253) (-249.587) (-235.598) -- 0:01:38
Average standard deviation of split frequencies: 0.057025
20500 -- (-236.501) (-234.499) (-235.793) [-235.498] * [-233.747] (-236.019) (-250.765) (-236.304) -- 0:01:35
21000 -- (-235.554) [-234.586] (-239.148) (-236.800) * (-235.291) (-237.191) (-253.082) [-240.204] -- 0:01:33
21500 -- (-234.206) (-236.813) [-236.045] (-235.650) * [-233.487] (-236.145) (-240.461) (-241.038) -- 0:01:31
22000 -- (-236.983) [-235.772] (-236.265) (-233.248) * (-234.390) [-233.206] (-239.338) (-234.579) -- 0:01:28
22500 -- (-238.786) (-235.590) (-233.952) [-234.731] * (-234.424) (-235.272) [-240.084] (-235.601) -- 0:01:26
23000 -- (-234.389) (-234.798) (-233.334) [-235.107] * [-236.783] (-234.575) (-238.026) (-235.805) -- 0:01:24
23500 -- (-237.817) [-233.921] (-235.426) (-236.470) * [-233.828] (-234.987) (-239.809) (-235.862) -- 0:01:23
24000 -- [-235.995] (-233.299) (-234.671) (-236.954) * (-236.158) (-239.080) [-235.094] (-234.346) -- 0:01:21
24500 -- (-236.534) (-237.379) [-235.375] (-233.680) * (-235.263) (-233.530) (-235.720) [-235.914] -- 0:01:19
25000 -- (-234.462) (-235.619) [-235.870] (-235.529) * (-236.450) (-234.462) [-235.164] (-239.028) -- 0:01:18
Average standard deviation of split frequencies: 0.046151
25500 -- (-236.125) [-236.197] (-232.990) (-234.990) * [-233.258] (-234.987) (-233.372) (-234.856) -- 0:01:16
26000 -- (-238.064) [-233.508] (-239.580) (-237.665) * (-233.075) (-233.645) (-236.447) [-236.104] -- 0:01:14
26500 -- [-237.334] (-237.210) (-233.191) (-235.228) * [-234.055] (-233.671) (-233.968) (-237.036) -- 0:01:13
27000 -- [-236.259] (-237.313) (-234.489) (-235.921) * (-237.420) (-237.191) (-233.895) [-236.956] -- 0:01:12
27500 -- (-238.633) (-236.914) [-233.416] (-234.005) * [-233.768] (-237.421) (-234.411) (-235.975) -- 0:01:10
28000 -- (-234.382) (-242.832) (-233.937) [-234.908] * (-234.486) (-241.415) [-234.006] (-235.764) -- 0:01:09
28500 -- [-234.359] (-238.671) (-235.954) (-235.297) * (-233.948) [-238.974] (-237.635) (-234.317) -- 0:01:08
29000 -- [-235.578] (-234.992) (-234.228) (-239.132) * (-235.729) (-235.622) [-233.800] (-236.900) -- 0:01:06
29500 -- (-236.703) (-237.749) (-234.680) [-238.641] * (-233.805) [-234.652] (-234.276) (-241.237) -- 0:01:05
30000 -- (-234.950) (-235.458) [-238.065] (-234.895) * (-233.809) (-233.296) [-234.782] (-237.286) -- 0:01:04
Average standard deviation of split frequencies: 0.043188
30500 -- (-236.653) (-236.791) [-238.784] (-236.515) * (-234.925) (-234.832) [-234.732] (-234.692) -- 0:01:03
31000 -- (-236.345) (-234.592) [-238.314] (-239.188) * [-235.485] (-233.877) (-235.583) (-234.319) -- 0:01:02
31500 -- (-233.323) [-233.462] (-238.629) (-234.761) * [-236.937] (-235.189) (-239.258) (-234.664) -- 0:01:01
32000 -- (-235.892) [-235.250] (-237.788) (-237.528) * (-237.601) (-234.080) [-233.874] (-233.634) -- 0:01:00
32500 -- (-233.638) (-234.266) [-234.407] (-233.559) * [-233.558] (-234.616) (-236.118) (-235.520) -- 0:00:59
33000 -- (-233.557) [-237.312] (-236.194) (-236.266) * [-235.730] (-238.864) (-234.766) (-233.392) -- 0:00:58
33500 -- (-233.402) (-236.362) [-233.821] (-234.087) * (-235.511) (-238.017) (-235.723) [-235.856] -- 0:00:57
34000 -- (-233.743) (-234.849) [-234.430] (-235.857) * (-236.877) [-237.894] (-243.339) (-238.442) -- 0:00:56
34500 -- (-236.417) [-233.400] (-237.533) (-234.881) * [-237.216] (-236.471) (-236.361) (-234.081) -- 0:00:55
35000 -- (-233.972) [-235.111] (-237.905) (-236.535) * (-235.201) [-234.994] (-233.877) (-235.024) -- 0:00:55
Average standard deviation of split frequencies: 0.036203
35500 -- (-236.856) [-234.576] (-235.910) (-237.379) * (-235.701) (-235.242) (-236.644) [-237.657] -- 0:00:54
36000 -- (-234.027) [-233.688] (-235.652) (-235.087) * (-234.986) (-241.780) (-234.484) [-235.104] -- 0:00:53
36500 -- (-233.457) (-238.490) [-234.405] (-233.819) * [-234.538] (-235.225) (-238.694) (-237.792) -- 0:01:19
37000 -- (-234.110) (-236.791) [-233.665] (-235.278) * (-235.801) (-235.985) [-236.181] (-236.268) -- 0:01:18
37500 -- (-233.383) (-235.205) [-233.517] (-234.575) * (-235.156) [-235.333] (-236.459) (-233.524) -- 0:01:17
38000 -- (-233.962) [-235.272] (-235.118) (-237.928) * (-242.140) [-234.927] (-233.685) (-242.771) -- 0:01:15
38500 -- (-235.800) [-234.844] (-234.563) (-235.991) * (-234.551) [-235.029] (-240.639) (-235.600) -- 0:01:14
39000 -- [-236.317] (-238.177) (-235.977) (-236.239) * (-235.308) (-235.938) (-234.908) [-235.830] -- 0:01:13
39500 -- (-236.572) (-234.564) (-237.146) [-234.035] * (-233.588) (-235.387) (-235.206) [-234.169] -- 0:01:12
40000 -- (-234.710) (-236.082) (-236.700) [-234.547] * (-233.333) [-234.745] (-237.068) (-233.506) -- 0:01:12
Average standard deviation of split frequencies: 0.031556
40500 -- (-233.834) (-234.552) [-235.773] (-234.590) * (-237.276) [-233.734] (-237.980) (-234.843) -- 0:01:11
41000 -- (-234.668) (-238.910) [-233.777] (-236.469) * (-235.006) (-236.662) (-238.166) [-236.457] -- 0:01:10
41500 -- (-235.162) (-235.144) [-234.354] (-234.346) * (-244.026) (-234.866) [-234.277] (-238.539) -- 0:01:09
42000 -- (-237.064) [-235.443] (-238.159) (-234.598) * (-238.199) [-233.065] (-233.919) (-236.356) -- 0:01:08
42500 -- [-236.250] (-238.270) (-235.426) (-234.869) * (-242.948) [-233.485] (-233.938) (-234.505) -- 0:01:07
43000 -- (-232.898) (-236.097) (-236.500) [-235.024] * [-235.580] (-236.125) (-233.076) (-235.792) -- 0:01:06
43500 -- (-235.500) [-237.574] (-233.979) (-238.755) * [-235.467] (-236.009) (-236.222) (-234.680) -- 0:01:05
44000 -- [-234.438] (-236.019) (-234.149) (-234.431) * (-237.297) (-237.029) (-236.845) [-234.485] -- 0:01:05
44500 -- (-234.302) [-239.587] (-235.308) (-234.699) * [-237.137] (-233.797) (-234.968) (-233.465) -- 0:01:04
45000 -- (-234.057) [-234.772] (-236.643) (-233.096) * (-235.269) [-234.207] (-233.303) (-236.717) -- 0:01:03
Average standard deviation of split frequencies: 0.032208
45500 -- (-234.464) (-236.309) (-234.728) [-233.164] * [-234.724] (-237.264) (-234.949) (-235.194) -- 0:01:02
46000 -- (-237.300) (-235.037) [-233.466] (-234.953) * (-234.385) (-234.013) (-235.324) [-235.387] -- 0:01:02
46500 -- [-233.656] (-235.912) (-235.334) (-236.528) * (-238.485) (-236.627) (-235.975) [-236.062] -- 0:01:01
47000 -- (-234.645) (-233.886) [-235.016] (-233.495) * (-235.888) [-235.931] (-233.340) (-233.003) -- 0:01:00
47500 -- (-236.866) [-235.870] (-237.727) (-233.665) * (-236.091) (-235.293) (-233.687) [-234.611] -- 0:01:00
48000 -- (-237.874) (-234.234) [-233.476] (-233.559) * (-237.212) [-235.012] (-234.617) (-235.242) -- 0:00:59
48500 -- (-239.826) [-235.931] (-233.757) (-233.932) * [-236.277] (-237.409) (-236.329) (-234.722) -- 0:00:58
49000 -- (-236.581) (-234.138) [-234.337] (-235.456) * (-237.892) (-233.640) [-233.952] (-235.826) -- 0:00:58
49500 -- [-237.966] (-234.307) (-235.204) (-239.835) * (-238.372) (-234.152) [-235.008] (-237.065) -- 0:00:57
50000 -- [-235.417] (-237.386) (-235.918) (-239.554) * (-236.340) (-236.116) (-234.142) [-237.543] -- 0:00:57
Average standard deviation of split frequencies: 0.030703
50500 -- [-234.976] (-234.816) (-236.532) (-238.897) * (-236.555) (-241.217) (-233.923) [-237.200] -- 0:00:56
51000 -- (-234.109) [-234.798] (-236.386) (-235.092) * (-236.437) (-235.816) (-235.061) [-238.586] -- 0:00:55
51500 -- [-235.047] (-234.083) (-233.707) (-236.842) * [-235.872] (-234.330) (-234.511) (-233.771) -- 0:00:55
52000 -- (-237.205) (-234.515) (-233.719) [-236.045] * (-234.018) (-237.197) [-237.306] (-237.183) -- 0:00:54
52500 -- [-234.721] (-234.299) (-234.835) (-237.618) * [-234.605] (-235.546) (-236.869) (-233.656) -- 0:00:54
53000 -- (-240.699) [-239.471] (-236.643) (-236.273) * [-234.422] (-235.090) (-240.558) (-235.271) -- 0:00:53
53500 -- (-236.803) (-235.101) (-235.737) [-237.637] * [-236.073] (-234.098) (-237.100) (-234.996) -- 0:01:10
54000 -- (-235.524) [-236.691] (-235.042) (-233.565) * (-236.658) (-237.123) (-236.148) [-234.381] -- 0:01:10
54500 -- (-237.066) (-236.598) (-236.847) [-233.302] * (-235.060) [-233.645] (-235.021) (-235.690) -- 0:01:09
55000 -- (-236.688) (-235.756) [-237.731] (-236.642) * [-238.871] (-237.352) (-235.191) (-233.858) -- 0:01:08
Average standard deviation of split frequencies: 0.028798
55500 -- (-236.405) (-234.740) (-235.294) [-235.667] * [-234.552] (-234.460) (-235.879) (-235.462) -- 0:01:08
56000 -- (-234.026) (-234.734) (-234.334) [-236.299] * (-235.568) [-234.267] (-235.496) (-234.322) -- 0:01:07
56500 -- [-236.147] (-235.704) (-233.917) (-236.096) * [-234.780] (-243.333) (-239.137) (-234.272) -- 0:01:06
57000 -- [-234.025] (-236.957) (-235.001) (-236.010) * (-235.856) (-236.122) (-235.946) [-234.632] -- 0:01:06
57500 -- (-234.443) (-238.169) (-236.723) [-233.694] * (-234.416) (-234.841) [-235.159] (-234.404) -- 0:01:05
58000 -- (-235.108) (-234.240) (-236.729) [-236.525] * [-233.416] (-235.384) (-235.184) (-235.266) -- 0:01:04
58500 -- (-236.713) (-238.263) (-237.072) [-233.509] * [-237.361] (-234.274) (-236.705) (-236.424) -- 0:01:04
59000 -- (-233.764) (-235.696) (-235.793) [-236.271] * [-238.591] (-239.722) (-233.200) (-233.787) -- 0:01:03
59500 -- (-234.969) (-233.333) [-235.933] (-237.437) * (-235.426) (-239.049) (-236.325) [-235.800] -- 0:01:03
60000 -- (-237.956) (-233.842) [-236.703] (-235.464) * (-235.257) (-235.226) (-236.779) [-235.841] -- 0:01:02
Average standard deviation of split frequencies: 0.026174
60500 -- (-235.122) (-237.261) (-235.113) [-234.561] * (-234.712) [-236.109] (-234.124) (-234.460) -- 0:01:02
61000 -- (-235.149) [-235.941] (-237.668) (-234.972) * (-236.281) [-233.917] (-234.438) (-235.127) -- 0:01:01
61500 -- [-237.246] (-235.083) (-233.860) (-236.645) * (-235.679) [-236.502] (-235.386) (-234.140) -- 0:01:01
62000 -- [-237.863] (-234.863) (-236.772) (-234.624) * (-235.913) (-236.678) [-234.043] (-233.347) -- 0:01:00
62500 -- (-237.419) [-235.283] (-238.881) (-236.112) * (-237.899) [-234.704] (-235.922) (-237.537) -- 0:01:00
63000 -- (-235.062) (-235.922) [-233.973] (-237.226) * (-237.295) (-242.104) (-237.172) [-234.546] -- 0:00:59
63500 -- (-235.085) (-234.617) (-237.168) [-235.728] * (-236.739) [-235.504] (-236.571) (-237.253) -- 0:00:58
64000 -- [-235.040] (-234.590) (-236.762) (-233.520) * [-235.355] (-234.248) (-236.891) (-237.689) -- 0:00:58
64500 -- (-234.108) (-236.171) [-236.218] (-235.864) * (-235.358) (-239.703) (-233.158) [-235.462] -- 0:00:58
65000 -- (-234.711) (-235.233) [-233.671] (-235.008) * (-236.446) [-234.636] (-233.895) (-233.744) -- 0:00:57
Average standard deviation of split frequencies: 0.024642
65500 -- (-236.046) [-239.138] (-235.375) (-234.756) * (-236.209) (-234.173) (-237.898) [-233.420] -- 0:00:57
66000 -- (-237.670) (-244.225) (-238.477) [-233.284] * [-234.874] (-236.191) (-240.237) (-236.707) -- 0:00:56
66500 -- [-233.627] (-237.238) (-236.465) (-233.018) * (-235.411) [-234.172] (-234.066) (-235.397) -- 0:00:56
67000 -- (-235.218) [-237.544] (-235.508) (-233.440) * (-234.227) (-234.206) (-234.541) [-237.470] -- 0:00:55
67500 -- (-234.577) [-233.445] (-233.638) (-234.660) * (-235.509) [-235.791] (-235.066) (-234.766) -- 0:00:55
68000 -- (-238.597) (-234.810) (-233.476) [-235.262] * (-237.919) (-235.905) (-237.819) [-238.144] -- 0:00:54
68500 -- (-237.530) (-234.478) (-235.811) [-234.555] * (-234.931) (-235.218) [-233.445] (-239.047) -- 0:00:54
69000 -- [-237.264] (-234.922) (-234.761) (-236.469) * [-234.932] (-236.463) (-235.271) (-234.558) -- 0:00:53
69500 -- (-237.383) (-238.748) [-238.857] (-237.090) * [-235.161] (-234.706) (-238.226) (-236.267) -- 0:00:53
70000 -- (-235.617) (-234.005) (-243.351) [-233.750] * (-235.829) [-239.000] (-238.983) (-238.740) -- 0:00:53
Average standard deviation of split frequencies: 0.019310
70500 -- [-237.449] (-234.913) (-236.415) (-234.059) * [-234.608] (-235.328) (-243.100) (-237.331) -- 0:01:05
71000 -- (-239.219) (-234.115) (-235.279) [-236.199] * (-235.628) (-235.790) [-234.656] (-236.376) -- 0:01:05
71500 -- (-239.102) (-237.627) (-233.080) [-236.818] * (-234.442) (-234.786) (-237.471) [-234.286] -- 0:01:04
72000 -- [-234.014] (-239.530) (-241.279) (-236.712) * (-235.222) (-238.192) [-233.433] (-235.941) -- 0:01:04
72500 -- [-233.181] (-234.533) (-238.392) (-234.896) * (-235.830) (-233.997) [-233.078] (-232.937) -- 0:01:03
73000 -- [-233.092] (-233.688) (-235.374) (-234.774) * (-233.605) (-235.054) [-234.619] (-234.169) -- 0:01:03
73500 -- (-234.815) (-239.485) [-236.087] (-235.116) * (-236.141) (-237.089) [-235.735] (-237.691) -- 0:01:03
74000 -- (-240.702) [-234.027] (-233.287) (-233.930) * [-238.458] (-234.152) (-234.230) (-242.591) -- 0:01:02
74500 -- (-236.518) [-237.045] (-236.815) (-236.311) * (-235.423) (-234.408) [-238.494] (-240.516) -- 0:01:02
75000 -- (-237.611) (-239.669) (-235.598) [-234.391] * (-235.390) (-234.048) [-234.711] (-235.426) -- 0:01:01
Average standard deviation of split frequencies: 0.021873
75500 -- (-234.244) (-235.744) [-238.184] (-234.212) * (-235.549) (-233.909) [-234.172] (-238.605) -- 0:01:01
76000 -- [-235.458] (-236.041) (-234.705) (-234.207) * (-234.871) (-235.035) (-234.571) [-242.344] -- 0:01:00
76500 -- (-238.165) (-240.780) (-242.305) [-235.832] * (-235.818) [-239.207] (-235.385) (-235.669) -- 0:01:00
77000 -- (-240.253) (-235.957) (-233.423) [-234.188] * (-233.841) (-241.508) (-233.466) [-239.435] -- 0:00:59
77500 -- (-239.886) (-236.756) [-235.092] (-239.244) * (-235.011) [-236.023] (-235.663) (-238.549) -- 0:00:59
78000 -- (-237.375) (-237.560) [-234.808] (-234.270) * (-235.754) (-234.154) (-234.934) [-234.072] -- 0:00:59
78500 -- [-233.146] (-235.551) (-237.114) (-237.031) * (-235.240) [-235.968] (-236.811) (-233.811) -- 0:00:58
79000 -- (-236.416) [-235.748] (-240.097) (-234.240) * (-236.794) (-234.255) (-237.188) [-233.327] -- 0:00:58
79500 -- [-233.517] (-234.369) (-234.340) (-234.608) * [-234.601] (-236.027) (-235.112) (-235.147) -- 0:00:57
80000 -- (-233.724) (-236.034) [-237.076] (-233.963) * (-233.789) [-236.939] (-237.090) (-237.158) -- 0:00:57
Average standard deviation of split frequencies: 0.023683
80500 -- (-238.751) (-233.488) [-236.272] (-236.429) * [-237.944] (-234.013) (-238.774) (-237.165) -- 0:00:57
81000 -- [-237.060] (-236.251) (-234.293) (-235.767) * [-233.371] (-234.741) (-237.817) (-236.971) -- 0:00:56
81500 -- (-234.864) [-233.577] (-238.683) (-240.959) * (-233.728) (-235.621) [-236.117] (-235.230) -- 0:00:56
82000 -- (-234.590) (-233.074) (-234.638) [-234.835] * (-234.108) (-234.446) [-235.368] (-236.903) -- 0:00:55
82500 -- [-234.400] (-234.211) (-239.386) (-233.917) * (-234.932) [-239.367] (-236.110) (-234.151) -- 0:00:55
83000 -- [-233.400] (-234.277) (-236.453) (-234.947) * (-241.529) (-235.433) [-236.424] (-234.840) -- 0:00:55
83500 -- (-237.932) (-233.445) [-235.113] (-234.229) * (-236.131) [-234.946] (-238.145) (-237.449) -- 0:00:54
84000 -- [-235.671] (-236.359) (-238.906) (-235.023) * (-236.824) (-235.271) [-234.641] (-240.290) -- 0:00:54
84500 -- (-234.833) (-236.815) (-235.566) [-235.966] * (-235.389) (-233.725) (-236.122) [-233.952] -- 0:00:54
85000 -- (-235.537) [-235.969] (-234.420) (-234.718) * (-234.978) (-236.434) (-236.134) [-233.857] -- 0:00:53
Average standard deviation of split frequencies: 0.024811
85500 -- (-235.812) (-235.441) [-239.433] (-235.690) * (-233.703) [-236.438] (-235.139) (-235.122) -- 0:00:53
86000 -- [-237.771] (-235.524) (-234.375) (-234.887) * (-237.009) [-234.611] (-235.905) (-235.320) -- 0:00:53
86500 -- (-234.140) (-233.527) [-234.561] (-234.820) * (-235.280) (-237.808) (-234.337) [-236.285] -- 0:00:52
87000 -- [-234.226] (-234.212) (-237.064) (-235.740) * [-233.330] (-234.990) (-239.626) (-233.718) -- 0:00:52
87500 -- (-234.569) (-237.500) [-236.734] (-235.051) * (-236.190) [-234.848] (-233.676) (-234.969) -- 0:01:02
88000 -- (-240.382) [-236.608] (-235.279) (-233.559) * (-234.196) (-234.109) (-236.207) [-234.449] -- 0:01:02
88500 -- (-235.749) [-238.189] (-236.683) (-233.550) * [-236.490] (-234.588) (-236.104) (-235.803) -- 0:01:01
89000 -- (-236.808) (-233.264) [-240.108] (-234.093) * (-234.720) (-233.500) [-234.472] (-236.537) -- 0:01:01
89500 -- [-234.102] (-234.728) (-243.515) (-235.234) * [-236.378] (-236.314) (-235.141) (-233.888) -- 0:01:01
90000 -- (-233.726) [-234.058] (-242.582) (-236.013) * (-236.888) [-233.462] (-237.772) (-235.808) -- 0:01:00
Average standard deviation of split frequencies: 0.024081
90500 -- (-235.208) (-234.926) [-235.887] (-237.783) * (-235.132) [-236.853] (-234.871) (-236.923) -- 0:01:00
91000 -- (-236.852) (-233.923) (-233.987) [-237.123] * (-237.674) (-234.646) [-234.771] (-234.782) -- 0:00:59
91500 -- (-236.630) [-236.758] (-236.070) (-234.891) * [-236.032] (-233.926) (-236.745) (-234.100) -- 0:00:59
92000 -- [-236.289] (-237.320) (-236.945) (-235.238) * (-233.855) (-235.882) [-235.332] (-235.129) -- 0:00:59
92500 -- (-236.823) (-236.935) (-235.082) [-233.911] * (-234.496) (-238.018) (-234.253) [-233.421] -- 0:00:58
93000 -- (-236.962) (-235.317) [-236.365] (-235.806) * [-233.577] (-237.690) (-235.084) (-234.007) -- 0:00:58
93500 -- (-236.912) (-237.997) (-237.777) [-234.042] * [-234.369] (-233.667) (-235.137) (-236.113) -- 0:00:58
94000 -- (-235.214) [-235.139] (-237.483) (-237.812) * (-234.830) (-233.984) [-235.243] (-237.956) -- 0:00:57
94500 -- (-234.066) [-233.586] (-236.728) (-239.405) * [-234.539] (-234.552) (-233.926) (-235.321) -- 0:00:57
95000 -- (-237.545) [-233.764] (-235.605) (-237.768) * [-234.744] (-235.427) (-235.520) (-234.984) -- 0:00:57
Average standard deviation of split frequencies: 0.022743
95500 -- [-234.312] (-234.714) (-234.316) (-234.383) * (-235.897) (-236.544) (-233.512) [-234.583] -- 0:00:56
96000 -- (-237.511) (-235.987) (-234.536) [-235.627] * (-238.992) (-237.096) (-235.672) [-233.951] -- 0:00:56
96500 -- [-237.225] (-239.043) (-237.141) (-237.360) * (-235.523) [-235.916] (-235.998) (-235.758) -- 0:00:56
97000 -- [-237.128] (-234.158) (-236.989) (-233.894) * (-234.999) (-233.688) (-233.554) [-234.115] -- 0:00:55
97500 -- [-236.779] (-234.694) (-235.610) (-233.703) * (-233.961) (-237.667) [-233.409] (-235.526) -- 0:00:55
98000 -- [-235.636] (-239.495) (-235.201) (-235.163) * [-234.265] (-239.992) (-236.093) (-240.326) -- 0:00:55
98500 -- [-235.863] (-239.906) (-238.327) (-233.775) * (-234.404) [-234.681] (-238.438) (-235.895) -- 0:00:54
99000 -- (-237.696) (-234.582) [-237.306] (-235.495) * (-236.509) (-235.379) [-237.519] (-235.710) -- 0:00:54
99500 -- [-234.734] (-235.174) (-236.196) (-233.846) * (-235.360) (-235.335) [-237.296] (-237.026) -- 0:00:54
100000 -- (-234.343) (-233.527) (-236.858) [-234.153] * (-234.367) (-233.870) [-237.139] (-245.192) -- 0:00:54
Average standard deviation of split frequencies: 0.020292
100500 -- [-236.675] (-241.119) (-236.582) (-234.504) * (-233.995) (-236.690) [-235.354] (-237.160) -- 0:00:53
101000 -- (-236.223) (-233.842) [-233.943] (-236.617) * (-234.084) (-235.750) (-234.591) [-234.978] -- 0:00:53
101500 -- [-234.504] (-234.881) (-236.184) (-235.121) * (-236.828) [-234.494] (-237.346) (-243.797) -- 0:00:53
102000 -- [-235.120] (-233.976) (-234.238) (-234.176) * (-235.886) [-235.166] (-240.798) (-239.592) -- 0:00:52
102500 -- [-234.401] (-233.475) (-234.835) (-236.650) * (-234.313) [-236.103] (-233.786) (-240.638) -- 0:00:52
103000 -- (-233.788) [-235.506] (-235.971) (-235.170) * [-235.061] (-238.901) (-235.807) (-233.475) -- 0:00:52
103500 -- (-235.493) [-232.949] (-235.571) (-233.721) * (-233.956) (-233.863) (-243.812) [-234.762] -- 0:00:51
104000 -- [-233.359] (-233.713) (-238.220) (-235.079) * (-234.715) (-233.770) [-235.330] (-234.430) -- 0:00:51
104500 -- (-236.157) (-234.067) (-239.018) [-233.238] * [-233.097] (-236.208) (-234.623) (-236.278) -- 0:00:59
105000 -- (-234.482) (-236.235) (-233.305) [-233.408] * (-235.511) (-235.090) [-235.067] (-234.514) -- 0:00:59
Average standard deviation of split frequencies: 0.016455
105500 -- (-236.594) (-233.159) (-235.715) [-235.606] * (-236.531) (-238.594) [-233.787] (-233.304) -- 0:00:59
106000 -- [-235.209] (-237.830) (-238.581) (-234.757) * (-236.665) (-234.104) [-235.290] (-234.111) -- 0:00:59
106500 -- (-234.511) [-233.613] (-235.903) (-239.806) * [-235.506] (-238.316) (-235.014) (-234.990) -- 0:00:58
107000 -- (-235.037) [-234.238] (-234.479) (-234.531) * (-233.989) (-235.282) [-234.900] (-235.380) -- 0:00:58
107500 -- (-239.613) [-235.833] (-235.425) (-233.328) * (-234.348) [-236.119] (-233.611) (-237.665) -- 0:00:58
108000 -- (-240.173) (-235.021) [-233.979] (-239.199) * (-236.912) (-235.178) [-236.425] (-235.979) -- 0:00:57
108500 -- (-237.656) (-234.840) [-234.785] (-238.780) * [-234.015] (-236.535) (-233.262) (-235.213) -- 0:00:57
109000 -- (-235.830) (-234.331) [-233.754] (-237.201) * [-233.875] (-237.282) (-234.999) (-235.579) -- 0:00:57
109500 -- (-235.700) (-233.256) (-234.512) [-240.647] * [-234.746] (-239.769) (-234.367) (-235.516) -- 0:00:56
110000 -- (-234.349) [-233.853] (-236.429) (-240.203) * [-233.111] (-235.037) (-235.691) (-234.328) -- 0:00:56
Average standard deviation of split frequencies: 0.016802
110500 -- [-233.710] (-234.417) (-236.185) (-234.532) * (-235.247) (-239.691) [-237.894] (-234.607) -- 0:00:56
111000 -- [-233.252] (-235.267) (-237.377) (-235.729) * [-234.898] (-233.949) (-238.863) (-236.942) -- 0:00:56
111500 -- [-234.548] (-234.419) (-234.301) (-235.716) * (-236.866) [-236.106] (-235.098) (-239.133) -- 0:00:55
112000 -- (-234.307) [-236.278] (-239.635) (-235.664) * (-234.273) (-236.461) (-242.003) [-237.280] -- 0:00:55
112500 -- (-234.483) (-237.234) [-236.912] (-235.441) * [-236.959] (-234.666) (-234.097) (-235.116) -- 0:00:55
113000 -- [-236.609] (-235.704) (-236.490) (-237.396) * [-235.329] (-241.987) (-238.666) (-237.663) -- 0:00:54
113500 -- (-234.612) (-234.968) (-239.735) [-236.430] * (-234.588) (-235.918) [-238.241] (-238.007) -- 0:00:54
114000 -- [-233.568] (-236.452) (-237.376) (-236.874) * (-233.632) [-234.999] (-240.214) (-238.393) -- 0:00:54
114500 -- [-236.970] (-236.702) (-233.711) (-236.286) * [-233.576] (-234.114) (-235.331) (-236.282) -- 0:00:54
115000 -- (-236.794) [-234.732] (-234.146) (-235.028) * [-235.499] (-236.300) (-238.161) (-239.639) -- 0:00:53
Average standard deviation of split frequencies: 0.017212
115500 -- (-234.011) (-241.597) [-233.684] (-235.616) * (-234.966) (-238.422) (-235.092) [-235.995] -- 0:00:53
116000 -- (-233.862) (-234.646) (-233.857) [-234.099] * (-234.394) (-239.245) [-235.949] (-237.195) -- 0:00:53
116500 -- (-236.166) (-234.203) (-234.188) [-233.466] * (-233.963) (-234.073) [-233.433] (-236.622) -- 0:00:53
117000 -- [-233.997] (-237.797) (-234.605) (-237.442) * (-236.579) (-240.652) [-234.130] (-234.320) -- 0:00:52
117500 -- (-233.820) [-236.323] (-234.691) (-237.898) * [-234.089] (-233.309) (-235.074) (-237.659) -- 0:00:52
118000 -- (-233.899) (-235.354) [-238.233] (-233.254) * (-233.720) (-236.465) (-233.650) [-234.713] -- 0:00:52
118500 -- (-236.335) (-234.903) [-233.749] (-234.824) * (-235.172) (-233.935) (-236.873) [-233.992] -- 0:00:52
119000 -- (-233.888) (-236.987) (-238.679) [-235.840] * (-235.993) (-235.727) (-237.469) [-233.680] -- 0:00:51
119500 -- (-237.466) (-234.495) [-237.572] (-239.516) * (-236.460) (-234.868) (-237.671) [-234.352] -- 0:00:51
120000 -- (-234.965) (-236.914) [-233.529] (-236.503) * (-235.552) [-234.736] (-239.353) (-235.009) -- 0:00:51
Average standard deviation of split frequencies: 0.015856
120500 -- [-233.934] (-233.970) (-236.718) (-233.896) * (-236.704) (-235.070) [-233.463] (-236.039) -- 0:00:51
121000 -- (-235.215) (-236.393) [-238.907] (-233.378) * (-233.615) [-235.960] (-234.067) (-234.250) -- 0:00:58
121500 -- (-237.891) (-235.514) [-235.791] (-235.974) * (-234.098) (-234.408) [-235.150] (-233.556) -- 0:00:57
122000 -- (-235.693) (-236.765) [-236.999] (-234.219) * [-234.502] (-235.691) (-234.076) (-237.685) -- 0:00:57
122500 -- (-234.807) (-234.868) [-238.034] (-235.253) * (-237.209) [-236.631] (-237.119) (-235.094) -- 0:00:57
123000 -- (-237.798) (-235.123) (-235.658) [-234.366] * [-236.050] (-238.584) (-235.076) (-236.484) -- 0:00:57
123500 -- (-234.161) (-235.383) [-238.117] (-236.257) * (-240.934) (-238.292) [-234.370] (-233.631) -- 0:00:56
124000 -- (-234.442) [-233.783] (-235.568) (-234.506) * (-235.573) (-235.077) [-235.437] (-239.420) -- 0:00:56
124500 -- [-239.032] (-235.354) (-233.049) (-235.631) * (-238.287) (-235.354) [-240.506] (-234.426) -- 0:00:56
125000 -- (-237.641) (-236.572) [-234.283] (-235.485) * (-237.740) (-237.516) (-235.517) [-233.712] -- 0:00:56
Average standard deviation of split frequencies: 0.016628
125500 -- [-237.997] (-233.716) (-233.910) (-235.288) * [-233.993] (-237.908) (-236.124) (-236.306) -- 0:00:55
126000 -- (-233.915) (-233.482) [-236.975] (-234.578) * (-236.930) (-233.989) (-237.048) [-234.553] -- 0:00:55
126500 -- (-234.413) [-236.770] (-237.655) (-234.944) * [-233.179] (-234.327) (-236.868) (-236.484) -- 0:00:55
127000 -- (-235.907) (-234.537) (-236.034) [-234.435] * [-236.936] (-236.395) (-235.054) (-235.351) -- 0:00:54
127500 -- [-237.955] (-234.894) (-235.355) (-235.001) * [-236.633] (-233.986) (-238.760) (-235.859) -- 0:00:54
128000 -- [-235.987] (-238.172) (-236.536) (-235.036) * (-233.783) (-237.770) (-237.371) [-233.807] -- 0:00:54
128500 -- (-234.930) [-236.060] (-236.014) (-241.089) * (-235.521) (-233.219) (-235.020) [-234.678] -- 0:00:54
129000 -- (-237.370) (-239.680) (-235.062) [-239.388] * [-235.180] (-236.325) (-234.527) (-234.037) -- 0:00:54
129500 -- (-234.236) (-235.540) [-234.351] (-237.873) * (-234.623) (-234.726) (-236.301) [-239.610] -- 0:00:53
130000 -- [-235.259] (-235.598) (-234.745) (-236.106) * (-235.374) (-234.731) (-233.209) [-235.752] -- 0:00:53
Average standard deviation of split frequencies: 0.017237
130500 -- [-234.863] (-234.837) (-238.759) (-236.537) * (-233.995) (-236.485) (-235.466) [-234.793] -- 0:00:53
131000 -- (-238.315) (-234.475) [-235.879] (-236.733) * (-237.823) (-235.232) (-234.559) [-236.213] -- 0:00:53
131500 -- (-233.527) (-233.381) [-233.698] (-236.834) * (-234.786) [-236.488] (-235.346) (-236.113) -- 0:00:52
132000 -- (-235.091) (-235.770) [-233.851] (-237.721) * [-238.067] (-236.126) (-233.686) (-235.211) -- 0:00:52
132500 -- [-234.350] (-236.919) (-238.772) (-237.243) * (-240.161) [-235.964] (-234.009) (-235.455) -- 0:00:52
133000 -- (-235.626) [-236.539] (-236.870) (-234.014) * (-240.003) (-234.153) (-236.571) [-235.028] -- 0:00:52
133500 -- [-235.105] (-235.451) (-234.475) (-235.680) * (-237.311) (-244.548) (-235.217) [-236.203] -- 0:00:51
134000 -- (-234.234) (-237.326) [-236.108] (-234.792) * (-236.283) (-236.440) [-234.117] (-236.239) -- 0:00:51
134500 -- (-234.463) [-234.064] (-237.119) (-233.655) * (-236.384) (-233.712) [-236.209] (-236.096) -- 0:00:51
135000 -- (-238.432) (-234.784) (-238.240) [-233.682] * (-234.319) (-236.678) [-233.493] (-237.209) -- 0:00:51
Average standard deviation of split frequencies: 0.018791
135500 -- (-235.015) [-233.817] (-234.688) (-234.353) * [-234.376] (-234.612) (-234.188) (-234.545) -- 0:00:51
136000 -- [-236.254] (-234.233) (-233.941) (-236.916) * [-233.996] (-234.302) (-235.373) (-237.210) -- 0:00:50
136500 -- (-237.832) [-235.612] (-234.950) (-234.809) * (-233.740) (-234.578) (-235.235) [-237.227] -- 0:00:50
137000 -- (-235.597) [-234.299] (-235.031) (-235.496) * (-233.221) (-239.199) [-233.644] (-235.174) -- 0:00:50
137500 -- (-233.560) (-239.908) [-234.450] (-240.123) * (-233.758) (-236.168) (-242.086) [-237.790] -- 0:00:50
138000 -- [-235.528] (-234.337) (-233.663) (-236.981) * (-235.212) (-238.874) (-236.926) [-238.071] -- 0:00:49
138500 -- (-238.592) (-233.535) (-234.766) [-236.264] * (-234.717) (-234.203) (-235.627) [-236.030] -- 0:00:55
139000 -- (-234.404) (-233.228) (-235.344) [-235.744] * (-238.199) [-236.035] (-234.937) (-234.420) -- 0:00:55
139500 -- (-233.710) (-238.083) [-234.080] (-237.761) * [-235.253] (-237.051) (-234.593) (-233.533) -- 0:00:55
140000 -- [-234.498] (-234.529) (-234.631) (-237.234) * [-236.843] (-234.324) (-234.744) (-234.617) -- 0:00:55
Average standard deviation of split frequencies: 0.019921
140500 -- (-233.991) (-234.884) [-233.860] (-236.845) * (-236.140) [-235.514] (-234.737) (-234.690) -- 0:00:55
141000 -- [-238.600] (-234.017) (-237.619) (-239.937) * (-237.540) [-239.805] (-237.512) (-235.662) -- 0:00:54
141500 -- [-235.607] (-234.885) (-234.958) (-234.494) * [-235.237] (-235.690) (-234.348) (-236.695) -- 0:00:54
142000 -- (-234.719) (-237.407) [-235.375] (-236.890) * [-235.772] (-234.689) (-235.165) (-239.851) -- 0:00:54
142500 -- (-237.126) (-238.967) (-235.688) [-234.208] * [-234.831] (-233.422) (-239.919) (-237.341) -- 0:00:54
143000 -- (-237.198) (-234.919) [-236.425] (-235.883) * (-233.548) (-235.308) [-234.632] (-234.233) -- 0:00:53
143500 -- (-234.683) (-236.531) [-233.411] (-238.755) * (-233.954) (-234.433) (-233.818) [-237.497] -- 0:00:53
144000 -- (-235.287) (-236.484) [-234.066] (-238.044) * (-234.144) (-239.789) (-233.847) [-236.012] -- 0:00:53
144500 -- [-234.495] (-238.208) (-234.370) (-234.393) * [-234.637] (-234.169) (-234.923) (-236.265) -- 0:00:53
145000 -- (-235.782) (-235.776) (-235.004) [-236.847] * [-234.608] (-236.033) (-234.143) (-236.009) -- 0:00:53
Average standard deviation of split frequencies: 0.018693
145500 -- (-237.927) (-235.601) (-234.852) [-236.244] * (-233.233) (-240.920) (-235.823) [-233.044] -- 0:00:52
146000 -- (-234.175) (-239.356) [-234.956] (-236.274) * (-236.396) (-236.190) [-236.092] (-235.758) -- 0:00:52
146500 -- [-233.976] (-235.091) (-237.464) (-235.844) * (-234.770) (-234.088) (-238.647) [-235.072] -- 0:00:52
147000 -- (-233.577) [-233.402] (-236.534) (-237.142) * (-234.771) [-235.214] (-238.718) (-233.739) -- 0:00:52
147500 -- [-237.698] (-233.966) (-238.131) (-233.787) * (-234.252) (-237.648) (-242.634) [-233.173] -- 0:00:52
148000 -- (-234.794) (-236.655) [-234.254] (-234.862) * (-236.098) (-240.670) [-242.275] (-235.169) -- 0:00:51
148500 -- (-236.355) [-234.732] (-238.349) (-234.572) * (-235.384) (-241.333) [-235.520] (-235.090) -- 0:00:51
149000 -- (-234.700) [-235.053] (-236.471) (-236.285) * [-236.061] (-234.885) (-236.015) (-236.787) -- 0:00:51
149500 -- (-234.461) [-234.387] (-235.325) (-233.403) * (-236.067) (-235.821) [-236.020] (-235.491) -- 0:00:51
150000 -- (-234.030) [-233.815] (-236.290) (-233.767) * (-234.783) (-236.070) [-233.093] (-238.589) -- 0:00:51
Average standard deviation of split frequencies: 0.020685
150500 -- (-236.471) (-235.860) [-236.279] (-234.573) * (-236.591) [-234.956] (-233.318) (-237.701) -- 0:00:50
151000 -- [-235.592] (-233.603) (-234.851) (-233.491) * (-233.649) (-234.008) [-234.989] (-236.383) -- 0:00:50
151500 -- (-238.041) (-234.245) [-235.145] (-233.606) * (-233.758) (-235.468) [-234.869] (-234.532) -- 0:00:50
152000 -- (-235.163) (-235.309) [-237.156] (-234.969) * (-238.569) (-235.317) (-236.800) [-234.663] -- 0:00:50
152500 -- (-237.514) [-234.065] (-235.872) (-235.673) * (-240.299) (-235.047) (-236.190) [-233.817] -- 0:00:50
153000 -- (-233.907) [-236.563] (-237.680) (-237.397) * (-235.124) (-237.142) (-236.452) [-234.921] -- 0:00:49
153500 -- [-233.918] (-235.078) (-237.007) (-241.191) * (-235.065) [-234.053] (-233.785) (-241.680) -- 0:00:49
154000 -- (-234.650) (-234.304) (-237.582) [-234.526] * (-233.851) (-233.571) [-235.143] (-235.721) -- 0:00:49
154500 -- (-236.506) [-233.714] (-242.281) (-233.331) * (-236.548) [-233.882] (-236.023) (-235.199) -- 0:00:49
155000 -- (-234.825) (-235.744) (-237.206) [-235.955] * (-234.239) (-235.830) (-234.291) [-233.724] -- 0:00:49
Average standard deviation of split frequencies: 0.019731
155500 -- (-235.338) (-235.864) [-235.947] (-235.687) * (-233.405) (-236.577) [-236.353] (-234.285) -- 0:00:54
156000 -- (-237.005) [-236.156] (-235.613) (-233.865) * [-236.064] (-237.857) (-234.891) (-237.930) -- 0:00:54
156500 -- (-243.801) [-242.500] (-236.184) (-234.230) * [-233.582] (-233.608) (-234.458) (-237.980) -- 0:00:53
157000 -- (-236.398) (-234.314) [-235.641] (-235.189) * (-235.809) (-233.816) [-234.126] (-235.945) -- 0:00:53
157500 -- [-235.965] (-237.168) (-236.820) (-238.319) * (-235.182) [-235.196] (-234.730) (-237.445) -- 0:00:53
158000 -- (-234.512) (-236.413) (-242.242) [-235.191] * (-235.789) (-236.539) (-235.373) [-233.429] -- 0:00:53
158500 -- (-237.630) (-235.661) [-235.809] (-234.694) * (-237.199) (-236.101) [-235.449] (-235.663) -- 0:00:53
159000 -- (-235.472) (-236.122) [-234.774] (-235.718) * (-236.340) (-233.720) [-236.243] (-234.984) -- 0:00:52
159500 -- (-235.129) (-236.636) (-234.995) [-237.267] * (-236.036) (-234.488) (-235.408) [-235.271] -- 0:00:52
160000 -- (-235.287) (-238.088) (-234.063) [-237.199] * (-236.137) [-236.950] (-234.510) (-234.742) -- 0:00:52
Average standard deviation of split frequencies: 0.018295
160500 -- (-235.317) [-234.402] (-234.212) (-236.616) * (-234.370) [-238.743] (-237.125) (-235.627) -- 0:00:52
161000 -- (-234.224) [-234.752] (-234.645) (-235.789) * (-236.478) (-234.871) (-239.419) [-235.693] -- 0:00:52
161500 -- (-235.894) [-235.019] (-233.962) (-235.145) * (-237.525) [-235.227] (-235.124) (-235.751) -- 0:00:51
162000 -- [-233.705] (-234.407) (-236.981) (-233.339) * [-235.744] (-235.005) (-232.961) (-233.398) -- 0:00:51
162500 -- [-235.611] (-235.796) (-233.645) (-234.434) * (-236.878) (-237.002) [-234.390] (-238.975) -- 0:00:51
163000 -- [-234.101] (-234.928) (-239.051) (-235.420) * (-238.205) (-233.359) [-235.860] (-234.527) -- 0:00:51
163500 -- (-233.869) (-235.107) (-235.475) [-238.240] * (-235.616) (-235.071) [-234.943] (-239.057) -- 0:00:51
164000 -- (-234.672) (-234.985) (-236.354) [-235.791] * (-234.004) [-235.122] (-233.837) (-237.952) -- 0:00:50
164500 -- (-235.587) [-236.488] (-236.741) (-234.325) * [-235.142] (-236.795) (-236.033) (-234.686) -- 0:00:50
165000 -- (-236.649) (-236.329) [-237.433] (-235.230) * [-235.092] (-236.171) (-239.125) (-234.110) -- 0:00:50
Average standard deviation of split frequencies: 0.017670
165500 -- (-237.965) [-234.555] (-235.486) (-237.183) * (-236.722) (-234.599) (-233.776) [-237.177] -- 0:00:50
166000 -- (-238.466) (-234.663) (-234.240) [-233.368] * (-234.202) (-235.263) [-234.765] (-238.521) -- 0:00:50
166500 -- (-236.688) (-236.498) [-233.514] (-232.946) * (-235.240) (-233.636) [-236.601] (-235.667) -- 0:00:50
167000 -- [-239.340] (-235.686) (-235.236) (-237.570) * (-238.683) (-235.051) (-238.577) [-233.102] -- 0:00:49
167500 -- (-241.743) (-234.167) (-238.244) [-236.495] * (-234.748) (-238.680) (-236.807) [-233.096] -- 0:00:49
168000 -- (-236.615) (-235.983) (-235.441) [-237.935] * (-233.317) [-235.828] (-233.894) (-234.708) -- 0:00:49
168500 -- (-236.091) [-235.063] (-234.458) (-233.764) * (-238.058) (-234.399) (-236.853) [-236.450] -- 0:00:49
169000 -- (-234.698) (-241.195) (-234.015) [-235.260] * (-235.542) (-235.070) (-236.424) [-235.469] -- 0:00:49
169500 -- (-233.296) (-237.489) (-236.066) [-235.705] * (-237.147) (-233.353) [-237.561] (-235.214) -- 0:00:48
170000 -- (-237.926) (-234.302) (-237.392) [-234.009] * (-239.224) [-235.776] (-234.361) (-233.744) -- 0:00:48
Average standard deviation of split frequencies: 0.018198
170500 -- (-236.197) (-234.691) [-233.810] (-235.403) * (-236.015) [-234.386] (-236.474) (-233.010) -- 0:00:48
171000 -- (-239.156) [-236.784] (-233.988) (-236.425) * [-235.435] (-233.242) (-236.390) (-233.612) -- 0:00:48
171500 -- (-235.792) (-237.600) [-235.998] (-235.026) * (-235.458) (-237.758) [-235.830] (-237.602) -- 0:00:48
172000 -- (-233.941) (-235.098) [-237.296] (-234.696) * (-241.504) (-233.504) [-241.571] (-240.815) -- 0:00:48
172500 -- (-236.411) (-233.253) (-236.463) [-235.277] * (-244.198) [-233.875] (-235.650) (-236.524) -- 0:00:52
173000 -- (-234.469) [-233.408] (-237.910) (-234.716) * [-237.874] (-234.637) (-234.275) (-235.476) -- 0:00:52
173500 -- (-236.047) (-235.318) [-236.039] (-234.145) * (-238.666) [-234.110] (-235.013) (-234.058) -- 0:00:52
174000 -- (-234.128) (-234.974) [-234.368] (-237.050) * (-235.885) (-233.292) (-234.205) [-238.142] -- 0:00:52
174500 -- [-233.995] (-235.789) (-233.871) (-235.124) * (-234.192) (-234.291) [-235.314] (-238.799) -- 0:00:52
175000 -- [-234.363] (-236.634) (-233.527) (-234.679) * (-238.210) [-235.003] (-233.655) (-243.805) -- 0:00:51
Average standard deviation of split frequencies: 0.016386
175500 -- (-233.766) (-233.656) [-235.484] (-234.015) * (-236.810) (-235.977) [-235.451] (-239.122) -- 0:00:51
176000 -- [-234.202] (-233.580) (-236.675) (-235.902) * (-233.489) (-236.558) (-235.837) [-238.096] -- 0:00:51
176500 -- (-235.920) [-237.851] (-235.640) (-234.861) * (-237.344) (-237.057) [-236.304] (-240.329) -- 0:00:51
177000 -- (-237.017) (-236.107) [-235.308] (-233.822) * (-237.261) [-235.625] (-234.928) (-238.246) -- 0:00:51
177500 -- [-234.561] (-234.059) (-235.182) (-235.312) * (-235.311) (-236.635) [-236.864] (-237.465) -- 0:00:50
178000 -- (-237.121) (-234.106) [-236.118] (-235.949) * (-235.139) (-233.138) (-235.158) [-233.415] -- 0:00:50
178500 -- (-237.692) [-235.674] (-234.052) (-236.520) * (-234.536) (-234.054) [-235.925] (-236.407) -- 0:00:50
179000 -- (-236.102) (-233.373) [-235.216] (-234.307) * (-234.994) [-236.159] (-234.202) (-234.535) -- 0:00:50
179500 -- (-235.862) [-234.060] (-236.414) (-234.207) * [-234.642] (-233.964) (-234.242) (-233.742) -- 0:00:50
180000 -- (-234.849) (-238.084) [-234.451] (-236.025) * (-234.248) (-233.327) [-235.015] (-233.683) -- 0:00:50
Average standard deviation of split frequencies: 0.016576
180500 -- (-236.312) [-236.052] (-238.148) (-234.366) * [-235.549] (-239.468) (-234.350) (-234.154) -- 0:00:49
181000 -- [-236.889] (-238.301) (-234.834) (-235.095) * (-236.123) (-235.085) [-233.980] (-235.534) -- 0:00:49
181500 -- (-238.314) (-236.664) [-233.923] (-240.323) * (-235.153) [-237.212] (-234.489) (-235.527) -- 0:00:49
182000 -- (-234.802) (-238.022) [-234.161] (-238.577) * [-235.440] (-233.429) (-238.165) (-235.348) -- 0:00:49
182500 -- (-233.711) (-234.666) (-233.985) [-237.039] * (-234.456) (-238.453) [-235.848] (-235.120) -- 0:00:49
183000 -- (-235.920) [-236.637] (-233.845) (-238.300) * (-233.164) (-237.313) (-234.447) [-235.440] -- 0:00:49
183500 -- (-237.442) (-237.851) (-233.500) [-236.673] * (-235.636) [-235.451] (-234.266) (-237.953) -- 0:00:48
184000 -- (-233.469) (-236.849) (-235.447) [-234.302] * [-233.930] (-236.159) (-234.539) (-234.155) -- 0:00:48
184500 -- [-235.738] (-234.213) (-235.436) (-234.967) * (-239.257) [-235.183] (-234.157) (-236.846) -- 0:00:48
185000 -- (-233.904) [-234.827] (-234.419) (-234.757) * (-239.061) (-236.541) (-237.766) [-233.913] -- 0:00:48
Average standard deviation of split frequencies: 0.015365
185500 -- [-234.966] (-236.071) (-238.257) (-234.671) * (-236.836) (-234.465) (-242.016) [-237.152] -- 0:00:48
186000 -- (-235.632) (-233.310) [-236.919] (-234.655) * (-236.053) (-234.084) (-235.981) [-237.397] -- 0:00:48
186500 -- (-236.648) [-235.250] (-237.226) (-243.863) * (-236.014) (-234.048) [-234.025] (-234.394) -- 0:00:47
187000 -- (-241.597) [-234.257] (-235.064) (-234.395) * [-235.354] (-234.931) (-233.608) (-234.540) -- 0:00:47
187500 -- (-236.493) (-236.230) [-233.929] (-234.983) * (-235.071) (-235.378) [-235.809] (-236.080) -- 0:00:47
188000 -- [-233.099] (-234.486) (-233.488) (-236.739) * (-234.999) (-235.709) [-237.043] (-237.360) -- 0:00:47
188500 -- (-234.419) (-236.021) [-235.550] (-236.603) * (-233.691) (-236.812) [-237.029] (-234.461) -- 0:00:47
189000 -- (-234.863) (-233.828) (-240.562) [-236.044] * (-233.778) (-235.302) [-241.371] (-233.409) -- 0:00:47
189500 -- (-235.012) (-236.719) (-236.820) [-235.913] * [-238.226] (-235.903) (-237.169) (-235.019) -- 0:00:51
190000 -- (-235.150) (-236.812) [-236.660] (-235.659) * (-235.689) (-238.412) (-237.687) [-233.748] -- 0:00:51
Average standard deviation of split frequencies: 0.014980
190500 -- (-234.745) [-235.338] (-234.917) (-235.552) * (-235.301) (-234.428) [-233.810] (-236.143) -- 0:00:50
191000 -- [-238.563] (-235.338) (-233.444) (-237.160) * (-237.058) (-235.739) [-234.759] (-236.698) -- 0:00:50
191500 -- (-238.591) [-233.278] (-233.729) (-234.933) * (-236.003) [-234.608] (-234.989) (-236.140) -- 0:00:50
192000 -- (-235.756) (-234.008) (-235.200) [-236.577] * (-233.191) [-233.750] (-234.885) (-236.743) -- 0:00:50
192500 -- (-235.293) (-233.778) (-237.436) [-237.336] * (-235.807) [-235.703] (-235.072) (-239.746) -- 0:00:50
193000 -- (-238.891) (-234.442) (-234.826) [-242.777] * (-235.938) (-236.059) [-234.653] (-236.640) -- 0:00:50
193500 -- (-236.630) (-235.010) (-236.747) [-235.248] * (-238.057) (-234.743) (-234.592) [-235.387] -- 0:00:50
194000 -- [-235.327] (-239.392) (-233.985) (-235.514) * (-238.059) (-234.852) [-233.779] (-236.249) -- 0:00:49
194500 -- (-237.156) [-234.983] (-234.158) (-237.761) * (-234.501) (-236.429) (-236.426) [-235.517] -- 0:00:49
195000 -- (-233.804) (-238.599) [-235.721] (-235.118) * (-234.958) (-236.835) (-235.410) [-234.660] -- 0:00:49
Average standard deviation of split frequencies: 0.015846
195500 -- (-233.688) [-235.248] (-235.121) (-236.760) * (-237.489) (-233.809) [-237.386] (-234.970) -- 0:00:49
196000 -- [-236.564] (-234.612) (-235.662) (-233.821) * (-237.340) [-235.283] (-236.268) (-237.686) -- 0:00:49
196500 -- (-234.595) (-235.906) [-236.299] (-237.953) * (-234.216) [-235.220] (-237.074) (-234.104) -- 0:00:49
197000 -- (-233.724) (-236.712) (-233.784) [-236.334] * (-235.830) [-236.528] (-234.151) (-236.005) -- 0:00:48
197500 -- (-236.832) (-236.601) [-236.286] (-235.161) * [-233.951] (-235.760) (-234.642) (-236.849) -- 0:00:48
198000 -- [-235.033] (-235.836) (-234.380) (-235.834) * (-234.213) [-233.806] (-234.147) (-236.586) -- 0:00:48
198500 -- (-233.623) (-237.722) [-234.658] (-236.367) * (-234.110) (-237.840) [-234.058] (-235.189) -- 0:00:48
199000 -- [-235.115] (-234.631) (-235.634) (-235.032) * (-233.455) (-234.823) (-234.114) [-233.784] -- 0:00:48
199500 -- (-238.970) (-234.141) [-236.724] (-235.045) * (-235.497) (-235.474) (-234.806) [-236.554] -- 0:00:48
200000 -- [-235.679] (-234.604) (-235.466) (-234.758) * [-234.588] (-236.667) (-236.054) (-233.471) -- 0:00:48
Average standard deviation of split frequencies: 0.015123
200500 -- (-235.167) (-235.647) [-233.428] (-235.520) * (-233.956) (-234.149) (-234.129) [-234.186] -- 0:00:47
201000 -- (-234.246) (-234.369) [-233.955] (-235.074) * [-234.474] (-233.724) (-234.736) (-234.665) -- 0:00:47
201500 -- (-236.961) (-235.251) (-234.741) [-238.163] * [-233.630] (-236.182) (-235.276) (-233.338) -- 0:00:47
202000 -- (-233.195) [-235.062] (-239.417) (-239.812) * (-235.791) (-234.010) [-236.428] (-234.125) -- 0:00:47
202500 -- (-234.869) (-235.699) (-236.018) [-235.477] * [-235.175] (-235.314) (-236.613) (-235.679) -- 0:00:47
203000 -- (-235.144) (-236.113) [-238.953] (-236.925) * (-234.987) (-233.812) (-235.291) [-234.708] -- 0:00:47
203500 -- (-234.797) [-235.269] (-235.612) (-236.618) * (-235.213) [-234.398] (-238.501) (-234.503) -- 0:00:46
204000 -- (-234.302) (-235.111) [-235.511] (-236.096) * (-236.204) (-234.073) (-235.852) [-233.848] -- 0:00:46
204500 -- (-236.319) (-237.246) [-233.821] (-235.615) * (-234.851) (-235.281) (-236.329) [-234.168] -- 0:00:46
205000 -- (-236.859) [-236.835] (-238.569) (-239.413) * [-233.934] (-235.467) (-235.048) (-235.107) -- 0:00:50
Average standard deviation of split frequencies: 0.013730
205500 -- (-235.757) (-235.994) (-237.399) [-233.094] * (-234.660) (-235.160) [-235.652] (-235.683) -- 0:00:50
206000 -- (-237.001) (-237.801) (-236.551) [-235.098] * (-233.885) (-234.976) [-233.210] (-238.869) -- 0:00:50
206500 -- [-234.067] (-235.818) (-233.796) (-245.515) * [-235.948] (-233.068) (-239.767) (-237.070) -- 0:00:49
207000 -- (-233.480) [-235.786] (-234.406) (-235.233) * [-236.019] (-233.259) (-237.656) (-240.495) -- 0:00:49
207500 -- [-234.283] (-234.668) (-236.011) (-234.751) * (-234.734) (-234.941) [-233.984] (-236.740) -- 0:00:49
208000 -- (-235.480) [-233.673] (-235.801) (-235.624) * (-234.461) (-233.506) (-233.990) [-236.385] -- 0:00:49
208500 -- (-237.306) [-234.534] (-235.654) (-236.917) * (-237.017) [-234.652] (-237.635) (-235.535) -- 0:00:49
209000 -- [-236.924] (-234.920) (-237.489) (-236.999) * [-236.608] (-241.466) (-234.131) (-234.368) -- 0:00:49
209500 -- (-235.811) [-234.914] (-240.866) (-238.679) * [-235.428] (-236.444) (-234.933) (-234.865) -- 0:00:49
210000 -- (-236.109) [-234.816] (-235.876) (-234.270) * (-234.909) (-236.477) (-237.086) [-233.927] -- 0:00:48
Average standard deviation of split frequencies: 0.013426
210500 -- (-241.308) (-235.896) (-235.577) [-233.385] * (-235.532) [-236.132] (-233.620) (-234.174) -- 0:00:48
211000 -- (-242.761) (-234.029) (-234.024) [-233.525] * [-233.068] (-236.704) (-233.976) (-234.071) -- 0:00:48
211500 -- [-239.172] (-238.399) (-238.210) (-234.200) * (-233.807) (-237.308) (-233.656) [-233.998] -- 0:00:48
212000 -- (-235.150) [-238.042] (-236.696) (-235.750) * (-238.542) (-235.869) (-235.882) [-233.835] -- 0:00:48
212500 -- [-233.749] (-235.873) (-236.596) (-236.880) * (-236.782) (-234.781) [-233.981] (-236.720) -- 0:00:48
213000 -- [-236.973] (-236.935) (-236.013) (-233.754) * [-234.111] (-234.830) (-233.731) (-236.137) -- 0:00:48
213500 -- (-235.015) (-238.514) (-235.944) [-239.500] * (-235.651) (-237.534) [-235.810] (-233.944) -- 0:00:47
214000 -- [-234.230] (-234.990) (-235.970) (-234.798) * (-234.710) (-233.733) [-234.176] (-234.436) -- 0:00:47
214500 -- (-237.827) [-234.025] (-234.880) (-233.218) * (-235.570) [-233.979] (-236.500) (-236.874) -- 0:00:47
215000 -- (-235.077) (-233.614) [-236.822] (-234.270) * [-235.536] (-233.860) (-239.490) (-234.755) -- 0:00:47
Average standard deviation of split frequencies: 0.013231
215500 -- (-236.008) (-236.097) (-237.563) [-234.399] * (-238.206) (-233.683) [-235.156] (-236.198) -- 0:00:47
216000 -- (-236.671) (-235.747) [-234.951] (-233.419) * (-234.253) (-233.840) [-235.534] (-233.314) -- 0:00:47
216500 -- (-233.996) [-235.169] (-236.847) (-234.820) * (-234.745) (-236.300) (-239.336) [-235.721] -- 0:00:47
217000 -- [-234.971] (-234.733) (-236.020) (-235.502) * (-238.285) (-236.720) (-238.006) [-234.253] -- 0:00:46
217500 -- (-234.273) (-236.596) [-233.914] (-235.527) * [-239.883] (-237.138) (-240.216) (-235.485) -- 0:00:46
218000 -- (-239.257) (-236.355) (-236.962) [-237.550] * [-234.102] (-238.337) (-234.569) (-235.481) -- 0:00:46
218500 -- (-235.481) (-234.822) (-242.216) [-237.592] * [-233.353] (-235.037) (-236.031) (-234.380) -- 0:00:46
219000 -- (-235.367) (-235.121) (-235.281) [-235.976] * (-234.054) (-235.994) (-236.458) [-235.558] -- 0:00:49
219500 -- (-235.321) (-236.956) [-234.494] (-236.392) * (-233.541) [-236.000] (-235.077) (-235.374) -- 0:00:49
220000 -- [-236.501] (-235.800) (-234.813) (-236.630) * (-239.969) (-237.799) [-233.481] (-235.844) -- 0:00:49
Average standard deviation of split frequencies: 0.013446
220500 -- [-233.854] (-233.524) (-237.367) (-234.609) * (-233.628) (-237.314) [-234.662] (-234.744) -- 0:00:49
221000 -- (-234.978) (-236.011) (-236.740) [-233.856] * (-235.120) (-238.777) (-233.548) [-235.103] -- 0:00:49
221500 -- (-234.575) (-234.779) [-235.786] (-234.663) * [-234.439] (-237.449) (-235.655) (-233.306) -- 0:00:49
222000 -- (-233.552) (-235.229) (-236.649) [-235.108] * [-234.953] (-235.255) (-238.483) (-234.720) -- 0:00:49
222500 -- [-237.506] (-234.579) (-234.825) (-235.533) * (-235.136) (-234.193) (-234.157) [-234.748] -- 0:00:48
223000 -- [-233.616] (-236.406) (-233.865) (-235.268) * (-234.254) [-235.208] (-238.435) (-234.798) -- 0:00:48
223500 -- (-240.428) (-235.906) (-235.876) [-236.261] * (-237.388) [-235.923] (-237.075) (-237.033) -- 0:00:48
224000 -- (-236.207) (-235.492) (-238.155) [-235.666] * [-237.026] (-235.977) (-237.566) (-233.305) -- 0:00:48
224500 -- (-237.171) (-238.611) [-241.147] (-235.661) * (-233.596) [-233.358] (-235.159) (-235.230) -- 0:00:48
225000 -- (-238.330) [-236.148] (-239.020) (-234.639) * (-236.915) (-234.109) (-233.956) [-234.484] -- 0:00:48
Average standard deviation of split frequencies: 0.012883
225500 -- (-239.641) (-235.602) (-233.981) [-236.680] * [-233.306] (-235.112) (-234.339) (-235.951) -- 0:00:48
226000 -- [-235.739] (-237.619) (-238.902) (-235.628) * (-233.764) (-236.762) (-235.503) [-236.870] -- 0:00:47
226500 -- [-235.320] (-236.585) (-237.077) (-236.873) * [-233.257] (-235.865) (-237.626) (-232.944) -- 0:00:47
227000 -- [-234.201] (-236.295) (-237.943) (-236.288) * (-234.968) (-235.673) [-236.319] (-233.367) -- 0:00:47
227500 -- (-234.720) (-236.962) [-234.458] (-235.238) * (-233.340) [-235.598] (-234.306) (-235.662) -- 0:00:47
228000 -- (-234.828) (-233.476) (-233.559) [-237.424] * (-235.857) (-235.552) [-234.305] (-237.150) -- 0:00:47
228500 -- (-234.225) (-235.228) [-238.452] (-236.174) * (-238.078) (-233.109) [-234.687] (-234.957) -- 0:00:47
229000 -- (-233.459) (-235.186) [-235.854] (-237.296) * (-233.212) [-234.288] (-237.282) (-239.706) -- 0:00:47
229500 -- (-237.389) (-237.619) [-235.524] (-237.957) * [-235.452] (-236.807) (-239.111) (-238.196) -- 0:00:47
230000 -- (-234.144) (-233.246) (-235.529) [-236.247] * (-235.924) [-233.638] (-235.996) (-235.110) -- 0:00:46
Average standard deviation of split frequencies: 0.012142
230500 -- (-237.633) (-234.850) [-236.604] (-234.946) * (-236.621) (-236.086) [-234.906] (-234.716) -- 0:00:46
231000 -- (-234.946) (-235.260) [-241.006] (-239.135) * (-238.545) [-236.635] (-234.699) (-236.034) -- 0:00:46
231500 -- (-238.863) (-237.068) [-238.038] (-236.872) * (-236.421) (-237.682) [-234.763] (-234.918) -- 0:00:46
232000 -- [-235.998] (-237.143) (-235.450) (-238.834) * (-234.628) [-236.389] (-240.149) (-234.421) -- 0:00:46
232500 -- (-236.670) (-236.310) (-236.457) [-236.188] * [-234.044] (-233.773) (-235.931) (-237.682) -- 0:00:46
233000 -- [-235.364] (-234.407) (-233.789) (-236.462) * (-237.428) (-234.587) [-232.945] (-239.227) -- 0:00:46
233500 -- (-235.209) (-240.006) (-237.620) [-233.951] * (-236.661) (-235.367) [-236.581] (-237.715) -- 0:00:45
234000 -- (-237.882) [-234.412] (-233.991) (-238.050) * (-236.037) (-235.373) (-238.022) [-236.832] -- 0:00:45
234500 -- (-236.044) (-241.044) (-239.806) [-235.591] * (-235.197) [-234.385] (-236.729) (-236.542) -- 0:00:45
235000 -- (-233.908) [-235.152] (-234.000) (-233.533) * [-235.845] (-238.496) (-234.179) (-236.330) -- 0:00:45
Average standard deviation of split frequencies: 0.011610
235500 -- (-234.117) [-234.742] (-233.810) (-236.353) * (-236.247) (-234.099) (-237.432) [-238.421] -- 0:00:45
236000 -- (-236.362) [-236.439] (-234.034) (-237.100) * (-234.353) (-238.238) [-240.145] (-235.555) -- 0:00:48
236500 -- (-235.466) (-235.421) (-237.755) [-233.861] * (-235.135) (-237.367) [-234.063] (-235.327) -- 0:00:48
237000 -- [-236.592] (-233.287) (-234.107) (-236.325) * (-234.793) [-236.242] (-233.459) (-234.745) -- 0:00:48
237500 -- (-234.419) (-237.105) (-236.463) [-235.089] * [-235.995] (-234.982) (-235.545) (-234.512) -- 0:00:48
238000 -- (-234.481) (-235.863) [-236.628] (-234.673) * (-238.419) [-234.859] (-237.037) (-237.022) -- 0:00:48
238500 -- (-236.035) (-235.236) [-235.094] (-235.598) * (-237.443) (-240.958) [-234.367] (-236.213) -- 0:00:47
239000 -- [-234.968] (-238.427) (-236.480) (-235.524) * (-239.160) [-236.752] (-234.838) (-233.218) -- 0:00:47
239500 -- (-235.468) [-237.617] (-234.155) (-239.531) * (-239.583) (-235.288) [-233.559] (-236.496) -- 0:00:47
240000 -- (-234.818) [-235.186] (-235.426) (-235.736) * [-235.294] (-234.213) (-234.296) (-234.299) -- 0:00:47
Average standard deviation of split frequencies: 0.011752
240500 -- [-234.463] (-234.190) (-234.483) (-234.119) * (-235.384) (-243.577) [-236.030] (-234.214) -- 0:00:47
241000 -- (-234.005) [-236.680] (-234.434) (-235.696) * [-234.000] (-234.973) (-235.518) (-234.820) -- 0:00:47
241500 -- (-239.093) (-236.334) (-234.983) [-235.047] * (-235.149) (-234.314) [-235.604] (-235.987) -- 0:00:47
242000 -- [-233.799] (-244.708) (-233.685) (-236.899) * (-233.783) (-235.950) (-235.914) [-234.689] -- 0:00:46
242500 -- [-236.258] (-234.386) (-239.160) (-234.990) * (-233.441) (-235.480) (-234.309) [-234.997] -- 0:00:46
243000 -- (-235.223) (-235.254) (-240.207) [-234.838] * (-235.372) (-235.234) (-235.990) [-233.395] -- 0:00:46
243500 -- (-235.212) (-235.577) (-236.198) [-233.786] * (-234.287) (-234.722) (-239.175) [-235.123] -- 0:00:46
244000 -- (-234.253) [-237.553] (-234.196) (-235.504) * (-234.276) [-235.627] (-241.792) (-236.677) -- 0:00:46
244500 -- (-233.808) (-233.592) (-236.469) [-235.638] * [-234.979] (-234.540) (-242.800) (-237.740) -- 0:00:46
245000 -- (-233.969) [-233.974] (-235.124) (-233.260) * (-237.449) (-235.294) [-237.695] (-236.184) -- 0:00:46
Average standard deviation of split frequencies: 0.010180
245500 -- [-236.220] (-235.155) (-235.033) (-233.783) * (-233.818) (-236.205) (-233.808) [-236.053] -- 0:00:46
246000 -- (-236.585) (-233.690) (-234.722) [-238.231] * (-234.488) (-233.462) (-236.268) [-237.510] -- 0:00:45
246500 -- (-236.948) (-235.377) [-233.463] (-236.200) * (-234.765) (-236.418) (-235.974) [-233.617] -- 0:00:45
247000 -- [-233.034] (-234.399) (-236.496) (-237.820) * (-233.988) (-234.087) (-236.601) [-236.195] -- 0:00:45
247500 -- (-236.847) [-234.265] (-235.006) (-234.860) * (-233.198) (-237.321) [-235.066] (-235.268) -- 0:00:45
248000 -- (-236.407) (-234.304) (-236.002) [-233.291] * (-237.980) [-237.240] (-236.085) (-235.494) -- 0:00:45
248500 -- (-239.531) [-237.078] (-236.947) (-237.550) * (-235.651) (-234.173) [-234.720] (-239.115) -- 0:00:45
249000 -- (-238.959) (-235.044) (-237.728) [-233.469] * [-234.711] (-235.438) (-234.948) (-234.693) -- 0:00:45
249500 -- (-234.985) (-234.712) (-238.190) [-237.039] * (-235.249) (-236.272) [-235.357] (-236.085) -- 0:00:45
250000 -- [-237.737] (-236.330) (-234.930) (-235.695) * (-235.198) (-235.763) (-236.036) [-234.949] -- 0:00:45
Average standard deviation of split frequencies: 0.010696
250500 -- (-236.975) [-238.308] (-235.459) (-235.422) * (-234.994) (-235.115) (-236.004) [-235.200] -- 0:00:44
251000 -- [-233.912] (-234.251) (-234.590) (-237.078) * (-235.409) (-235.562) (-237.085) [-235.699] -- 0:00:44
251500 -- [-234.851] (-236.216) (-235.332) (-236.006) * (-235.160) (-237.643) [-234.371] (-234.968) -- 0:00:44
252000 -- (-237.063) [-236.259] (-234.618) (-238.764) * (-235.619) [-233.603] (-235.433) (-237.924) -- 0:00:44
252500 -- (-234.754) [-235.280] (-236.631) (-234.712) * [-234.391] (-234.202) (-239.273) (-236.090) -- 0:00:44
253000 -- [-235.316] (-235.081) (-236.127) (-240.029) * (-234.587) (-234.582) (-240.156) [-233.476] -- 0:00:47
253500 -- [-233.303] (-234.796) (-239.615) (-238.232) * (-236.242) (-235.722) (-238.954) [-235.446] -- 0:00:47
254000 -- (-238.469) (-236.650) [-234.946] (-234.962) * (-235.926) (-233.135) [-238.153] (-235.220) -- 0:00:46
254500 -- [-238.958] (-234.839) (-235.188) (-236.118) * (-234.284) (-234.186) [-234.288] (-236.061) -- 0:00:46
255000 -- (-234.795) [-235.220] (-234.438) (-237.712) * (-236.102) (-241.987) [-235.282] (-234.019) -- 0:00:46
Average standard deviation of split frequencies: 0.011164
255500 -- (-239.071) (-234.551) [-233.681] (-235.809) * (-233.719) (-238.887) [-234.814] (-242.510) -- 0:00:46
256000 -- [-237.643] (-233.169) (-235.616) (-236.634) * (-236.455) (-237.413) [-235.314] (-237.262) -- 0:00:46
256500 -- (-237.252) [-233.451] (-235.533) (-234.060) * [-236.324] (-238.207) (-234.265) (-240.017) -- 0:00:46
257000 -- (-239.468) (-235.916) [-237.628] (-235.324) * [-236.097] (-235.835) (-236.116) (-235.586) -- 0:00:46
257500 -- (-238.123) (-241.635) (-235.439) [-235.734] * (-235.896) [-233.775] (-238.386) (-233.876) -- 0:00:46
258000 -- [-233.918] (-236.921) (-234.347) (-235.386) * (-236.444) (-236.941) [-233.794] (-233.138) -- 0:00:46
258500 -- (-237.556) [-233.800] (-234.630) (-235.590) * (-237.296) [-234.719] (-235.223) (-234.159) -- 0:00:45
259000 -- (-240.991) [-235.226] (-235.966) (-235.789) * (-234.665) [-234.839] (-236.455) (-237.018) -- 0:00:45
259500 -- (-239.209) (-235.724) [-233.880] (-234.871) * (-234.377) (-234.117) [-237.608] (-235.739) -- 0:00:45
260000 -- (-234.350) [-240.302] (-234.570) (-238.571) * (-234.526) (-235.294) (-235.944) [-234.507] -- 0:00:45
Average standard deviation of split frequencies: 0.011077
260500 -- (-233.819) (-234.731) (-234.611) [-236.451] * (-236.010) [-235.385] (-237.042) (-234.653) -- 0:00:45
261000 -- [-235.361] (-234.177) (-239.118) (-235.791) * (-236.995) [-234.569] (-235.510) (-234.795) -- 0:00:45
261500 -- (-240.349) [-236.584] (-238.373) (-233.587) * (-235.322) (-233.797) (-233.146) [-240.260] -- 0:00:45
262000 -- (-235.357) (-234.898) [-235.227] (-234.045) * (-237.410) (-235.936) [-236.287] (-234.206) -- 0:00:45
262500 -- (-234.856) (-234.102) [-233.691] (-233.587) * (-234.219) (-233.940) [-238.405] (-235.866) -- 0:00:44
263000 -- (-234.174) [-234.584] (-235.231) (-234.161) * [-234.102] (-234.707) (-237.954) (-236.025) -- 0:00:44
263500 -- (-237.474) (-237.450) [-234.911] (-234.213) * (-236.194) [-234.479] (-235.235) (-233.645) -- 0:00:44
264000 -- (-235.543) (-235.397) [-235.032] (-234.507) * (-235.832) [-234.225] (-235.336) (-236.935) -- 0:00:44
264500 -- [-235.383] (-235.377) (-236.143) (-235.337) * (-235.253) (-235.985) (-236.389) [-235.496] -- 0:00:44
265000 -- (-235.244) (-237.853) [-233.432] (-234.935) * (-236.209) (-236.770) (-233.567) [-235.869] -- 0:00:44
Average standard deviation of split frequencies: 0.012405
265500 -- [-236.743] (-236.873) (-243.502) (-236.646) * (-234.833) [-236.086] (-234.254) (-234.731) -- 0:00:44
266000 -- (-237.398) (-235.430) (-237.097) [-234.260] * (-235.576) (-236.176) (-233.343) [-238.472] -- 0:00:44
266500 -- (-240.070) [-235.460] (-236.339) (-236.885) * [-236.522] (-236.918) (-235.499) (-234.857) -- 0:00:44
267000 -- [-233.989] (-240.186) (-234.526) (-238.393) * (-235.446) [-238.249] (-235.924) (-233.372) -- 0:00:43
267500 -- (-236.484) (-236.213) [-239.321] (-236.178) * (-235.763) (-236.894) [-237.538] (-234.189) -- 0:00:43
268000 -- (-238.859) (-235.644) (-237.650) [-236.144] * [-235.544] (-239.252) (-234.766) (-235.656) -- 0:00:43
268500 -- (-237.140) (-238.690) [-235.068] (-235.507) * (-233.630) [-233.981] (-233.359) (-234.756) -- 0:00:43
269000 -- (-234.384) (-237.999) [-236.784] (-234.636) * (-234.622) (-237.553) [-235.125] (-234.869) -- 0:00:43
269500 -- (-235.404) [-234.044] (-233.783) (-234.425) * (-234.849) (-237.782) (-236.635) [-241.184] -- 0:00:43
270000 -- (-234.795) (-235.006) (-235.248) [-241.034] * [-234.741] (-235.863) (-237.097) (-242.379) -- 0:00:43
Average standard deviation of split frequencies: 0.013421
270500 -- (-234.991) [-237.957] (-234.599) (-241.651) * (-235.210) (-236.757) (-239.343) [-235.972] -- 0:00:45
271000 -- (-235.206) [-235.269] (-237.907) (-233.248) * (-239.617) (-234.173) (-236.517) [-236.950] -- 0:00:45
271500 -- (-233.653) [-233.926] (-236.201) (-237.339) * (-235.993) (-233.425) (-233.519) [-236.020] -- 0:00:45
272000 -- (-233.768) (-236.009) (-234.965) [-238.407] * (-239.029) (-235.305) [-234.310] (-233.637) -- 0:00:45
272500 -- (-235.323) (-236.214) [-235.261] (-236.363) * (-234.224) [-238.496] (-233.683) (-234.570) -- 0:00:45
273000 -- (-235.183) [-236.033] (-236.768) (-233.498) * (-235.341) (-235.848) [-235.478] (-235.571) -- 0:00:45
273500 -- (-235.839) [-233.853] (-236.519) (-234.038) * [-236.087] (-233.986) (-236.667) (-238.322) -- 0:00:45
274000 -- (-238.886) (-233.618) (-238.198) [-235.448] * (-235.838) [-233.493] (-234.917) (-237.174) -- 0:00:45
274500 -- (-237.320) (-234.509) [-237.841] (-235.717) * (-235.724) [-234.486] (-234.297) (-235.583) -- 0:00:44
275000 -- (-240.437) (-236.070) (-238.333) [-235.464] * (-233.604) (-235.001) [-233.343] (-234.344) -- 0:00:44
Average standard deviation of split frequencies: 0.013463
275500 -- (-236.262) (-233.666) [-234.774] (-235.823) * [-234.419] (-236.019) (-238.088) (-233.748) -- 0:00:44
276000 -- [-239.653] (-234.665) (-236.964) (-239.698) * (-235.785) [-234.979] (-235.271) (-235.644) -- 0:00:44
276500 -- (-238.338) (-234.120) (-234.857) [-233.781] * [-235.084] (-234.060) (-236.344) (-234.249) -- 0:00:44
277000 -- (-235.926) [-235.648] (-234.307) (-234.399) * (-235.583) (-236.269) [-234.738] (-238.711) -- 0:00:44
277500 -- [-236.752] (-235.762) (-233.761) (-233.240) * (-235.605) [-235.930] (-237.946) (-237.970) -- 0:00:44
278000 -- [-234.083] (-233.920) (-235.270) (-234.583) * [-233.347] (-237.121) (-234.484) (-236.316) -- 0:00:44
278500 -- (-234.068) (-237.360) (-235.614) [-235.102] * (-235.108) (-236.205) (-235.908) [-241.383] -- 0:00:44
279000 -- [-234.513] (-234.915) (-236.611) (-234.400) * [-234.071] (-235.024) (-233.702) (-237.480) -- 0:00:43
279500 -- (-233.877) [-239.042] (-234.147) (-237.082) * [-234.867] (-235.671) (-233.282) (-237.688) -- 0:00:43
280000 -- [-234.102] (-237.085) (-239.002) (-234.603) * (-238.624) (-241.407) (-234.123) [-236.036] -- 0:00:43
Average standard deviation of split frequencies: 0.013962
280500 -- (-234.420) (-235.309) [-235.379] (-238.150) * (-237.362) (-234.523) (-233.706) [-236.816] -- 0:00:43
281000 -- [-234.918] (-234.737) (-234.055) (-236.022) * [-235.797] (-239.651) (-236.828) (-237.025) -- 0:00:43
281500 -- (-238.111) (-233.576) (-239.532) [-234.085] * (-235.970) [-235.557] (-234.266) (-234.323) -- 0:00:43
282000 -- [-237.023] (-238.348) (-237.602) (-234.955) * [-235.813] (-236.295) (-234.097) (-234.607) -- 0:00:43
282500 -- [-235.671] (-236.346) (-233.175) (-234.059) * (-235.894) (-236.310) (-239.870) [-237.226] -- 0:00:43
283000 -- (-234.645) [-236.537] (-233.974) (-234.559) * (-234.121) (-239.582) (-235.782) [-234.582] -- 0:00:43
283500 -- (-235.374) (-234.929) (-236.100) [-235.286] * (-235.666) (-237.538) [-233.764] (-236.183) -- 0:00:42
284000 -- [-237.276] (-241.778) (-235.893) (-235.069) * [-238.078] (-237.225) (-234.285) (-236.898) -- 0:00:42
284500 -- (-236.572) [-237.328] (-235.244) (-234.124) * (-237.593) (-234.767) (-236.286) [-236.774] -- 0:00:42
285000 -- [-234.691] (-235.138) (-239.090) (-233.655) * (-235.157) (-233.466) (-239.611) [-238.507] -- 0:00:42
Average standard deviation of split frequencies: 0.015968
285500 -- (-239.043) [-234.272] (-234.948) (-238.014) * (-236.928) (-240.706) [-234.217] (-235.190) -- 0:00:42
286000 -- (-234.176) [-234.807] (-235.921) (-234.718) * (-236.226) (-238.220) [-235.184] (-235.792) -- 0:00:42
286500 -- (-237.398) [-234.029] (-235.988) (-235.179) * [-233.196] (-234.757) (-237.025) (-235.384) -- 0:00:42
287000 -- (-234.981) [-235.152] (-233.758) (-236.380) * [-234.227] (-235.032) (-234.431) (-240.577) -- 0:00:42
287500 -- [-241.326] (-236.435) (-234.641) (-233.755) * [-234.274] (-237.285) (-238.029) (-236.878) -- 0:00:44
288000 -- (-238.260) (-235.962) [-235.927] (-234.743) * [-236.194] (-236.761) (-236.191) (-233.474) -- 0:00:44
288500 -- [-235.078] (-237.888) (-235.264) (-235.703) * [-236.294] (-238.644) (-235.894) (-236.252) -- 0:00:44
289000 -- (-233.421) (-234.424) (-235.907) [-233.545] * [-234.890] (-234.510) (-233.009) (-235.756) -- 0:00:44
289500 -- (-235.835) [-234.161] (-238.831) (-234.146) * (-236.677) (-233.978) (-233.391) [-235.252] -- 0:00:44
290000 -- (-236.596) (-233.175) [-235.865] (-233.740) * (-236.904) (-234.853) [-234.458] (-234.410) -- 0:00:44
Average standard deviation of split frequencies: 0.015948
290500 -- (-236.471) [-234.028] (-234.808) (-236.097) * [-233.956] (-238.167) (-235.506) (-237.264) -- 0:00:43
291000 -- (-235.950) [-235.559] (-234.066) (-235.375) * (-234.777) (-236.401) [-234.029] (-233.293) -- 0:00:43
291500 -- (-234.696) (-242.083) [-234.084] (-238.272) * (-236.710) (-236.826) [-237.106] (-234.923) -- 0:00:43
292000 -- [-234.201] (-237.319) (-234.029) (-233.683) * (-233.957) (-234.280) (-240.690) [-234.187] -- 0:00:43
292500 -- (-236.336) (-239.533) [-239.310] (-237.199) * (-233.891) [-234.030] (-234.002) (-233.909) -- 0:00:43
293000 -- (-234.655) (-235.320) [-236.862] (-236.322) * (-234.231) (-234.979) (-233.020) [-234.077] -- 0:00:43
293500 -- (-237.688) (-236.672) (-235.050) [-233.037] * (-238.728) (-236.039) (-236.081) [-235.044] -- 0:00:43
294000 -- (-235.946) (-235.727) (-237.267) [-234.876] * (-235.937) (-236.589) (-235.004) [-236.599] -- 0:00:43
294500 -- (-237.555) (-234.821) (-234.880) [-233.969] * (-237.611) (-236.559) [-236.554] (-238.886) -- 0:00:43
295000 -- (-235.091) [-235.710] (-233.456) (-234.993) * (-237.757) [-233.821] (-238.889) (-237.431) -- 0:00:43
Average standard deviation of split frequencies: 0.015926
295500 -- (-234.600) [-235.861] (-235.286) (-236.140) * (-238.033) (-237.708) (-236.730) [-234.931] -- 0:00:42
296000 -- (-234.533) [-234.821] (-234.521) (-235.278) * (-238.646) [-238.741] (-239.140) (-234.787) -- 0:00:42
296500 -- (-233.993) (-234.531) [-235.104] (-237.892) * (-234.712) (-237.437) (-233.946) [-236.179] -- 0:00:42
297000 -- (-237.307) (-233.814) [-236.376] (-236.994) * (-234.908) (-235.769) [-233.493] (-236.763) -- 0:00:42
297500 -- [-233.057] (-238.707) (-236.650) (-234.884) * (-233.812) (-236.366) [-236.054] (-235.366) -- 0:00:42
298000 -- (-234.746) [-239.269] (-236.295) (-234.997) * (-234.337) (-236.177) (-237.891) [-233.837] -- 0:00:42
298500 -- (-233.869) [-235.095] (-236.377) (-236.466) * (-236.197) (-239.741) (-234.203) [-235.807] -- 0:00:42
299000 -- (-234.203) (-234.313) (-235.361) [-236.279] * [-234.772] (-239.518) (-236.944) (-234.760) -- 0:00:42
299500 -- (-235.670) (-238.211) (-234.106) [-234.927] * [-234.492] (-238.075) (-236.100) (-235.349) -- 0:00:42
300000 -- (-236.205) (-236.968) [-235.315] (-234.688) * [-236.891] (-234.497) (-233.702) (-234.721) -- 0:00:42
Average standard deviation of split frequencies: 0.016267
300500 -- (-233.688) (-233.748) [-235.121] (-235.100) * (-234.429) [-235.901] (-234.892) (-235.321) -- 0:00:41
301000 -- (-235.846) (-234.506) (-236.076) [-235.803] * (-240.536) [-234.014] (-239.464) (-237.731) -- 0:00:41
301500 -- (-235.848) (-235.827) (-234.459) [-236.247] * (-238.241) (-238.509) (-235.386) [-235.162] -- 0:00:41
302000 -- (-234.781) [-234.940] (-235.506) (-234.261) * (-241.580) (-243.089) (-235.194) [-234.470] -- 0:00:41
302500 -- (-235.430) [-234.463] (-234.970) (-237.442) * (-239.445) (-240.580) [-236.818] (-234.714) -- 0:00:41
303000 -- (-238.989) [-234.975] (-241.059) (-235.658) * (-235.409) (-235.292) [-235.518] (-235.727) -- 0:00:41
303500 -- [-234.688] (-238.224) (-239.748) (-240.458) * (-235.150) (-234.283) (-237.042) [-236.846] -- 0:00:41
304000 -- [-237.674] (-237.811) (-239.487) (-236.137) * (-240.339) [-234.361] (-234.817) (-235.678) -- 0:00:41
304500 -- (-233.940) (-234.630) (-235.983) [-235.750] * (-238.312) (-236.790) [-233.704] (-234.825) -- 0:00:43
305000 -- (-233.406) (-239.161) [-238.382] (-238.155) * (-235.462) (-237.045) (-237.339) [-236.277] -- 0:00:43
Average standard deviation of split frequencies: 0.016657
305500 -- [-236.476] (-236.016) (-237.575) (-236.584) * (-233.742) (-235.170) [-235.062] (-233.763) -- 0:00:43
306000 -- (-235.277) (-238.701) (-236.639) [-237.018] * [-239.711] (-238.135) (-238.347) (-233.223) -- 0:00:43
306500 -- (-236.538) (-235.319) [-236.097] (-238.004) * (-233.609) [-235.488] (-234.189) (-234.431) -- 0:00:42
307000 -- (-235.036) [-233.063] (-235.838) (-233.635) * (-234.074) (-234.153) [-236.096] (-237.003) -- 0:00:42
307500 -- (-234.027) (-236.410) [-236.131] (-233.323) * (-234.251) (-236.251) (-237.944) [-234.166] -- 0:00:42
308000 -- [-234.532] (-236.505) (-236.473) (-237.204) * (-237.473) (-236.456) [-233.383] (-236.159) -- 0:00:42
308500 -- (-236.712) [-234.907] (-235.603) (-239.292) * (-236.715) [-237.067] (-233.509) (-234.144) -- 0:00:42
309000 -- [-234.018] (-236.705) (-237.763) (-235.245) * (-234.256) (-234.942) (-233.955) [-235.277] -- 0:00:42
309500 -- (-234.722) [-236.833] (-234.687) (-233.191) * [-233.353] (-238.257) (-233.876) (-236.095) -- 0:00:42
310000 -- [-234.296] (-237.633) (-234.083) (-235.120) * [-235.737] (-235.973) (-234.960) (-234.666) -- 0:00:42
Average standard deviation of split frequencies: 0.017166
310500 -- [-234.553] (-235.975) (-236.894) (-234.080) * (-235.296) (-236.848) (-235.307) [-238.066] -- 0:00:42
311000 -- (-235.100) [-237.338] (-234.464) (-234.277) * (-234.605) (-240.146) (-235.176) [-235.202] -- 0:00:42
311500 -- (-236.627) [-234.522] (-234.320) (-233.632) * [-235.242] (-237.648) (-236.862) (-234.748) -- 0:00:41
312000 -- (-234.544) [-235.789] (-234.376) (-238.718) * (-234.481) (-237.561) (-235.588) [-236.245] -- 0:00:41
312500 -- (-235.277) (-235.972) [-238.006] (-234.593) * (-234.130) [-238.887] (-236.151) (-240.475) -- 0:00:41
313000 -- (-235.915) (-244.714) [-235.055] (-237.216) * (-237.004) [-237.437] (-238.879) (-237.764) -- 0:00:41
313500 -- [-234.924] (-234.311) (-235.247) (-235.880) * (-243.485) (-237.991) [-233.621] (-234.351) -- 0:00:41
314000 -- (-235.374) (-233.424) (-236.467) [-236.304] * (-237.936) (-234.372) [-233.343] (-233.195) -- 0:00:41
314500 -- [-235.888] (-237.588) (-236.172) (-234.946) * (-237.096) (-233.674) [-235.212] (-234.726) -- 0:00:41
315000 -- [-233.009] (-236.171) (-234.301) (-237.191) * (-234.687) (-234.626) (-238.282) [-235.393] -- 0:00:41
Average standard deviation of split frequencies: 0.017528
315500 -- [-233.416] (-234.831) (-234.547) (-235.457) * (-236.356) (-238.093) [-240.120] (-233.596) -- 0:00:41
316000 -- (-237.429) [-235.228] (-235.846) (-236.235) * (-236.226) [-235.807] (-238.079) (-234.877) -- 0:00:41
316500 -- (-235.000) (-233.186) (-235.530) [-237.823] * (-235.055) [-234.923] (-240.962) (-234.559) -- 0:00:41
317000 -- (-234.896) (-233.098) (-234.339) [-233.912] * (-234.994) (-236.106) [-235.500] (-236.388) -- 0:00:40
317500 -- (-235.093) (-233.712) (-233.737) [-233.957] * (-233.735) (-233.312) (-239.624) [-237.163] -- 0:00:40
318000 -- (-235.107) (-234.440) (-236.102) [-233.271] * (-234.125) (-234.003) [-235.199] (-234.945) -- 0:00:40
318500 -- (-234.675) [-235.267] (-238.100) (-235.725) * (-234.672) (-235.339) (-236.478) [-234.702] -- 0:00:40
319000 -- (-234.329) (-233.674) [-235.865] (-235.112) * (-236.593) (-235.046) (-241.853) [-236.813] -- 0:00:40
319500 -- (-235.699) [-235.208] (-238.147) (-233.529) * (-236.508) [-235.029] (-235.547) (-236.247) -- 0:00:40
320000 -- (-235.950) (-237.066) (-234.538) [-234.170] * [-236.797] (-233.687) (-240.080) (-235.162) -- 0:00:40
Average standard deviation of split frequencies: 0.017825
320500 -- [-238.637] (-236.152) (-235.411) (-234.205) * (-234.962) [-234.802] (-236.879) (-236.670) -- 0:00:40
321000 -- (-236.588) (-235.956) [-234.966] (-234.070) * (-235.405) (-237.991) (-239.084) [-234.978] -- 0:00:40
321500 -- [-234.018] (-235.288) (-236.239) (-237.447) * (-236.701) (-235.676) (-236.331) [-234.476] -- 0:00:42
322000 -- (-233.902) [-236.103] (-236.348) (-235.400) * (-235.075) [-233.304] (-236.188) (-234.850) -- 0:00:42
322500 -- (-235.176) (-236.605) (-237.203) [-237.551] * (-235.568) (-234.649) [-236.927] (-236.084) -- 0:00:42
323000 -- (-236.250) [-234.948] (-233.792) (-234.704) * (-234.864) [-233.429] (-237.275) (-235.838) -- 0:00:41
323500 -- (-235.609) (-238.302) (-234.434) [-239.125] * (-239.106) (-235.605) [-235.484] (-235.018) -- 0:00:41
324000 -- (-235.121) [-238.060] (-234.245) (-236.843) * [-237.357] (-236.610) (-240.782) (-235.370) -- 0:00:41
324500 -- (-234.424) (-237.890) (-233.689) [-236.799] * (-237.401) [-237.406] (-239.214) (-233.973) -- 0:00:41
325000 -- [-234.493] (-236.277) (-234.361) (-237.650) * (-233.771) (-235.006) [-236.433] (-233.485) -- 0:00:41
Average standard deviation of split frequencies: 0.018713
325500 -- (-235.042) (-235.589) [-236.603] (-234.181) * (-234.993) (-235.254) [-234.456] (-234.983) -- 0:00:41
326000 -- (-234.233) [-233.957] (-235.205) (-235.158) * (-237.816) [-236.886] (-236.676) (-234.208) -- 0:00:41
326500 -- (-238.061) [-233.516] (-234.439) (-239.323) * (-234.964) [-235.496] (-233.738) (-234.038) -- 0:00:41
327000 -- (-238.639) [-234.583] (-235.988) (-234.016) * [-234.186] (-236.797) (-238.071) (-233.670) -- 0:00:41
327500 -- (-233.823) (-236.724) [-234.509] (-236.217) * (-233.746) (-234.168) (-236.279) [-234.350] -- 0:00:41
328000 -- (-234.121) (-233.979) [-240.928] (-236.872) * (-235.306) (-234.774) [-235.349] (-237.108) -- 0:00:40
328500 -- (-236.624) [-234.944] (-233.734) (-238.897) * (-235.915) (-234.313) (-237.369) [-235.011] -- 0:00:40
329000 -- (-234.899) [-235.073] (-234.710) (-235.485) * (-234.045) (-235.404) [-236.185] (-235.777) -- 0:00:40
329500 -- (-235.426) [-236.284] (-234.699) (-237.378) * (-234.927) (-234.213) [-234.248] (-236.651) -- 0:00:40
330000 -- (-237.484) (-235.547) (-239.369) [-235.711] * (-235.668) (-237.478) [-233.453] (-234.129) -- 0:00:40
Average standard deviation of split frequencies: 0.018617
330500 -- (-233.669) (-234.167) [-235.078] (-235.279) * (-233.752) [-233.441] (-237.679) (-237.060) -- 0:00:40
331000 -- [-234.316] (-234.188) (-237.197) (-235.708) * (-236.613) (-235.913) (-234.172) [-238.647] -- 0:00:40
331500 -- (-235.669) (-234.508) [-235.387] (-238.141) * (-236.395) (-234.070) (-235.124) [-234.950] -- 0:00:40
332000 -- (-234.798) [-234.131] (-235.193) (-238.488) * (-237.490) (-236.061) (-234.589) [-236.688] -- 0:00:40
332500 -- (-237.386) (-235.340) [-235.696] (-235.580) * (-234.674) (-234.165) (-233.516) [-233.732] -- 0:00:40
333000 -- (-235.787) (-235.451) (-237.093) [-235.420] * [-236.404] (-234.072) (-235.185) (-239.781) -- 0:00:40
333500 -- (-237.444) (-234.719) (-234.658) [-234.808] * (-236.335) (-234.291) (-233.487) [-237.226] -- 0:00:39
334000 -- (-235.699) (-235.000) [-235.311] (-233.280) * (-236.031) (-238.077) (-234.559) [-233.610] -- 0:00:39
334500 -- (-233.553) (-238.505) [-233.630] (-235.034) * (-235.502) (-234.578) [-234.274] (-234.615) -- 0:00:39
335000 -- (-234.425) (-235.328) [-233.412] (-235.059) * (-233.404) (-235.322) (-237.352) [-233.782] -- 0:00:39
Average standard deviation of split frequencies: 0.019064
335500 -- (-234.662) (-235.156) (-233.811) [-235.388] * [-233.984] (-236.410) (-234.685) (-234.079) -- 0:00:39
336000 -- (-236.044) (-235.032) [-235.687] (-234.911) * (-234.160) [-236.758] (-236.659) (-239.251) -- 0:00:39
336500 -- (-235.912) (-237.854) [-233.903] (-236.306) * [-233.744] (-233.606) (-238.500) (-235.176) -- 0:00:39
337000 -- [-235.151] (-235.386) (-237.457) (-239.525) * (-234.970) [-235.083] (-238.092) (-237.756) -- 0:00:39
337500 -- (-235.675) (-235.081) [-233.056] (-234.001) * (-237.678) (-235.582) (-235.080) [-235.106] -- 0:00:39
338000 -- (-234.284) (-234.374) [-234.583] (-233.962) * (-240.282) (-234.099) (-235.414) [-236.519] -- 0:00:39
338500 -- [-233.925] (-235.289) (-233.596) (-233.612) * (-235.016) [-234.861] (-233.726) (-239.508) -- 0:00:41
339000 -- (-234.323) (-235.522) [-234.215] (-234.894) * (-236.060) (-235.482) [-235.883] (-236.386) -- 0:00:40
339500 -- (-235.686) (-234.605) [-235.699] (-237.391) * (-235.297) (-235.008) [-233.230] (-236.423) -- 0:00:40
340000 -- (-235.928) (-234.025) (-235.422) [-235.788] * (-235.923) [-237.129] (-235.142) (-234.637) -- 0:00:40
Average standard deviation of split frequencies: 0.019200
340500 -- (-237.134) (-233.832) (-236.786) [-234.858] * (-236.020) (-235.908) [-234.455] (-234.840) -- 0:00:40
341000 -- (-234.860) [-236.568] (-238.799) (-233.794) * (-234.848) (-237.991) (-236.001) [-234.212] -- 0:00:40
341500 -- (-235.629) [-235.836] (-236.907) (-235.085) * (-238.409) (-235.079) (-233.287) [-236.686] -- 0:00:40
342000 -- (-234.401) (-234.280) [-240.316] (-234.324) * (-237.129) (-234.431) [-233.945] (-237.308) -- 0:00:40
342500 -- (-235.742) (-237.732) (-236.571) [-234.106] * (-244.790) [-234.367] (-233.646) (-236.002) -- 0:00:40
343000 -- (-235.537) (-233.247) [-235.080] (-236.285) * (-236.052) [-237.209] (-236.095) (-237.546) -- 0:00:40
343500 -- (-236.441) (-234.433) [-233.797] (-234.914) * (-234.777) (-233.810) (-237.993) [-235.466] -- 0:00:40
344000 -- (-237.142) (-238.151) (-234.233) [-234.514] * (-236.338) (-236.042) [-236.037] (-237.384) -- 0:00:40
344500 -- [-234.318] (-235.795) (-236.196) (-234.487) * [-234.797] (-239.120) (-237.373) (-235.122) -- 0:00:39
345000 -- (-236.761) (-233.076) (-234.692) [-233.672] * [-233.236] (-233.994) (-238.533) (-236.162) -- 0:00:39
Average standard deviation of split frequencies: 0.019226
345500 -- (-239.664) [-233.058] (-233.515) (-233.234) * (-234.131) (-234.269) (-241.691) [-236.119] -- 0:00:39
346000 -- (-239.237) [-234.486] (-235.286) (-236.226) * (-236.731) (-235.577) (-245.213) [-238.591] -- 0:00:39
346500 -- [-234.603] (-236.870) (-236.549) (-236.790) * (-237.253) [-236.007] (-236.817) (-236.119) -- 0:00:39
347000 -- [-235.532] (-234.517) (-233.884) (-237.231) * (-235.606) (-235.322) [-234.379] (-234.278) -- 0:00:39
347500 -- (-234.122) [-237.974] (-233.085) (-235.833) * (-239.296) (-234.061) [-235.590] (-234.446) -- 0:00:39
348000 -- (-233.571) (-237.708) (-234.526) [-234.924] * (-237.890) (-236.413) (-237.884) [-233.671] -- 0:00:39
348500 -- [-239.029] (-235.910) (-236.960) (-240.826) * (-238.907) (-235.999) (-235.628) [-234.110] -- 0:00:39
349000 -- (-233.852) [-236.493] (-233.517) (-236.135) * (-233.430) [-237.446] (-235.037) (-234.259) -- 0:00:39
349500 -- [-234.798] (-236.660) (-234.085) (-242.311) * (-236.999) (-234.820) (-234.692) [-233.693] -- 0:00:39
350000 -- (-242.521) (-234.856) (-233.451) [-235.742] * (-234.109) (-235.741) (-236.467) [-234.969] -- 0:00:39
Average standard deviation of split frequencies: 0.018662
350500 -- (-236.003) (-235.742) (-233.763) [-235.051] * (-235.813) [-236.537] (-233.676) (-234.044) -- 0:00:38
351000 -- [-234.180] (-235.941) (-236.289) (-235.801) * (-239.643) (-236.002) [-235.954] (-237.830) -- 0:00:38
351500 -- (-236.137) (-233.041) (-234.658) [-236.782] * (-236.344) [-233.747] (-234.262) (-239.439) -- 0:00:38
352000 -- (-237.992) [-236.272] (-234.018) (-234.901) * (-234.782) [-233.676] (-235.776) (-237.847) -- 0:00:38
352500 -- [-235.258] (-236.327) (-235.106) (-236.321) * (-236.389) (-236.117) (-234.360) [-236.388] -- 0:00:38
353000 -- (-236.794) [-235.882] (-235.569) (-236.847) * [-233.988] (-236.173) (-233.931) (-234.530) -- 0:00:38
353500 -- [-236.425] (-234.420) (-237.740) (-237.099) * (-234.380) (-237.525) [-236.516] (-235.477) -- 0:00:38
354000 -- [-236.901] (-235.327) (-238.102) (-239.174) * (-237.646) (-236.360) [-234.749] (-236.446) -- 0:00:38
354500 -- [-240.552] (-234.483) (-235.768) (-237.318) * (-233.252) (-234.891) (-235.713) [-234.796] -- 0:00:38
355000 -- [-234.439] (-237.291) (-237.261) (-234.754) * [-234.046] (-235.273) (-235.520) (-237.960) -- 0:00:38
Average standard deviation of split frequencies: 0.018686
355500 -- (-235.164) (-234.480) (-242.882) [-233.141] * (-235.323) (-237.122) [-235.553] (-234.060) -- 0:00:39
356000 -- [-235.051] (-237.707) (-234.171) (-233.741) * (-239.648) (-235.206) [-238.023] (-233.983) -- 0:00:39
356500 -- (-238.573) (-239.635) [-235.528] (-237.810) * (-235.688) [-234.688] (-237.509) (-235.303) -- 0:00:39
357000 -- [-237.105] (-239.357) (-235.367) (-238.464) * (-234.755) (-237.448) [-235.782] (-233.527) -- 0:00:39
357500 -- (-240.164) [-237.141] (-236.716) (-233.226) * [-234.507] (-237.236) (-233.581) (-236.553) -- 0:00:39
358000 -- (-237.540) [-235.132] (-236.209) (-240.906) * (-233.807) (-235.194) [-234.282] (-239.570) -- 0:00:39
358500 -- (-238.945) (-234.507) (-234.646) [-241.608] * (-235.237) (-234.176) (-237.263) [-237.518] -- 0:00:39
359000 -- (-235.939) (-236.189) [-233.646] (-243.526) * (-234.607) (-234.725) [-234.358] (-236.085) -- 0:00:39
359500 -- (-233.774) (-236.858) [-236.128] (-237.364) * (-235.247) [-235.289] (-234.956) (-233.306) -- 0:00:39
360000 -- [-234.866] (-237.140) (-233.568) (-235.658) * (-236.209) [-238.441] (-234.404) (-234.525) -- 0:00:39
Average standard deviation of split frequencies: 0.018879
360500 -- [-236.111] (-240.211) (-236.575) (-234.366) * (-233.521) (-237.757) [-235.296] (-235.320) -- 0:00:39
361000 -- (-234.569) [-236.149] (-235.918) (-233.875) * (-234.438) [-237.812] (-240.444) (-235.878) -- 0:00:38
361500 -- [-234.990] (-233.248) (-233.399) (-234.052) * (-233.592) [-235.785] (-235.287) (-234.815) -- 0:00:38
362000 -- (-235.181) (-235.338) [-234.459] (-234.906) * (-238.063) (-236.409) (-238.625) [-233.502] -- 0:00:38
362500 -- (-237.098) (-235.555) [-239.594] (-238.568) * (-234.250) [-233.857] (-237.547) (-233.387) -- 0:00:38
363000 -- (-238.368) (-234.361) (-237.049) [-236.280] * [-233.646] (-236.359) (-236.493) (-233.926) -- 0:00:38
363500 -- (-235.024) (-234.838) (-240.167) [-239.245] * (-237.302) (-235.879) [-235.795] (-233.866) -- 0:00:38
364000 -- (-238.957) [-239.973] (-234.506) (-239.289) * (-234.926) (-234.244) (-235.369) [-236.476] -- 0:00:38
364500 -- [-234.852] (-233.883) (-234.911) (-233.120) * (-241.574) [-234.110] (-235.873) (-237.455) -- 0:00:38
365000 -- [-234.749] (-240.342) (-233.929) (-233.208) * [-233.443] (-234.381) (-235.337) (-236.596) -- 0:00:38
Average standard deviation of split frequencies: 0.018103
365500 -- [-237.058] (-235.752) (-233.982) (-237.950) * [-234.104] (-238.112) (-239.084) (-238.048) -- 0:00:38
366000 -- (-237.471) (-238.192) [-233.826] (-243.770) * (-236.429) (-234.237) (-233.550) [-236.603] -- 0:00:38
366500 -- [-235.299] (-235.190) (-235.764) (-235.775) * (-235.138) (-234.088) (-235.298) [-235.920] -- 0:00:38
367000 -- (-233.397) [-235.868] (-237.039) (-234.981) * (-234.316) [-238.290] (-238.854) (-236.946) -- 0:00:37
367500 -- (-233.555) (-236.988) [-234.829] (-234.950) * (-235.141) [-240.083] (-234.893) (-235.396) -- 0:00:37
368000 -- (-233.543) (-235.471) (-235.818) [-233.719] * (-236.652) [-237.407] (-237.583) (-233.570) -- 0:00:37
368500 -- [-233.129] (-234.403) (-235.209) (-235.442) * [-236.491] (-237.025) (-234.697) (-242.038) -- 0:00:37
369000 -- (-235.476) (-233.806) (-233.859) [-233.941] * (-234.184) (-235.059) (-234.157) [-237.716] -- 0:00:37
369500 -- (-234.411) (-234.574) (-236.781) [-234.053] * [-235.505] (-238.102) (-234.953) (-234.821) -- 0:00:37
370000 -- (-233.873) [-233.699] (-235.866) (-234.952) * (-236.434) (-238.573) [-233.995] (-234.686) -- 0:00:37
Average standard deviation of split frequencies: 0.019289
370500 -- (-234.342) [-234.795] (-237.534) (-237.857) * (-234.621) (-237.539) [-233.894] (-233.950) -- 0:00:37
371000 -- (-234.492) (-239.587) (-241.008) [-233.028] * (-235.253) [-236.715] (-236.462) (-233.542) -- 0:00:37
371500 -- (-236.219) [-235.433] (-237.112) (-238.747) * (-237.649) (-234.583) [-237.056] (-236.413) -- 0:00:37
372000 -- (-234.386) [-236.598] (-235.406) (-238.272) * [-234.456] (-233.612) (-237.253) (-237.855) -- 0:00:37
372500 -- [-237.364] (-235.507) (-234.698) (-234.997) * [-234.072] (-236.395) (-235.685) (-237.323) -- 0:00:37
373000 -- (-234.501) (-239.578) (-235.909) [-234.441] * (-234.832) (-238.034) [-235.342] (-234.937) -- 0:00:38
373500 -- (-236.693) (-236.662) [-234.039] (-233.946) * [-234.245] (-233.833) (-233.933) (-240.784) -- 0:00:38
374000 -- [-236.105] (-236.410) (-235.780) (-236.773) * (-233.877) [-234.445] (-235.239) (-236.206) -- 0:00:38
374500 -- [-235.069] (-234.869) (-234.496) (-241.598) * (-233.649) (-235.098) [-235.204] (-233.375) -- 0:00:38
375000 -- (-237.741) (-234.344) [-234.480] (-241.930) * [-234.149] (-233.480) (-235.453) (-234.571) -- 0:00:38
Average standard deviation of split frequencies: 0.019015
375500 -- (-235.263) (-234.356) [-236.251] (-237.299) * (-233.849) [-234.938] (-234.659) (-234.153) -- 0:00:38
376000 -- [-233.708] (-236.333) (-236.238) (-235.668) * [-235.347] (-235.316) (-235.323) (-237.252) -- 0:00:38
376500 -- (-235.913) [-239.720] (-235.264) (-235.385) * (-233.970) [-233.538] (-238.564) (-234.800) -- 0:00:38
377000 -- (-235.136) (-237.075) (-235.117) [-234.150] * (-234.482) (-233.579) (-233.707) [-234.550] -- 0:00:38
377500 -- (-236.984) [-234.620] (-233.448) (-234.862) * (-234.129) [-234.885] (-235.148) (-233.844) -- 0:00:37
378000 -- (-238.522) (-237.936) [-235.321] (-236.757) * (-238.511) [-234.019] (-238.743) (-237.251) -- 0:00:37
378500 -- (-238.424) (-236.702) [-237.849] (-234.964) * (-237.218) [-234.154] (-239.472) (-236.316) -- 0:00:37
379000 -- (-238.907) (-235.139) (-238.639) [-235.273] * (-238.214) [-234.786] (-239.325) (-235.139) -- 0:00:37
379500 -- (-235.605) (-237.255) (-239.355) [-234.142] * (-237.215) (-236.614) [-234.738] (-239.910) -- 0:00:37
380000 -- [-235.695] (-236.270) (-237.834) (-239.208) * (-235.161) (-238.358) [-233.878] (-234.075) -- 0:00:37
Average standard deviation of split frequencies: 0.017847
380500 -- [-234.896] (-234.543) (-238.360) (-239.584) * (-235.109) (-234.556) (-234.779) [-233.438] -- 0:00:37
381000 -- [-234.238] (-235.038) (-236.162) (-237.698) * (-234.721) [-236.628] (-233.906) (-233.799) -- 0:00:37
381500 -- [-233.269] (-234.499) (-233.196) (-233.556) * (-234.919) [-235.119] (-234.470) (-237.005) -- 0:00:37
382000 -- (-241.202) (-234.120) (-234.926) [-235.670] * (-236.516) [-235.078] (-233.780) (-238.285) -- 0:00:37
382500 -- (-236.664) [-234.013] (-235.233) (-239.001) * (-234.863) (-234.257) [-234.086] (-237.126) -- 0:00:37
383000 -- (-239.021) (-235.543) (-234.722) [-237.496] * (-235.118) (-236.079) [-233.397] (-235.840) -- 0:00:37
383500 -- (-236.521) (-233.824) (-235.074) [-233.325] * [-236.458] (-233.742) (-234.446) (-236.921) -- 0:00:36
384000 -- (-236.389) [-233.455] (-233.898) (-236.121) * (-236.124) (-235.242) (-233.888) [-235.488] -- 0:00:36
384500 -- (-238.238) (-233.522) [-234.648] (-235.375) * (-237.974) (-238.550) [-237.673] (-236.843) -- 0:00:36
385000 -- (-234.088) [-237.068] (-235.332) (-233.827) * (-234.119) [-237.832] (-234.625) (-239.930) -- 0:00:36
Average standard deviation of split frequencies: 0.017026
385500 -- (-235.367) [-234.619] (-235.433) (-240.760) * [-236.583] (-235.682) (-235.187) (-237.709) -- 0:00:36
386000 -- (-234.279) (-234.358) [-235.961] (-234.531) * (-237.408) (-235.731) [-234.948] (-234.252) -- 0:00:36
386500 -- (-235.323) (-240.745) (-235.228) [-234.108] * (-235.805) (-234.421) (-236.699) [-236.992] -- 0:00:36
387000 -- (-233.482) (-237.914) (-234.087) [-233.509] * [-233.621] (-242.955) (-236.263) (-242.046) -- 0:00:36
387500 -- [-235.169] (-239.759) (-234.388) (-233.449) * (-234.154) (-238.961) (-235.906) [-236.526] -- 0:00:36
388000 -- (-235.829) (-235.589) [-234.631] (-234.408) * (-236.904) (-236.049) (-238.256) [-236.847] -- 0:00:36
388500 -- [-234.962] (-237.151) (-234.725) (-239.071) * (-234.972) (-235.255) [-235.113] (-235.291) -- 0:00:36
389000 -- (-234.095) (-234.206) (-233.564) [-236.625] * [-234.177] (-234.457) (-234.964) (-239.961) -- 0:00:36
389500 -- (-235.324) (-236.417) [-233.769] (-234.005) * (-234.222) (-237.786) (-235.096) [-234.388] -- 0:00:36
390000 -- (-234.178) (-235.004) (-233.905) [-236.640] * (-235.303) (-238.230) [-236.120] (-238.606) -- 0:00:37
Average standard deviation of split frequencies: 0.016290
390500 -- (-236.683) [-234.330] (-234.703) (-234.486) * [-235.805] (-235.349) (-234.335) (-236.523) -- 0:00:37
391000 -- (-235.792) (-234.527) (-234.187) [-235.398] * (-237.055) [-233.680] (-236.363) (-235.063) -- 0:00:37
391500 -- (-238.288) (-237.081) (-234.483) [-235.040] * (-234.414) (-237.267) [-233.901] (-235.206) -- 0:00:37
392000 -- (-235.746) (-236.362) (-237.312) [-238.045] * (-237.765) (-235.126) [-235.040] (-234.263) -- 0:00:37
392500 -- (-235.108) [-236.847] (-234.317) (-235.783) * [-233.352] (-237.848) (-235.125) (-233.440) -- 0:00:37
393000 -- (-235.824) [-233.490] (-235.655) (-235.291) * (-233.554) [-234.919] (-237.522) (-235.303) -- 0:00:37
393500 -- (-236.794) (-235.029) (-240.229) [-235.027] * [-234.197] (-233.584) (-233.771) (-234.228) -- 0:00:36
394000 -- (-233.024) (-235.516) (-237.275) [-238.200] * (-234.183) (-235.198) (-234.501) [-234.950] -- 0:00:36
394500 -- (-234.145) [-235.432] (-238.405) (-236.100) * (-234.122) (-235.132) [-233.444] (-235.737) -- 0:00:36
395000 -- (-233.266) (-234.425) [-235.573] (-234.098) * (-237.535) [-233.372] (-235.791) (-237.213) -- 0:00:36
Average standard deviation of split frequencies: 0.015896
395500 -- (-234.608) (-236.941) (-236.688) [-234.210] * (-234.423) (-234.133) (-233.346) [-234.071] -- 0:00:36
396000 -- [-233.666] (-235.179) (-235.269) (-237.739) * (-234.147) (-233.369) [-234.724] (-236.169) -- 0:00:36
396500 -- (-233.055) [-236.078] (-234.954) (-234.593) * (-235.675) (-233.523) (-235.925) [-236.266] -- 0:00:36
397000 -- [-235.263] (-234.566) (-233.843) (-233.505) * (-233.483) (-235.306) [-238.743] (-240.368) -- 0:00:36
397500 -- [-235.529] (-234.187) (-238.745) (-235.696) * (-237.759) [-235.405] (-236.117) (-234.149) -- 0:00:36
398000 -- [-236.098] (-237.986) (-237.001) (-234.629) * [-235.456] (-237.525) (-234.944) (-234.713) -- 0:00:36
398500 -- (-237.376) [-236.539] (-234.288) (-234.959) * [-235.591] (-237.197) (-236.469) (-234.328) -- 0:00:36
399000 -- (-235.628) (-234.632) (-234.175) [-235.916] * [-237.838] (-234.968) (-233.579) (-233.960) -- 0:00:36
399500 -- (-237.130) (-234.154) (-234.846) [-233.797] * (-238.059) (-234.830) (-234.274) [-233.750] -- 0:00:36
400000 -- (-235.368) [-233.932] (-234.903) (-233.917) * (-248.206) [-234.421] (-239.474) (-235.633) -- 0:00:36
Average standard deviation of split frequencies: 0.015157
400500 -- (-236.649) (-235.306) (-233.866) [-236.343] * (-240.771) (-234.581) (-234.136) [-234.600] -- 0:00:35
401000 -- [-235.868] (-235.851) (-236.688) (-239.997) * [-236.446] (-236.172) (-235.417) (-234.153) -- 0:00:35
401500 -- [-233.629] (-235.908) (-235.935) (-234.149) * [-234.749] (-234.028) (-233.583) (-234.857) -- 0:00:35
402000 -- (-233.441) [-234.754] (-235.088) (-234.646) * [-238.214] (-238.287) (-236.474) (-233.545) -- 0:00:35
402500 -- [-234.441] (-234.092) (-237.824) (-238.572) * (-236.647) (-235.737) [-235.187] (-238.193) -- 0:00:35
403000 -- [-233.095] (-234.682) (-236.338) (-236.096) * [-234.049] (-233.753) (-236.135) (-235.022) -- 0:00:35
403500 -- (-236.993) [-235.878] (-237.374) (-233.936) * (-234.622) [-234.290] (-237.002) (-234.415) -- 0:00:35
404000 -- [-234.465] (-235.675) (-233.575) (-234.032) * (-237.272) [-235.901] (-235.889) (-234.249) -- 0:00:35
404500 -- (-240.270) (-235.764) [-237.052] (-234.451) * (-236.467) [-235.169] (-235.890) (-233.363) -- 0:00:35
405000 -- (-234.567) [-236.446] (-236.044) (-234.966) * [-233.429] (-235.501) (-234.368) (-234.083) -- 0:00:35
Average standard deviation of split frequencies: 0.015352
405500 -- (-238.454) (-236.842) (-236.085) [-233.852] * (-232.983) [-235.709] (-233.878) (-233.756) -- 0:00:35
406000 -- (-235.704) (-235.971) [-235.648] (-236.370) * (-238.176) [-238.387] (-234.633) (-236.967) -- 0:00:35
406500 -- (-234.232) (-235.684) (-237.215) [-233.884] * (-235.399) (-240.316) [-236.754] (-235.923) -- 0:00:35
407000 -- (-235.835) (-234.174) (-236.965) [-236.010] * [-237.169] (-235.324) (-237.504) (-239.125) -- 0:00:36
407500 -- [-235.978] (-234.436) (-237.515) (-235.749) * [-234.749] (-235.736) (-234.025) (-236.295) -- 0:00:36
408000 -- [-239.626] (-238.416) (-233.711) (-234.809) * (-234.662) (-233.420) [-233.814] (-235.399) -- 0:00:36
408500 -- (-239.277) (-236.657) (-236.155) [-234.977] * (-235.363) (-237.421) (-235.038) [-234.641] -- 0:00:36
409000 -- (-234.890) (-235.058) [-235.485] (-233.566) * (-240.922) (-234.319) [-234.767] (-236.691) -- 0:00:36
409500 -- (-236.416) [-236.388] (-235.664) (-234.483) * (-236.055) (-236.650) (-235.693) [-236.752] -- 0:00:36
410000 -- (-233.527) [-235.047] (-234.715) (-234.764) * (-235.218) (-235.428) (-234.326) [-235.283] -- 0:00:35
Average standard deviation of split frequencies: 0.014923
410500 -- (-233.184) (-235.051) (-236.066) [-234.591] * (-235.559) [-234.172] (-235.433) (-233.518) -- 0:00:35
411000 -- [-235.944] (-240.217) (-238.202) (-236.306) * (-234.787) [-233.969] (-233.410) (-236.004) -- 0:00:35
411500 -- (-233.116) (-233.813) [-235.247] (-237.622) * (-235.651) (-233.489) (-233.158) [-233.638] -- 0:00:35
412000 -- (-236.828) (-240.449) (-233.882) [-234.898] * (-235.743) (-238.635) (-236.163) [-234.248] -- 0:00:35
412500 -- (-236.662) [-239.653] (-234.429) (-236.322) * [-234.543] (-235.614) (-234.678) (-236.484) -- 0:00:35
413000 -- (-239.449) (-239.909) (-235.936) [-233.720] * (-236.746) [-235.832] (-235.905) (-236.623) -- 0:00:35
413500 -- (-238.248) (-235.542) (-236.473) [-234.110] * [-236.177] (-235.191) (-233.191) (-233.949) -- 0:00:35
414000 -- (-234.995) [-234.112] (-238.259) (-235.011) * (-235.487) (-233.594) [-234.795] (-233.721) -- 0:00:35
414500 -- (-244.600) (-235.644) (-237.793) [-235.106] * [-234.314] (-234.012) (-236.390) (-233.985) -- 0:00:35
415000 -- (-235.153) (-238.902) (-237.010) [-234.529] * (-236.154) (-235.624) (-234.409) [-234.195] -- 0:00:35
Average standard deviation of split frequencies: 0.014731
415500 -- [-234.427] (-235.263) (-234.059) (-234.710) * (-235.176) (-235.384) (-237.365) [-235.251] -- 0:00:35
416000 -- [-235.406] (-234.044) (-234.030) (-235.146) * (-237.676) [-236.027] (-239.582) (-237.771) -- 0:00:35
416500 -- (-234.047) (-236.397) [-234.946] (-239.941) * [-234.987] (-235.796) (-236.849) (-235.680) -- 0:00:35
417000 -- (-235.157) (-239.252) [-235.222] (-236.754) * (-233.745) (-235.946) (-234.136) [-235.742] -- 0:00:34
417500 -- (-236.953) (-234.229) (-237.114) [-236.728] * (-233.070) (-237.482) [-236.223] (-235.681) -- 0:00:34
418000 -- (-233.469) (-238.150) (-238.493) [-234.267] * [-233.330] (-236.167) (-234.912) (-235.974) -- 0:00:34
418500 -- [-234.245] (-235.455) (-237.153) (-235.888) * [-234.113] (-239.244) (-235.923) (-234.605) -- 0:00:34
419000 -- (-237.019) (-233.451) [-235.479] (-238.153) * (-234.752) (-239.115) [-233.413] (-236.050) -- 0:00:34
419500 -- [-235.482] (-235.172) (-234.119) (-233.766) * (-233.769) (-236.779) (-234.092) [-233.851] -- 0:00:34
420000 -- (-234.742) (-233.543) [-233.848] (-236.530) * (-242.480) (-235.494) [-234.023] (-234.521) -- 0:00:34
Average standard deviation of split frequencies: 0.013645
420500 -- [-237.859] (-234.190) (-234.561) (-235.953) * (-236.707) [-236.576] (-236.467) (-237.365) -- 0:00:34
421000 -- (-239.822) (-234.486) [-236.039] (-237.095) * (-236.241) (-239.666) (-235.430) [-235.354] -- 0:00:34
421500 -- (-233.835) [-234.902] (-234.413) (-240.881) * (-235.453) (-235.824) [-235.016] (-234.855) -- 0:00:34
422000 -- [-234.187] (-235.470) (-233.706) (-241.284) * (-235.031) [-234.331] (-234.373) (-237.325) -- 0:00:34
422500 -- (-236.211) [-235.463] (-233.913) (-235.817) * (-238.915) [-235.733] (-234.113) (-240.286) -- 0:00:34
423000 -- (-234.345) [-238.170] (-237.158) (-235.620) * [-234.833] (-238.032) (-234.314) (-236.049) -- 0:00:34
423500 -- (-236.637) (-236.300) (-234.680) [-236.531] * (-234.614) (-236.551) [-233.601] (-237.085) -- 0:00:34
424000 -- [-235.330] (-234.318) (-241.359) (-237.998) * (-233.626) (-234.892) (-233.202) [-233.890] -- 0:00:35
424500 -- [-235.828] (-239.124) (-236.955) (-235.299) * (-234.658) (-235.511) [-235.516] (-233.629) -- 0:00:35
425000 -- (-238.165) (-234.924) [-234.817] (-235.196) * [-235.538] (-233.562) (-233.790) (-237.000) -- 0:00:35
Average standard deviation of split frequencies: 0.013771
425500 -- (-234.700) [-237.633] (-235.486) (-235.077) * (-233.634) [-234.233] (-234.586) (-236.928) -- 0:00:35
426000 -- [-234.192] (-236.163) (-233.539) (-235.732) * (-236.042) (-234.149) [-233.305] (-238.755) -- 0:00:35
426500 -- (-236.575) [-237.762] (-234.288) (-240.082) * [-235.201] (-234.754) (-235.258) (-233.848) -- 0:00:34
427000 -- [-234.954] (-235.349) (-237.886) (-235.128) * [-234.201] (-233.227) (-233.684) (-236.015) -- 0:00:34
427500 -- (-236.054) [-235.160] (-234.091) (-236.023) * (-236.535) (-233.604) (-234.682) [-234.114] -- 0:00:34
428000 -- [-242.275] (-233.811) (-234.540) (-236.205) * (-236.368) (-234.218) [-235.483] (-233.777) -- 0:00:34
428500 -- (-237.065) (-233.733) [-236.571] (-235.461) * [-235.718] (-234.516) (-240.310) (-234.721) -- 0:00:34
429000 -- (-234.908) (-235.424) (-237.255) [-234.388] * [-235.353] (-234.278) (-234.401) (-234.161) -- 0:00:34
429500 -- [-237.329] (-234.992) (-237.698) (-240.696) * [-241.754] (-236.738) (-235.284) (-234.731) -- 0:00:34
430000 -- [-233.340] (-233.950) (-238.985) (-239.808) * (-234.564) [-235.724] (-233.425) (-234.463) -- 0:00:34
Average standard deviation of split frequencies: 0.013378
430500 -- [-233.876] (-237.438) (-239.340) (-237.210) * (-235.811) (-239.911) (-233.637) [-234.109] -- 0:00:34
431000 -- (-234.088) [-236.323] (-234.376) (-234.751) * [-235.418] (-236.112) (-234.725) (-234.565) -- 0:00:34
431500 -- (-234.742) (-235.184) [-233.832] (-235.391) * (-236.116) [-234.795] (-236.912) (-235.216) -- 0:00:34
432000 -- [-234.471] (-233.611) (-233.197) (-234.763) * [-234.507] (-235.567) (-235.881) (-235.426) -- 0:00:34
432500 -- (-236.606) (-233.418) [-236.484] (-236.050) * (-237.052) (-234.217) [-237.378] (-236.121) -- 0:00:34
433000 -- (-233.622) [-234.419] (-236.012) (-233.450) * (-236.757) (-234.675) [-234.856] (-234.440) -- 0:00:34
433500 -- [-234.140] (-240.513) (-235.947) (-236.157) * (-237.187) (-234.558) (-234.101) [-235.417] -- 0:00:33
434000 -- (-234.534) (-240.775) [-234.297] (-237.453) * (-237.348) (-236.284) (-238.592) [-237.590] -- 0:00:33
434500 -- [-234.487] (-238.792) (-239.270) (-234.342) * (-236.772) (-236.241) (-234.708) [-234.456] -- 0:00:33
435000 -- (-234.437) [-235.434] (-235.378) (-234.380) * (-234.393) (-236.239) (-238.681) [-236.477] -- 0:00:33
Average standard deviation of split frequencies: 0.013335
435500 -- (-236.990) (-237.277) (-237.425) [-234.584] * (-237.330) (-234.587) [-235.662] (-234.057) -- 0:00:33
436000 -- [-234.090] (-237.952) (-234.419) (-239.845) * (-238.897) (-235.947) [-234.957] (-238.329) -- 0:00:33
436500 -- (-234.472) [-234.477] (-238.504) (-237.954) * (-234.172) (-234.513) [-237.197] (-238.072) -- 0:00:33
437000 -- (-234.878) [-235.842] (-237.755) (-238.260) * [-234.054] (-234.448) (-233.639) (-239.090) -- 0:00:33
437500 -- (-237.119) (-235.743) (-235.696) [-234.234] * [-237.693] (-236.232) (-234.938) (-234.862) -- 0:00:33
438000 -- (-234.966) (-233.864) [-234.449] (-233.318) * [-235.840] (-236.611) (-233.262) (-235.561) -- 0:00:33
438500 -- (-237.975) (-234.761) [-235.071] (-234.213) * (-233.680) [-237.718] (-233.028) (-241.680) -- 0:00:33
439000 -- (-234.198) (-237.297) (-235.647) [-235.488] * [-235.305] (-237.692) (-236.711) (-234.113) -- 0:00:33
439500 -- [-234.083] (-239.791) (-234.886) (-233.478) * (-239.084) (-236.680) [-234.433] (-236.077) -- 0:00:33
440000 -- (-234.768) (-239.917) [-234.515] (-235.404) * [-233.631] (-235.338) (-236.184) (-237.078) -- 0:00:33
Average standard deviation of split frequencies: 0.013152
440500 -- (-234.422) [-241.565] (-238.824) (-236.515) * (-236.518) (-235.154) [-234.593] (-235.441) -- 0:00:34
441000 -- (-235.451) (-242.362) (-239.033) [-236.006] * (-236.015) (-234.971) [-234.594] (-233.937) -- 0:00:34
441500 -- (-235.077) (-235.033) [-236.385] (-237.370) * [-233.811] (-234.286) (-236.298) (-235.497) -- 0:00:34
442000 -- [-235.771] (-234.971) (-235.736) (-236.335) * (-233.464) (-237.874) (-238.726) [-234.671] -- 0:00:34
442500 -- [-234.776] (-233.895) (-238.010) (-237.345) * (-238.074) (-234.099) [-233.642] (-239.078) -- 0:00:34
443000 -- (-235.000) [-233.840] (-233.894) (-237.808) * (-235.784) (-235.200) [-234.259] (-238.491) -- 0:00:33
443500 -- [-234.422] (-235.255) (-237.244) (-237.928) * [-233.843] (-237.338) (-233.892) (-233.945) -- 0:00:33
444000 -- (-233.618) (-234.748) (-235.718) [-237.541] * [-233.209] (-234.631) (-233.009) (-239.558) -- 0:00:33
444500 -- [-235.734] (-235.166) (-237.839) (-234.814) * (-233.253) (-235.843) (-234.023) [-235.691] -- 0:00:33
445000 -- (-235.544) (-233.483) (-235.998) [-235.554] * (-237.289) (-237.601) (-238.211) [-234.173] -- 0:00:33
Average standard deviation of split frequencies: 0.013623
445500 -- (-234.793) [-234.055] (-234.722) (-236.515) * (-233.591) (-234.970) [-236.012] (-237.317) -- 0:00:33
446000 -- (-237.910) [-236.112] (-234.942) (-238.323) * (-237.826) [-238.839] (-235.439) (-236.178) -- 0:00:33
446500 -- (-235.353) (-236.359) (-234.529) [-234.770] * (-238.113) (-233.756) [-233.946] (-236.090) -- 0:00:33
447000 -- [-235.597] (-235.429) (-237.895) (-236.495) * (-237.263) [-235.655] (-237.777) (-237.204) -- 0:00:33
447500 -- (-234.573) [-234.240] (-234.235) (-235.364) * [-234.970] (-235.284) (-235.442) (-238.888) -- 0:00:33
448000 -- (-233.818) (-236.442) (-234.612) [-235.013] * (-234.045) [-233.912] (-235.195) (-237.211) -- 0:00:33
448500 -- (-235.271) (-233.379) (-237.229) [-235.203] * [-234.793] (-236.909) (-234.368) (-241.360) -- 0:00:33
449000 -- (-234.977) (-236.449) (-233.956) [-234.127] * (-236.088) (-235.585) (-238.209) [-238.458] -- 0:00:33
449500 -- [-234.701] (-236.782) (-235.532) (-234.612) * (-235.462) (-240.016) [-232.929] (-238.438) -- 0:00:33
450000 -- (-233.620) (-233.642) (-234.864) [-240.024] * (-234.380) (-235.148) [-238.792] (-236.187) -- 0:00:33
Average standard deviation of split frequencies: 0.014179
450500 -- [-233.337] (-233.561) (-235.074) (-238.663) * (-236.881) (-235.426) [-235.473] (-234.854) -- 0:00:32
451000 -- (-234.204) [-233.469] (-236.787) (-236.980) * (-234.708) (-235.038) (-236.732) [-233.724] -- 0:00:32
451500 -- (-234.754) (-237.225) [-233.061] (-237.189) * (-234.426) [-234.112] (-237.837) (-236.025) -- 0:00:32
452000 -- (-239.473) (-234.174) [-234.970] (-234.832) * (-235.400) [-235.538] (-238.859) (-235.109) -- 0:00:32
452500 -- (-234.737) (-237.510) (-233.676) [-237.865] * (-237.501) (-235.552) [-239.650] (-234.861) -- 0:00:32
453000 -- (-233.475) (-233.584) (-234.586) [-233.233] * (-236.555) [-234.708] (-235.791) (-234.831) -- 0:00:32
453500 -- [-233.309] (-238.548) (-234.399) (-235.273) * (-238.122) (-234.164) [-234.779] (-238.285) -- 0:00:32
454000 -- [-234.452] (-236.229) (-234.764) (-233.834) * (-239.256) (-234.080) [-234.230] (-235.232) -- 0:00:32
454500 -- [-235.076] (-237.358) (-237.050) (-235.683) * [-234.209] (-233.737) (-237.250) (-236.136) -- 0:00:32
455000 -- (-234.944) (-235.015) [-235.033] (-235.633) * (-234.044) [-236.876] (-233.234) (-237.291) -- 0:00:32
Average standard deviation of split frequencies: 0.014186
455500 -- (-235.708) [-235.405] (-233.305) (-235.063) * (-234.718) (-233.767) (-233.905) [-236.577] -- 0:00:32
456000 -- (-234.118) [-239.309] (-235.696) (-234.949) * (-237.881) (-233.393) (-237.776) [-236.394] -- 0:00:32
456500 -- [-234.740] (-235.588) (-232.968) (-233.985) * [-239.428] (-233.022) (-234.443) (-234.806) -- 0:00:32
457000 -- (-235.445) (-237.092) [-234.912] (-235.383) * (-237.650) (-233.515) (-236.700) [-234.817] -- 0:00:32
457500 -- (-235.390) (-238.715) (-234.435) [-237.246] * (-236.451) (-236.247) [-236.210] (-236.189) -- 0:00:33
458000 -- (-234.942) (-235.295) (-233.116) [-233.883] * [-235.341] (-235.655) (-233.527) (-242.313) -- 0:00:33
458500 -- [-235.121] (-239.954) (-233.036) (-234.941) * [-236.677] (-238.579) (-236.269) (-234.627) -- 0:00:33
459000 -- (-234.591) [-237.336] (-233.888) (-234.877) * (-233.127) (-237.295) (-233.726) [-235.766] -- 0:00:33
459500 -- (-236.226) [-234.335] (-234.628) (-235.934) * [-234.059] (-235.507) (-235.063) (-233.766) -- 0:00:32
460000 -- (-236.436) (-234.954) (-235.413) [-235.489] * (-238.925) [-235.886] (-237.475) (-237.598) -- 0:00:32
Average standard deviation of split frequencies: 0.014213
460500 -- (-237.663) (-235.471) [-236.340] (-238.282) * (-236.805) (-236.866) [-238.865] (-237.128) -- 0:00:32
461000 -- (-234.761) (-236.950) [-236.961] (-239.406) * (-237.241) (-235.342) (-237.792) [-235.880] -- 0:00:32
461500 -- (-237.516) (-235.731) (-236.475) [-235.411] * [-235.750] (-234.882) (-236.811) (-239.883) -- 0:00:32
462000 -- (-234.922) (-237.990) [-236.262] (-238.160) * (-236.438) (-240.702) (-235.280) [-234.164] -- 0:00:32
462500 -- (-236.776) (-235.650) (-236.992) [-236.729] * [-234.670] (-235.057) (-235.131) (-234.762) -- 0:00:32
463000 -- (-234.284) (-234.812) [-233.446] (-234.940) * (-234.379) (-236.902) (-234.561) [-236.067] -- 0:00:32
463500 -- [-238.853] (-234.552) (-237.430) (-234.298) * (-233.399) (-235.624) [-235.084] (-234.397) -- 0:00:32
464000 -- (-234.099) [-236.273] (-237.038) (-235.685) * (-234.047) [-240.130] (-234.936) (-236.546) -- 0:00:32
464500 -- (-236.204) (-235.636) (-236.111) [-238.945] * (-236.108) (-237.056) [-236.610] (-234.399) -- 0:00:32
465000 -- (-234.030) (-237.516) (-237.491) [-234.716] * (-235.818) (-233.764) [-235.285] (-235.986) -- 0:00:32
Average standard deviation of split frequencies: 0.014612
465500 -- [-238.504] (-236.871) (-235.832) (-237.071) * [-235.849] (-233.940) (-235.748) (-234.047) -- 0:00:32
466000 -- [-235.670] (-237.276) (-238.846) (-236.794) * (-236.713) (-233.594) (-236.477) [-233.495] -- 0:00:32
466500 -- (-235.584) (-235.657) [-237.537] (-240.252) * (-241.375) (-234.255) [-233.592] (-233.772) -- 0:00:32
467000 -- (-234.783) [-234.233] (-233.957) (-234.791) * (-237.112) (-234.218) [-234.989] (-235.214) -- 0:00:31
467500 -- (-234.315) (-233.996) (-234.572) [-234.089] * [-235.030] (-235.985) (-234.965) (-239.809) -- 0:00:31
468000 -- (-233.721) (-236.363) (-236.214) [-233.368] * (-235.874) [-234.063] (-236.865) (-233.884) -- 0:00:31
468500 -- (-238.318) (-235.450) [-233.408] (-233.543) * (-234.712) [-233.522] (-238.369) (-235.139) -- 0:00:31
469000 -- [-234.881] (-237.637) (-233.165) (-234.574) * [-234.678] (-235.178) (-234.196) (-237.944) -- 0:00:31
469500 -- (-233.464) (-234.729) (-233.272) [-238.843] * [-234.789] (-234.528) (-237.867) (-240.145) -- 0:00:31
470000 -- [-234.480] (-235.894) (-235.759) (-235.518) * [-235.345] (-233.370) (-235.692) (-233.446) -- 0:00:31
Average standard deviation of split frequencies: 0.015135
470500 -- (-242.825) (-234.466) [-237.723] (-234.862) * (-236.940) (-233.311) [-234.828] (-235.151) -- 0:00:31
471000 -- (-237.170) (-236.830) [-240.508] (-233.940) * (-236.176) (-233.520) (-241.937) [-235.207] -- 0:00:31
471500 -- (-236.067) (-236.776) (-235.530) [-234.742] * (-235.100) [-233.263] (-234.934) (-235.193) -- 0:00:31
472000 -- [-237.839] (-234.802) (-235.388) (-235.298) * (-234.472) (-238.919) (-236.154) [-237.839] -- 0:00:31
472500 -- (-233.252) [-236.031] (-237.315) (-234.238) * (-233.645) (-233.910) [-234.317] (-237.315) -- 0:00:31
473000 -- (-234.030) [-237.918] (-235.842) (-236.009) * (-233.537) (-234.911) (-237.130) [-235.823] -- 0:00:31
473500 -- (-235.084) (-233.380) (-235.138) [-234.727] * [-233.556] (-236.093) (-236.834) (-235.314) -- 0:00:31
474000 -- (-236.668) (-234.451) [-234.465] (-234.846) * (-234.069) (-238.773) (-237.996) [-235.266] -- 0:00:31
474500 -- (-234.069) (-237.180) [-235.541] (-234.358) * (-235.458) (-239.674) [-236.657] (-235.120) -- 0:00:32
475000 -- (-234.190) (-236.429) [-235.238] (-233.905) * [-233.476] (-235.831) (-238.852) (-234.805) -- 0:00:32
Average standard deviation of split frequencies: 0.015350
475500 -- (-235.600) (-233.567) [-234.143] (-235.360) * (-233.915) [-236.365] (-235.047) (-236.894) -- 0:00:31
476000 -- (-234.655) [-235.878] (-234.198) (-241.708) * (-233.876) (-234.083) [-233.744] (-234.216) -- 0:00:31
476500 -- (-233.542) (-236.940) [-233.787] (-241.678) * (-239.300) (-237.628) (-234.696) [-234.175] -- 0:00:31
477000 -- (-243.049) [-233.856] (-248.915) (-233.289) * (-239.576) (-235.952) (-234.281) [-236.250] -- 0:00:31
477500 -- (-235.354) (-235.981) (-234.022) [-234.830] * (-238.099) [-235.031] (-233.458) (-235.616) -- 0:00:31
478000 -- (-237.537) [-235.787] (-233.147) (-235.079) * (-234.006) (-234.303) (-233.783) [-235.542] -- 0:00:31
478500 -- (-237.599) [-235.172] (-234.084) (-236.301) * (-237.318) (-235.881) (-233.977) [-235.601] -- 0:00:31
479000 -- (-238.477) (-233.723) [-234.672] (-235.741) * (-233.902) (-234.962) [-234.412] (-234.074) -- 0:00:31
479500 -- (-243.762) (-235.547) (-233.278) [-237.288] * (-237.836) (-237.329) [-234.592] (-234.631) -- 0:00:31
480000 -- (-236.435) [-235.358] (-233.607) (-238.421) * [-239.621] (-237.816) (-234.211) (-234.285) -- 0:00:31
Average standard deviation of split frequencies: 0.015637
480500 -- (-238.467) [-234.218] (-235.077) (-235.749) * (-240.187) (-235.993) (-234.444) [-236.101] -- 0:00:31
481000 -- (-237.361) [-234.640] (-237.464) (-235.454) * (-233.814) [-235.279] (-238.980) (-237.523) -- 0:00:31
481500 -- (-237.042) (-237.667) [-233.442] (-235.542) * [-234.809] (-237.125) (-234.342) (-236.322) -- 0:00:31
482000 -- (-237.519) [-234.088] (-234.656) (-236.407) * (-235.160) [-234.998] (-235.081) (-235.884) -- 0:00:31
482500 -- (-235.209) [-234.634] (-234.898) (-233.240) * (-235.888) (-234.576) (-238.814) [-236.942] -- 0:00:31
483000 -- (-236.560) (-237.337) [-234.032] (-235.211) * [-233.667] (-235.617) (-236.036) (-233.575) -- 0:00:31
483500 -- (-236.942) (-237.146) (-234.640) [-234.539] * (-235.191) (-234.127) (-235.054) [-236.931] -- 0:00:30
484000 -- (-236.057) (-236.860) [-233.517] (-234.999) * (-233.282) (-234.372) (-238.593) [-234.749] -- 0:00:30
484500 -- (-236.821) (-234.642) (-233.756) [-234.547] * (-235.114) (-237.176) [-242.392] (-233.526) -- 0:00:30
485000 -- (-234.992) (-235.625) [-233.903] (-234.072) * (-232.997) [-235.621] (-238.062) (-233.997) -- 0:00:30
Average standard deviation of split frequencies: 0.016541
485500 -- (-234.521) (-235.359) (-236.952) [-233.467] * (-237.995) [-236.718] (-237.787) (-233.723) -- 0:00:30
486000 -- (-235.879) [-235.562] (-236.736) (-237.647) * [-234.479] (-237.986) (-235.906) (-234.568) -- 0:00:30
486500 -- (-237.426) (-234.102) [-234.175] (-233.770) * [-234.980] (-235.982) (-238.755) (-234.191) -- 0:00:30
487000 -- (-233.634) [-235.561] (-238.760) (-235.925) * (-235.894) (-236.115) [-233.656] (-234.955) -- 0:00:30
487500 -- (-233.809) (-233.112) (-235.494) [-236.599] * [-235.786] (-238.031) (-236.540) (-234.510) -- 0:00:30
488000 -- (-236.290) (-234.374) (-234.176) [-237.346] * (-236.940) [-236.763] (-234.626) (-236.558) -- 0:00:30
488500 -- (-234.954) [-234.338] (-236.630) (-234.407) * (-234.206) [-235.355] (-233.955) (-235.461) -- 0:00:30
489000 -- (-234.940) (-234.878) [-234.561] (-235.302) * (-233.655) (-239.970) (-235.064) [-236.173] -- 0:00:30
489500 -- (-235.962) [-234.391] (-239.035) (-233.412) * (-236.540) (-238.170) [-237.341] (-238.084) -- 0:00:30
490000 -- [-234.718] (-235.356) (-238.385) (-233.542) * (-234.698) (-235.934) (-236.112) [-239.499] -- 0:00:30
Average standard deviation of split frequencies: 0.016066
490500 -- (-235.775) (-236.586) [-235.158] (-235.731) * (-234.253) [-235.678] (-234.197) (-236.180) -- 0:00:30
491000 -- [-233.999] (-235.789) (-235.001) (-236.148) * (-235.763) [-236.046] (-236.610) (-236.291) -- 0:00:30
491500 -- (-234.118) [-235.031] (-234.727) (-237.250) * (-240.496) (-235.826) [-235.154] (-235.195) -- 0:00:31
492000 -- (-234.100) [-233.381] (-234.833) (-236.026) * (-235.151) [-235.772] (-234.840) (-237.229) -- 0:00:30
492500 -- (-234.695) [-234.488] (-235.765) (-233.765) * [-234.450] (-235.689) (-235.750) (-236.116) -- 0:00:30
493000 -- [-234.946] (-234.914) (-236.305) (-233.883) * (-233.191) (-238.641) (-234.586) [-235.778] -- 0:00:30
493500 -- (-236.172) (-234.689) [-233.656] (-235.130) * [-234.316] (-234.042) (-236.162) (-235.000) -- 0:00:30
494000 -- (-237.368) (-234.790) (-235.568) [-234.111] * (-233.900) (-237.829) (-234.481) [-236.925] -- 0:00:30
494500 -- (-239.536) [-234.071] (-235.729) (-235.010) * [-234.691] (-235.677) (-238.531) (-233.755) -- 0:00:30
495000 -- (-239.415) (-232.953) [-235.485] (-239.266) * (-233.733) [-234.132] (-234.476) (-239.573) -- 0:00:30
Average standard deviation of split frequencies: 0.015365
495500 -- (-239.436) [-233.474] (-238.183) (-236.332) * (-238.368) (-241.273) [-237.237] (-237.733) -- 0:00:30
496000 -- (-237.007) (-235.030) [-236.172] (-235.873) * (-237.681) (-240.050) (-241.585) [-234.797] -- 0:00:30
496500 -- (-242.691) (-234.487) [-235.980] (-233.680) * (-235.623) (-239.100) [-233.446] (-236.352) -- 0:00:30
497000 -- (-235.455) (-235.206) (-238.666) [-234.849] * [-238.031] (-237.955) (-233.363) (-236.023) -- 0:00:30
497500 -- (-234.981) (-235.780) [-234.877] (-235.359) * (-236.366) [-235.487] (-237.279) (-235.012) -- 0:00:30
498000 -- (-233.948) (-235.034) (-236.457) [-233.128] * [-235.188] (-238.218) (-234.465) (-234.667) -- 0:00:30
498500 -- (-238.122) (-239.890) [-236.007] (-234.028) * (-234.977) (-233.709) [-235.982] (-235.630) -- 0:00:30
499000 -- [-235.812] (-236.193) (-233.329) (-234.000) * [-234.151] (-234.705) (-235.432) (-236.874) -- 0:00:30
499500 -- [-240.334] (-235.835) (-235.560) (-235.055) * [-233.614] (-235.213) (-234.558) (-234.588) -- 0:00:30
500000 -- [-236.651] (-241.250) (-241.031) (-234.986) * (-233.551) (-234.769) (-240.988) [-236.408] -- 0:00:30
Average standard deviation of split frequencies: 0.014960
500500 -- [-233.428] (-234.907) (-237.818) (-235.990) * (-236.262) (-234.896) (-236.392) [-237.441] -- 0:00:29
501000 -- [-234.510] (-234.016) (-237.942) (-236.530) * (-234.441) [-236.435] (-236.855) (-235.615) -- 0:00:29
501500 -- (-234.321) (-234.253) (-236.497) [-235.763] * [-238.725] (-233.932) (-233.359) (-236.069) -- 0:00:29
502000 -- (-234.290) (-233.981) [-238.055] (-235.530) * (-234.271) (-237.040) [-235.451] (-236.316) -- 0:00:29
502500 -- (-236.644) [-233.995] (-239.738) (-235.418) * [-233.691] (-239.719) (-234.414) (-234.856) -- 0:00:29
503000 -- (-234.777) (-233.692) [-235.924] (-233.647) * (-234.589) (-234.832) (-237.435) [-234.600] -- 0:00:29
503500 -- (-237.002) (-235.464) (-235.740) [-238.958] * (-234.354) (-234.222) [-240.257] (-235.872) -- 0:00:29
504000 -- (-233.628) (-236.245) [-233.657] (-234.637) * (-234.990) [-234.656] (-239.502) (-235.388) -- 0:00:29
504500 -- (-233.641) (-235.572) [-234.694] (-237.134) * (-235.082) (-235.403) [-237.483] (-236.352) -- 0:00:29
505000 -- (-233.678) [-234.638] (-236.583) (-239.390) * (-235.450) (-233.202) [-236.745] (-235.270) -- 0:00:29
Average standard deviation of split frequencies: 0.015010
505500 -- [-239.563] (-235.941) (-234.629) (-235.972) * (-234.549) (-236.684) (-234.241) [-235.578] -- 0:00:29
506000 -- [-234.963] (-235.957) (-234.683) (-238.614) * (-240.378) (-236.490) (-234.698) [-235.932] -- 0:00:29
506500 -- (-233.253) (-237.421) [-236.119] (-237.394) * (-234.287) (-236.668) (-236.350) [-236.698] -- 0:00:29
507000 -- [-234.721] (-233.673) (-233.101) (-235.940) * (-236.329) (-235.370) (-238.337) [-235.119] -- 0:00:29
507500 -- [-233.849] (-235.134) (-235.803) (-237.108) * (-235.110) (-236.317) (-235.092) [-234.845] -- 0:00:29
508000 -- (-233.616) [-240.399] (-237.879) (-234.909) * (-237.407) [-234.544] (-236.244) (-235.430) -- 0:00:29
508500 -- (-236.770) (-236.036) [-233.470] (-237.504) * (-238.424) (-241.380) (-236.824) [-235.282] -- 0:00:29
509000 -- (-241.813) [-234.952] (-236.824) (-240.619) * [-233.953] (-234.469) (-234.766) (-234.710) -- 0:00:29
509500 -- (-239.545) (-236.424) (-237.484) [-242.754] * (-238.978) (-233.532) [-234.985] (-237.153) -- 0:00:29
510000 -- [-240.786] (-233.300) (-236.813) (-236.304) * (-234.306) (-240.416) [-235.131] (-235.127) -- 0:00:29
Average standard deviation of split frequencies: 0.014444
510500 -- (-234.761) (-235.417) [-238.349] (-233.969) * (-240.445) [-235.713] (-238.142) (-234.478) -- 0:00:29
511000 -- (-236.800) [-235.527] (-233.669) (-235.941) * (-233.827) (-237.679) (-236.648) [-234.884] -- 0:00:29
511500 -- (-236.220) (-237.538) (-237.932) [-235.515] * (-233.806) (-238.023) [-236.459] (-234.992) -- 0:00:29
512000 -- (-235.958) (-234.683) [-235.321] (-233.930) * (-240.465) (-235.890) [-238.213] (-234.560) -- 0:00:29
512500 -- (-240.225) (-238.796) [-234.879] (-235.269) * [-235.605] (-238.500) (-236.119) (-232.944) -- 0:00:29
513000 -- (-235.855) (-233.384) [-240.577] (-235.604) * (-236.592) (-235.711) [-234.010] (-237.028) -- 0:00:29
513500 -- (-238.247) [-234.034] (-235.925) (-238.707) * (-235.651) (-236.107) (-233.566) [-234.100] -- 0:00:29
514000 -- (-234.351) [-234.562] (-238.101) (-237.711) * [-233.688] (-236.555) (-234.214) (-235.125) -- 0:00:29
514500 -- (-238.386) [-233.777] (-236.064) (-235.109) * (-233.759) [-233.884] (-233.130) (-234.703) -- 0:00:29
515000 -- (-238.219) (-235.312) (-234.848) [-234.927] * (-233.736) [-233.149] (-234.821) (-234.396) -- 0:00:29
Average standard deviation of split frequencies: 0.013704
515500 -- [-236.052] (-242.105) (-235.083) (-235.231) * (-233.498) (-233.493) (-235.730) [-236.101] -- 0:00:29
516000 -- (-233.980) (-233.622) [-238.005] (-238.319) * (-237.016) (-234.065) [-236.933] (-237.777) -- 0:00:29
516500 -- (-233.998) (-235.292) [-236.007] (-238.225) * (-233.707) [-237.850] (-235.377) (-234.750) -- 0:00:29
517000 -- [-237.115] (-235.079) (-234.508) (-237.456) * (-234.623) [-234.266] (-236.921) (-233.404) -- 0:00:28
517500 -- (-234.138) (-237.866) (-235.902) [-235.081] * (-234.060) (-232.944) (-235.799) [-234.528] -- 0:00:28
518000 -- (-235.904) [-233.680] (-238.904) (-234.288) * (-236.639) (-234.141) (-234.819) [-236.513] -- 0:00:28
518500 -- (-234.440) (-235.342) (-234.869) [-237.585] * (-235.110) (-237.327) (-236.653) [-234.583] -- 0:00:28
519000 -- [-236.497] (-237.212) (-233.887) (-235.835) * (-234.485) (-235.129) (-235.785) [-235.296] -- 0:00:28
519500 -- (-235.185) [-244.342] (-236.256) (-236.032) * [-234.290] (-238.292) (-233.827) (-235.655) -- 0:00:28
520000 -- (-236.285) [-234.576] (-234.031) (-238.048) * (-235.110) (-237.013) (-235.906) [-236.314] -- 0:00:28
Average standard deviation of split frequencies: 0.013411
520500 -- (-235.630) (-236.885) [-237.761] (-236.770) * [-233.754] (-234.697) (-234.166) (-235.559) -- 0:00:28
521000 -- (-235.725) (-239.179) (-237.907) [-235.590] * [-233.940] (-234.788) (-234.723) (-237.290) -- 0:00:28
521500 -- (-233.534) [-237.297] (-236.693) (-234.116) * (-236.373) [-237.407] (-235.301) (-233.314) -- 0:00:28
522000 -- (-236.784) [-237.699] (-236.078) (-234.929) * (-237.638) (-239.809) (-235.190) [-235.744] -- 0:00:28
522500 -- (-236.841) (-234.555) [-237.304] (-238.908) * (-233.560) (-236.734) [-234.450] (-237.064) -- 0:00:28
523000 -- (-236.610) (-234.239) [-236.949] (-238.321) * (-233.812) [-238.335] (-237.578) (-234.313) -- 0:00:28
523500 -- (-233.447) [-233.642] (-235.474) (-234.641) * [-233.521] (-239.107) (-237.143) (-233.999) -- 0:00:28
524000 -- (-235.385) [-237.243] (-235.039) (-236.161) * (-236.842) (-235.164) [-236.725] (-233.888) -- 0:00:28
524500 -- (-237.799) (-233.353) [-234.495] (-234.379) * (-234.560) (-236.022) (-235.411) [-234.778] -- 0:00:28
525000 -- [-233.365] (-233.730) (-234.597) (-234.610) * (-234.793) (-238.060) (-234.761) [-234.390] -- 0:00:28
Average standard deviation of split frequencies: 0.012659
525500 -- (-235.507) (-240.460) (-236.372) [-233.283] * (-235.872) [-235.722] (-238.027) (-237.055) -- 0:00:28
526000 -- (-236.478) [-235.751] (-235.102) (-235.428) * (-233.228) [-234.761] (-234.045) (-234.089) -- 0:00:28
526500 -- (-239.056) (-235.960) (-236.698) [-234.041] * (-240.527) [-234.106] (-234.718) (-234.161) -- 0:00:28
527000 -- (-234.762) [-234.629] (-234.089) (-235.420) * (-236.156) (-235.156) (-240.959) [-235.191] -- 0:00:28
527500 -- (-239.855) (-234.276) (-235.430) [-233.832] * (-237.343) [-234.188] (-237.716) (-239.568) -- 0:00:28
528000 -- (-238.630) (-238.319) [-235.039] (-234.896) * (-235.992) (-234.693) (-236.342) [-235.301] -- 0:00:28
528500 -- (-239.612) (-240.028) (-234.242) [-234.514] * (-239.230) [-237.456] (-236.610) (-235.375) -- 0:00:28
529000 -- (-236.226) (-234.501) (-234.598) [-233.644] * (-237.136) (-239.002) (-234.530) [-237.390] -- 0:00:28
529500 -- (-234.875) (-236.057) [-234.584] (-235.566) * (-234.224) (-234.180) (-238.444) [-235.680] -- 0:00:28
530000 -- (-234.403) [-234.230] (-235.618) (-242.450) * (-238.658) [-236.463] (-239.499) (-237.064) -- 0:00:28
Average standard deviation of split frequencies: 0.012326
530500 -- [-234.038] (-234.514) (-236.655) (-236.724) * (-237.428) (-234.322) (-237.509) [-234.172] -- 0:00:28
531000 -- [-238.985] (-234.675) (-235.310) (-233.998) * (-239.200) [-238.564] (-236.495) (-233.162) -- 0:00:28
531500 -- [-233.640] (-233.707) (-234.364) (-236.047) * (-235.846) [-237.184] (-236.157) (-235.300) -- 0:00:28
532000 -- (-236.401) [-235.596] (-239.215) (-235.793) * (-236.741) (-235.502) (-235.052) [-234.898] -- 0:00:28
532500 -- (-233.090) [-236.744] (-234.806) (-238.184) * (-240.826) [-235.187] (-234.798) (-233.770) -- 0:00:28
533000 -- [-235.526] (-234.470) (-233.977) (-234.958) * (-236.725) (-235.546) [-233.483] (-236.205) -- 0:00:28
533500 -- (-237.558) (-234.899) [-234.703] (-236.790) * [-234.115] (-237.586) (-234.830) (-234.557) -- 0:00:27
534000 -- (-235.746) (-233.798) (-234.421) [-234.944] * (-235.502) (-237.776) (-234.023) [-234.336] -- 0:00:27
534500 -- (-236.481) (-233.479) (-233.638) [-233.686] * (-235.973) (-233.254) (-236.229) [-237.094] -- 0:00:27
535000 -- (-233.949) (-233.235) [-236.665] (-241.704) * (-234.039) (-236.842) (-235.468) [-235.768] -- 0:00:27
Average standard deviation of split frequencies: 0.012368
535500 -- (-235.983) (-234.371) [-235.331] (-234.694) * (-236.101) [-235.163] (-240.588) (-235.695) -- 0:00:27
536000 -- (-235.619) [-235.000] (-239.888) (-236.459) * (-233.414) (-235.928) [-235.195] (-235.800) -- 0:00:27
536500 -- (-235.872) (-236.340) (-240.113) [-236.813] * (-233.221) [-236.939] (-238.672) (-237.161) -- 0:00:27
537000 -- (-235.458) (-235.184) [-237.146] (-236.687) * (-241.623) (-236.326) [-236.742] (-237.808) -- 0:00:27
537500 -- [-235.301] (-234.487) (-234.799) (-237.526) * (-239.165) (-235.642) [-236.072] (-236.043) -- 0:00:27
538000 -- [-234.208] (-238.107) (-234.802) (-236.134) * [-234.209] (-238.861) (-237.684) (-235.464) -- 0:00:27
538500 -- (-236.832) (-238.468) (-233.993) [-235.989] * (-237.262) (-235.784) (-233.795) [-236.754] -- 0:00:27
539000 -- (-236.811) (-235.028) [-238.506] (-238.179) * (-234.382) [-234.994] (-234.191) (-236.738) -- 0:00:27
539500 -- (-235.318) (-239.753) [-239.174] (-235.379) * (-236.352) (-235.668) [-240.071] (-237.759) -- 0:00:27
540000 -- (-234.536) (-237.683) (-235.972) [-236.043] * [-233.121] (-236.058) (-235.410) (-242.946) -- 0:00:27
Average standard deviation of split frequencies: 0.012697
540500 -- (-235.519) (-235.252) [-236.730] (-236.326) * [-233.529] (-235.131) (-234.852) (-236.730) -- 0:00:27
541000 -- [-236.162] (-234.332) (-235.289) (-234.363) * (-236.126) [-234.968] (-235.177) (-235.587) -- 0:00:27
541500 -- (-236.640) (-237.233) (-234.412) [-234.807] * [-234.714] (-234.656) (-239.903) (-234.767) -- 0:00:27
542000 -- (-234.723) [-236.258] (-237.323) (-233.862) * (-237.588) (-234.720) [-237.119] (-233.775) -- 0:00:27
542500 -- (-235.646) (-235.849) [-233.855] (-238.585) * (-234.594) (-235.734) (-234.790) [-234.692] -- 0:00:27
543000 -- (-235.107) [-236.637] (-239.221) (-235.106) * (-237.455) (-235.766) [-234.135] (-234.764) -- 0:00:27
543500 -- (-234.389) (-236.624) (-234.754) [-235.210] * (-234.787) (-238.583) [-235.830] (-234.821) -- 0:00:27
544000 -- (-235.441) (-234.184) [-235.179] (-234.982) * (-237.798) [-235.825] (-235.109) (-233.513) -- 0:00:27
544500 -- (-236.658) (-235.603) [-236.632] (-234.603) * (-234.919) [-236.070] (-236.245) (-235.457) -- 0:00:27
545000 -- [-234.529] (-238.854) (-235.036) (-235.781) * (-234.257) (-236.755) [-235.010] (-234.393) -- 0:00:27
Average standard deviation of split frequencies: 0.011871
545500 -- (-236.562) [-236.226] (-233.915) (-234.553) * [-238.747] (-236.516) (-240.841) (-235.347) -- 0:00:27
546000 -- (-238.601) [-234.061] (-236.862) (-234.842) * (-236.551) (-236.736) [-237.488] (-234.850) -- 0:00:27
546500 -- [-234.729] (-235.752) (-237.056) (-234.485) * (-235.874) (-235.801) [-236.710] (-239.462) -- 0:00:27
547000 -- (-234.508) (-234.126) (-240.522) [-234.718] * (-237.452) (-235.746) (-234.243) [-236.542] -- 0:00:27
547500 -- (-242.192) (-234.165) [-234.729] (-234.793) * [-238.272] (-235.594) (-235.358) (-236.492) -- 0:00:27
548000 -- [-233.537] (-236.222) (-233.890) (-237.282) * (-236.592) (-234.941) [-234.962] (-235.170) -- 0:00:27
548500 -- [-233.941] (-235.066) (-234.135) (-238.244) * (-235.982) (-235.363) (-237.416) [-235.853] -- 0:00:27
549000 -- [-233.178] (-238.932) (-237.962) (-234.251) * (-239.923) (-234.992) (-235.421) [-235.414] -- 0:00:27
549500 -- (-236.678) [-237.059] (-239.720) (-235.556) * (-236.362) (-234.820) [-234.934] (-235.496) -- 0:00:27
550000 -- (-235.805) (-235.712) (-236.194) [-234.943] * (-234.955) (-235.924) [-234.097] (-234.895) -- 0:00:27
Average standard deviation of split frequencies: 0.011396
550500 -- (-235.436) (-235.546) [-237.162] (-235.600) * (-235.495) [-233.365] (-234.967) (-236.531) -- 0:00:26
551000 -- [-234.499] (-236.163) (-237.663) (-237.966) * (-235.031) (-235.585) [-237.557] (-237.684) -- 0:00:26
551500 -- (-239.340) (-234.808) [-236.931] (-233.624) * (-237.695) [-234.767] (-235.301) (-240.016) -- 0:00:26
552000 -- (-240.121) [-234.058] (-239.533) (-234.335) * (-234.174) (-235.032) (-233.689) [-233.735] -- 0:00:26
552500 -- (-233.278) [-234.918] (-240.350) (-235.549) * (-237.218) (-235.007) (-236.833) [-238.988] -- 0:00:26
553000 -- (-233.034) [-234.114] (-239.438) (-236.502) * (-237.019) (-235.309) [-236.372] (-236.356) -- 0:00:26
553500 -- (-233.640) (-234.413) [-236.260] (-234.410) * [-234.288] (-235.590) (-234.697) (-236.105) -- 0:00:26
554000 -- [-233.260] (-234.558) (-239.170) (-234.411) * (-234.226) (-234.367) [-238.910] (-233.246) -- 0:00:26
554500 -- (-235.461) (-239.447) [-237.220] (-234.213) * (-235.150) (-235.310) (-238.154) [-240.371] -- 0:00:26
555000 -- (-236.687) (-238.946) (-233.295) [-236.495] * [-236.530] (-240.582) (-233.346) (-234.919) -- 0:00:26
Average standard deviation of split frequencies: 0.011234
555500 -- (-237.548) (-237.818) [-234.148] (-234.818) * (-234.577) (-235.302) [-235.794] (-233.018) -- 0:00:26
556000 -- [-233.643] (-237.577) (-236.327) (-234.346) * (-238.782) (-235.511) (-234.477) [-237.300] -- 0:00:26
556500 -- [-234.334] (-236.385) (-234.456) (-234.552) * (-235.193) [-235.301] (-238.685) (-234.691) -- 0:00:26
557000 -- (-239.237) (-234.215) [-236.533] (-234.782) * (-236.908) [-235.626] (-234.325) (-239.640) -- 0:00:26
557500 -- (-236.529) [-237.228] (-233.772) (-234.355) * [-233.540] (-238.784) (-235.293) (-233.313) -- 0:00:26
558000 -- (-236.134) [-234.982] (-235.529) (-235.619) * (-236.117) (-236.762) (-237.989) [-237.229] -- 0:00:26
558500 -- (-234.830) (-240.668) (-236.894) [-235.574] * [-241.937] (-236.087) (-233.263) (-234.721) -- 0:00:26
559000 -- [-234.334] (-243.551) (-233.953) (-235.926) * [-234.940] (-233.757) (-234.170) (-235.445) -- 0:00:26
559500 -- (-234.278) (-234.748) [-236.066] (-237.625) * [-233.772] (-238.843) (-234.486) (-239.225) -- 0:00:26
560000 -- (-234.669) (-234.773) (-235.062) [-234.327] * (-235.167) (-235.153) (-236.577) [-236.305] -- 0:00:26
Average standard deviation of split frequencies: 0.011719
560500 -- (-237.128) [-234.131] (-234.610) (-237.750) * (-234.942) (-236.622) [-233.748] (-235.565) -- 0:00:26
561000 -- (-237.070) [-241.668] (-235.599) (-236.251) * (-237.395) (-235.101) [-236.467] (-234.834) -- 0:00:26
561500 -- [-234.382] (-239.435) (-234.135) (-235.163) * (-236.884) (-234.579) (-234.049) [-234.074] -- 0:00:26
562000 -- [-235.973] (-236.179) (-235.057) (-238.954) * [-235.360] (-234.412) (-243.235) (-237.334) -- 0:00:26
562500 -- (-234.871) (-236.202) (-235.798) [-234.982] * [-234.445] (-235.347) (-240.833) (-234.997) -- 0:00:26
563000 -- (-233.692) [-235.144] (-235.378) (-233.719) * (-237.016) [-238.130] (-236.938) (-234.106) -- 0:00:26
563500 -- (-234.811) (-236.071) (-235.001) [-235.652] * [-233.653] (-238.162) (-234.132) (-237.596) -- 0:00:26
564000 -- (-234.295) (-235.109) (-236.113) [-233.918] * (-234.521) (-234.131) [-234.823] (-234.646) -- 0:00:26
564500 -- [-234.030] (-237.985) (-236.692) (-236.890) * (-233.054) (-233.625) (-237.073) [-233.262] -- 0:00:26
565000 -- [-233.684] (-234.093) (-238.028) (-235.325) * [-234.429] (-234.163) (-233.952) (-234.642) -- 0:00:26
Average standard deviation of split frequencies: 0.011504
565500 -- [-236.504] (-234.813) (-238.704) (-239.177) * [-234.474] (-235.114) (-236.716) (-233.889) -- 0:00:26
566000 -- (-236.980) (-236.673) (-236.399) [-235.202] * (-235.714) (-233.899) (-236.605) [-234.233] -- 0:00:26
566500 -- (-238.302) [-234.433] (-239.308) (-235.115) * (-235.983) (-233.823) (-238.909) [-235.043] -- 0:00:26
567000 -- [-235.805] (-237.350) (-233.488) (-235.992) * [-233.726] (-238.153) (-236.709) (-235.539) -- 0:00:25
567500 -- (-234.264) (-237.744) [-233.875] (-233.341) * (-235.690) [-233.909] (-239.643) (-235.993) -- 0:00:25
568000 -- (-236.602) [-233.904] (-235.138) (-234.578) * [-236.166] (-236.411) (-234.947) (-238.951) -- 0:00:25
568500 -- [-237.429] (-234.040) (-239.705) (-234.488) * (-237.370) [-238.088] (-236.232) (-235.121) -- 0:00:25
569000 -- (-234.785) (-236.109) (-238.314) [-234.900] * (-238.031) (-234.022) (-234.831) [-233.439] -- 0:00:25
569500 -- (-236.053) [-234.127] (-238.065) (-238.032) * [-236.540] (-235.277) (-236.914) (-233.690) -- 0:00:25
570000 -- [-234.236] (-236.083) (-240.538) (-236.552) * (-238.904) (-235.223) (-242.662) [-233.803] -- 0:00:25
Average standard deviation of split frequencies: 0.011203
570500 -- (-241.198) (-235.590) (-236.214) [-236.190] * (-237.108) (-235.855) (-237.832) [-237.171] -- 0:00:25
571000 -- (-233.572) [-236.814] (-237.497) (-233.521) * [-238.614] (-235.998) (-235.606) (-233.924) -- 0:00:25
571500 -- (-234.836) (-233.865) (-234.928) [-238.584] * (-236.109) (-234.867) [-233.532] (-236.622) -- 0:00:25
572000 -- [-235.784] (-242.996) (-233.833) (-237.330) * (-235.600) (-235.920) [-234.209] (-236.559) -- 0:00:25
572500 -- (-233.433) [-234.800] (-234.935) (-236.739) * (-233.252) (-236.201) (-233.601) [-233.975] -- 0:00:25
573000 -- [-234.620] (-236.028) (-237.368) (-233.806) * (-239.114) [-233.772] (-235.472) (-236.055) -- 0:00:25
573500 -- (-233.494) (-235.528) (-234.208) [-234.003] * [-233.644] (-235.839) (-237.162) (-238.495) -- 0:00:25
574000 -- [-233.531] (-235.074) (-233.103) (-237.964) * (-236.389) [-233.535] (-235.845) (-233.826) -- 0:00:25
574500 -- (-235.310) [-234.547] (-233.633) (-236.973) * [-234.307] (-234.538) (-236.498) (-236.291) -- 0:00:25
575000 -- (-235.218) [-233.733] (-233.648) (-236.099) * [-234.707] (-238.714) (-236.116) (-235.624) -- 0:00:25
Average standard deviation of split frequencies: 0.011355
575500 -- (-237.506) (-234.174) (-236.176) [-241.530] * (-239.218) (-236.383) [-236.232] (-239.470) -- 0:00:25
576000 -- (-235.840) [-236.007] (-234.860) (-233.689) * (-234.211) (-234.227) (-235.353) [-236.157] -- 0:00:25
576500 -- (-236.484) [-237.695] (-233.411) (-236.348) * (-234.726) (-234.561) (-235.943) [-235.786] -- 0:00:25
577000 -- (-235.622) (-234.364) (-234.031) [-233.760] * (-234.812) [-234.039] (-238.031) (-235.112) -- 0:00:25
577500 -- (-234.438) [-236.184] (-235.748) (-234.384) * (-239.186) [-234.644] (-235.472) (-234.853) -- 0:00:25
578000 -- (-233.957) (-232.993) (-235.421) [-234.033] * [-236.683] (-236.921) (-235.030) (-233.947) -- 0:00:25
578500 -- (-236.198) (-236.133) (-235.571) [-235.077] * [-235.953] (-237.744) (-236.421) (-233.513) -- 0:00:25
579000 -- (-235.192) (-238.349) (-235.914) [-233.603] * [-235.543] (-240.114) (-236.326) (-233.696) -- 0:00:25
579500 -- (-237.122) (-237.856) [-235.255] (-233.253) * [-235.908] (-236.261) (-237.503) (-236.267) -- 0:00:25
580000 -- (-240.102) [-236.063] (-235.933) (-235.258) * (-235.368) (-234.845) (-234.608) [-235.716] -- 0:00:25
Average standard deviation of split frequencies: 0.011264
580500 -- (-242.501) (-237.717) (-237.498) [-234.058] * (-235.278) [-234.031] (-236.564) (-236.655) -- 0:00:25
581000 -- [-233.132] (-240.523) (-237.544) (-234.882) * (-236.224) [-234.640] (-234.599) (-234.213) -- 0:00:25
581500 -- [-235.926] (-233.120) (-238.767) (-236.393) * (-236.842) [-234.711] (-233.421) (-234.412) -- 0:00:25
582000 -- (-240.245) [-234.779] (-234.904) (-242.500) * (-234.874) [-236.089] (-233.830) (-234.487) -- 0:00:25
582500 -- [-237.196] (-240.798) (-233.538) (-233.932) * [-235.440] (-235.304) (-235.829) (-237.478) -- 0:00:25
583000 -- (-236.371) (-236.658) (-234.033) [-236.880] * (-235.753) (-235.621) (-235.605) [-235.612] -- 0:00:25
583500 -- (-236.205) [-235.583] (-235.010) (-233.455) * (-234.173) (-236.292) (-236.845) [-234.240] -- 0:00:24
584000 -- [-233.479] (-234.941) (-234.506) (-234.651) * (-234.862) [-233.088] (-238.906) (-234.660) -- 0:00:24
584500 -- (-237.712) (-234.834) [-234.271] (-236.810) * [-235.830] (-238.485) (-233.377) (-235.973) -- 0:00:24
585000 -- (-237.980) (-234.808) (-235.668) [-235.936] * (-235.229) (-233.222) [-234.119] (-235.173) -- 0:00:24
Average standard deviation of split frequencies: 0.010860
585500 -- (-238.123) (-235.108) (-235.119) [-237.080] * (-236.528) (-238.299) [-233.381] (-233.902) -- 0:00:24
586000 -- (-234.123) (-234.225) [-234.588] (-234.129) * (-235.937) (-241.914) (-234.787) [-235.003] -- 0:00:24
586500 -- [-238.833] (-237.101) (-235.245) (-234.309) * (-238.092) (-239.282) [-234.261] (-233.468) -- 0:00:24
587000 -- (-235.466) [-236.261] (-235.089) (-235.508) * [-233.394] (-236.459) (-234.546) (-237.818) -- 0:00:24
587500 -- [-234.909] (-234.371) (-235.892) (-233.763) * (-233.883) [-236.251] (-235.698) (-233.469) -- 0:00:24
588000 -- [-234.017] (-234.065) (-235.312) (-236.885) * [-235.141] (-234.962) (-236.393) (-238.170) -- 0:00:24
588500 -- (-237.992) [-237.375] (-236.209) (-236.079) * (-234.202) (-235.207) [-238.197] (-236.466) -- 0:00:24
589000 -- [-233.518] (-234.572) (-236.290) (-234.516) * (-236.787) [-238.834] (-239.496) (-237.060) -- 0:00:24
589500 -- [-236.009] (-236.033) (-239.204) (-235.022) * (-236.171) [-235.553] (-234.396) (-234.584) -- 0:00:24
590000 -- (-237.174) (-238.825) [-235.337] (-235.189) * (-233.918) (-233.782) [-236.595] (-235.139) -- 0:00:24
Average standard deviation of split frequencies: 0.011123
590500 -- (-235.327) (-237.530) [-233.289] (-233.451) * (-233.901) (-235.763) [-233.716] (-234.927) -- 0:00:24
591000 -- (-234.815) (-236.183) [-234.914] (-236.230) * [-233.643] (-241.372) (-234.722) (-235.992) -- 0:00:24
591500 -- [-236.241] (-238.545) (-234.658) (-235.194) * [-234.091] (-237.506) (-237.147) (-234.401) -- 0:00:24
592000 -- [-238.071] (-236.432) (-238.626) (-237.445) * (-236.238) (-234.980) [-234.404] (-235.498) -- 0:00:24
592500 -- (-234.826) (-234.340) [-236.313] (-235.584) * (-237.332) (-234.867) [-234.189] (-233.547) -- 0:00:24
593000 -- [-233.990] (-235.589) (-233.840) (-236.821) * (-234.997) (-233.853) (-236.563) [-237.682] -- 0:00:24
593500 -- (-235.549) (-235.120) [-233.799] (-237.569) * [-233.749] (-239.327) (-238.654) (-235.971) -- 0:00:24
594000 -- (-235.200) (-233.345) [-233.803] (-236.764) * (-235.884) (-235.086) [-234.742] (-233.577) -- 0:00:24
594500 -- (-234.708) [-233.545] (-234.557) (-233.840) * (-235.227) (-235.943) (-236.121) [-233.663] -- 0:00:24
595000 -- [-234.102] (-233.095) (-234.775) (-237.879) * (-233.543) (-236.793) (-234.814) [-233.306] -- 0:00:24
Average standard deviation of split frequencies: 0.011320
595500 -- (-235.030) (-233.409) [-236.973] (-241.462) * (-233.829) (-235.602) [-236.285] (-234.202) -- 0:00:24
596000 -- [-234.227] (-234.313) (-236.298) (-237.753) * [-233.604] (-236.207) (-233.901) (-235.657) -- 0:00:24
596500 -- [-233.664] (-234.902) (-235.697) (-235.634) * (-233.522) (-235.571) [-233.728] (-234.125) -- 0:00:24
597000 -- (-238.315) (-238.014) (-234.155) [-232.933] * (-234.885) (-238.281) (-238.250) [-236.946] -- 0:00:24
597500 -- (-235.163) (-235.781) (-234.204) [-236.416] * [-236.084] (-234.483) (-235.466) (-236.398) -- 0:00:24
598000 -- [-236.411] (-237.183) (-238.568) (-235.640) * (-236.380) [-233.570] (-234.302) (-235.014) -- 0:00:24
598500 -- (-235.930) (-235.743) (-233.122) [-237.529] * (-236.845) [-235.713] (-234.909) (-235.288) -- 0:00:24
599000 -- [-233.769] (-237.108) (-234.874) (-234.712) * (-236.490) (-234.425) [-234.108] (-235.345) -- 0:00:24
599500 -- (-233.458) [-235.612] (-235.538) (-236.618) * (-236.480) (-233.314) (-234.845) [-235.538] -- 0:00:24
600000 -- (-236.866) [-237.388] (-234.894) (-237.280) * (-236.508) (-235.739) (-239.063) [-235.305] -- 0:00:24
Average standard deviation of split frequencies: 0.011183
600500 -- (-234.680) [-234.626] (-234.976) (-236.918) * (-241.221) (-233.285) [-234.117] (-233.054) -- 0:00:23
601000 -- (-235.057) [-236.017] (-234.230) (-237.068) * [-235.561] (-234.301) (-234.538) (-234.455) -- 0:00:23
601500 -- (-238.011) (-233.969) [-235.174] (-236.920) * [-233.344] (-234.356) (-234.959) (-233.872) -- 0:00:23
602000 -- [-233.924] (-235.224) (-234.704) (-236.377) * (-234.932) (-235.404) [-234.216] (-235.626) -- 0:00:23
602500 -- (-237.223) (-239.661) [-235.045] (-234.530) * (-235.628) (-234.187) [-235.607] (-235.928) -- 0:00:23
603000 -- (-235.839) (-235.631) [-235.057] (-234.209) * (-238.505) (-233.690) (-234.061) [-233.840] -- 0:00:23
603500 -- [-235.198] (-233.791) (-237.892) (-239.572) * (-235.796) (-239.371) (-233.270) [-235.940] -- 0:00:23
604000 -- (-241.175) [-235.827] (-234.963) (-236.316) * (-234.937) (-238.042) [-236.039] (-234.895) -- 0:00:23
604500 -- (-234.915) [-235.103] (-235.377) (-237.275) * (-237.501) [-236.353] (-236.503) (-235.565) -- 0:00:23
605000 -- [-235.050] (-235.240) (-235.855) (-235.026) * (-236.022) (-240.984) (-236.635) [-234.244] -- 0:00:23
Average standard deviation of split frequencies: 0.011377
605500 -- (-235.826) [-233.567] (-235.313) (-238.573) * [-236.826] (-237.881) (-235.971) (-234.932) -- 0:00:23
606000 -- (-233.835) (-235.785) [-235.635] (-235.902) * [-235.657] (-237.503) (-237.104) (-233.359) -- 0:00:23
606500 -- (-233.832) [-235.148] (-244.362) (-234.510) * [-235.103] (-236.889) (-235.655) (-236.264) -- 0:00:23
607000 -- (-235.695) [-236.805] (-237.805) (-233.876) * (-234.935) (-236.426) [-235.813] (-233.407) -- 0:00:23
607500 -- (-234.212) (-235.826) (-238.635) [-234.394] * (-237.335) (-235.570) [-234.805] (-239.022) -- 0:00:23
608000 -- (-236.574) (-235.037) (-235.860) [-234.745] * (-235.593) (-238.867) (-241.664) [-234.982] -- 0:00:23
608500 -- (-234.880) (-236.103) (-234.165) [-235.921] * [-235.141] (-237.386) (-235.689) (-237.588) -- 0:00:23
609000 -- (-233.730) (-236.007) [-238.859] (-236.241) * (-240.380) (-236.204) (-235.098) [-236.067] -- 0:00:23
609500 -- [-233.582] (-236.667) (-234.576) (-238.647) * (-237.320) [-234.450] (-234.726) (-237.008) -- 0:00:23
610000 -- [-234.378] (-233.947) (-236.600) (-236.586) * [-235.081] (-233.761) (-237.899) (-237.450) -- 0:00:23
Average standard deviation of split frequencies: 0.011772
610500 -- [-236.808] (-233.555) (-235.101) (-236.277) * (-237.337) (-235.897) (-233.574) [-234.637] -- 0:00:23
611000 -- [-234.401] (-233.786) (-239.602) (-236.193) * (-238.291) [-237.142] (-233.951) (-235.613) -- 0:00:23
611500 -- [-234.972] (-235.395) (-238.657) (-237.983) * [-236.293] (-233.757) (-234.893) (-234.139) -- 0:00:23
612000 -- [-236.283] (-239.984) (-234.776) (-236.144) * [-239.656] (-233.512) (-235.277) (-234.327) -- 0:00:23
612500 -- (-233.909) (-234.095) (-238.975) [-237.349] * (-238.607) (-235.427) (-236.430) [-233.360] -- 0:00:23
613000 -- [-234.250] (-237.404) (-236.153) (-237.334) * [-233.944] (-235.013) (-233.714) (-237.703) -- 0:00:23
613500 -- (-235.003) (-236.369) [-234.568] (-235.242) * (-237.718) [-233.957] (-233.573) (-234.753) -- 0:00:23
614000 -- [-238.772] (-235.240) (-235.183) (-234.889) * (-236.073) [-234.280] (-234.357) (-235.353) -- 0:00:23
614500 -- (-235.728) (-233.785) (-236.138) [-234.020] * (-235.432) (-240.069) (-235.038) [-237.398] -- 0:00:23
615000 -- (-237.593) [-235.387] (-236.049) (-238.150) * (-238.400) (-234.915) (-236.481) [-234.224] -- 0:00:23
Average standard deviation of split frequencies: 0.011718
615500 -- [-236.361] (-233.870) (-233.907) (-234.814) * (-236.523) [-234.433] (-234.176) (-234.660) -- 0:00:23
616000 -- [-234.624] (-235.039) (-236.141) (-238.006) * (-237.694) (-235.964) [-233.864] (-237.625) -- 0:00:23
616500 -- [-235.329] (-234.598) (-235.522) (-234.728) * (-238.306) [-233.688] (-235.742) (-235.251) -- 0:00:23
617000 -- (-234.672) (-236.471) (-235.640) [-234.279] * [-236.871] (-235.496) (-233.966) (-234.808) -- 0:00:22
617500 -- [-234.319] (-237.041) (-234.569) (-236.061) * [-235.520] (-235.227) (-239.543) (-234.773) -- 0:00:22
618000 -- (-233.693) (-238.558) [-233.762] (-236.399) * (-235.056) (-233.905) [-236.749] (-233.615) -- 0:00:22
618500 -- [-234.558] (-234.419) (-235.116) (-237.599) * (-238.113) [-236.693] (-234.034) (-234.093) -- 0:00:22
619000 -- (-235.771) (-238.648) [-235.767] (-235.671) * (-236.487) (-237.722) [-234.169] (-234.792) -- 0:00:22
619500 -- (-235.236) (-234.879) [-234.140] (-236.448) * [-235.448] (-235.234) (-235.108) (-238.901) -- 0:00:22
620000 -- (-234.934) (-235.209) [-234.689] (-236.591) * (-234.587) [-235.943] (-236.173) (-234.453) -- 0:00:22
Average standard deviation of split frequencies: 0.011535
620500 -- (-237.142) (-236.389) [-232.961] (-234.437) * (-242.328) (-234.195) (-237.251) [-235.350] -- 0:00:22
621000 -- (-235.611) (-233.946) (-234.923) [-237.591] * (-238.557) (-234.050) [-234.131] (-234.556) -- 0:00:22
621500 -- (-236.061) (-237.394) (-234.817) [-233.575] * (-241.421) (-235.428) [-234.976] (-234.720) -- 0:00:22
622000 -- (-236.151) [-235.610] (-235.417) (-235.522) * (-234.779) (-237.257) [-234.463] (-238.437) -- 0:00:22
622500 -- (-233.930) (-235.898) (-235.658) [-234.266] * [-236.083] (-236.404) (-238.402) (-234.330) -- 0:00:22
623000 -- (-234.373) (-235.964) (-233.324) [-238.318] * [-236.115] (-236.965) (-237.365) (-234.482) -- 0:00:22
623500 -- [-235.834] (-234.472) (-233.886) (-234.326) * [-234.723] (-236.027) (-240.113) (-235.592) -- 0:00:22
624000 -- [-237.129] (-233.744) (-235.549) (-233.556) * (-238.940) [-234.190] (-236.076) (-235.026) -- 0:00:22
624500 -- (-235.953) (-234.054) (-234.772) [-233.611] * (-239.066) (-233.308) (-239.234) [-239.892] -- 0:00:22
625000 -- (-234.643) (-233.748) (-235.553) [-235.793] * (-236.972) (-234.542) (-243.847) [-233.435] -- 0:00:22
Average standard deviation of split frequencies: 0.011719
625500 -- [-233.905] (-235.051) (-234.980) (-237.324) * [-237.198] (-235.563) (-237.058) (-234.986) -- 0:00:22
626000 -- (-237.119) [-233.748] (-233.279) (-236.342) * (-234.736) [-241.292] (-236.637) (-235.132) -- 0:00:22
626500 -- [-236.713] (-237.813) (-239.081) (-235.404) * (-236.593) [-237.595] (-237.346) (-234.021) -- 0:00:22
627000 -- [-235.878] (-237.616) (-235.187) (-233.745) * (-234.924) [-234.736] (-235.425) (-233.864) -- 0:00:22
627500 -- (-234.957) (-240.119) [-235.935] (-236.295) * [-234.788] (-244.714) (-234.903) (-234.779) -- 0:00:22
628000 -- [-234.814] (-234.972) (-234.353) (-236.284) * [-243.285] (-239.801) (-237.758) (-236.537) -- 0:00:22
628500 -- (-233.642) (-241.893) [-234.829] (-236.336) * (-242.894) (-234.560) (-236.535) [-234.384] -- 0:00:22
629000 -- [-233.708] (-239.017) (-234.734) (-233.704) * [-236.024] (-237.143) (-234.302) (-237.857) -- 0:00:22
629500 -- (-237.537) (-235.623) (-236.993) [-234.233] * (-235.384) (-234.642) (-233.941) [-236.136] -- 0:00:22
630000 -- [-235.245] (-236.392) (-238.626) (-234.536) * (-234.908) (-234.959) (-233.573) [-237.569] -- 0:00:22
Average standard deviation of split frequencies: 0.011539
630500 -- [-237.177] (-235.167) (-233.939) (-234.604) * (-237.176) (-233.452) (-234.633) [-237.567] -- 0:00:22
631000 -- (-234.419) [-235.923] (-237.852) (-235.715) * (-234.263) (-238.691) (-234.021) [-234.785] -- 0:00:22
631500 -- (-235.323) (-233.872) [-238.577] (-235.413) * (-233.129) [-233.969] (-236.131) (-237.696) -- 0:00:22
632000 -- (-237.795) [-234.031] (-236.965) (-234.681) * (-233.315) (-234.771) [-239.395] (-235.550) -- 0:00:22
632500 -- (-235.956) (-234.241) [-235.688] (-234.008) * [-235.663] (-234.201) (-237.658) (-235.409) -- 0:00:22
633000 -- (-235.803) (-235.788) (-235.193) [-236.282] * [-240.806] (-236.501) (-234.153) (-236.537) -- 0:00:22
633500 -- [-234.928] (-234.602) (-243.159) (-235.910) * (-235.954) [-234.269] (-235.560) (-234.491) -- 0:00:21
634000 -- [-235.107] (-234.531) (-237.003) (-234.536) * (-235.013) (-235.745) (-234.128) [-235.351] -- 0:00:21
634500 -- [-235.676] (-240.629) (-234.548) (-233.523) * [-235.006] (-237.568) (-233.567) (-240.094) -- 0:00:21
635000 -- (-237.419) [-234.036] (-233.895) (-235.748) * [-234.970] (-234.976) (-235.679) (-237.919) -- 0:00:21
Average standard deviation of split frequencies: 0.011442
635500 -- (-234.993) (-234.490) (-238.643) [-237.336] * (-236.274) (-240.385) [-234.368] (-234.550) -- 0:00:21
636000 -- [-236.351] (-238.279) (-235.869) (-236.494) * [-239.983] (-236.151) (-235.917) (-236.350) -- 0:00:21
636500 -- [-238.029] (-236.169) (-234.219) (-236.102) * [-236.996] (-239.654) (-233.609) (-234.119) -- 0:00:21
637000 -- (-237.915) [-237.818] (-234.461) (-234.336) * [-236.497] (-233.933) (-233.778) (-235.532) -- 0:00:21
637500 -- (-239.634) (-235.955) (-234.156) [-235.010] * [-235.555] (-234.597) (-234.813) (-234.087) -- 0:00:21
638000 -- (-235.601) (-235.815) (-235.460) [-236.652] * (-236.513) (-234.827) (-234.270) [-233.978] -- 0:00:21
638500 -- (-233.610) (-236.037) [-234.163] (-237.110) * [-234.264] (-236.160) (-237.960) (-234.114) -- 0:00:21
639000 -- (-235.952) (-235.624) (-237.308) [-234.605] * (-234.150) (-236.797) (-234.720) [-233.636] -- 0:00:21
639500 -- (-236.825) [-237.358] (-238.101) (-236.928) * [-234.565] (-234.642) (-235.050) (-236.139) -- 0:00:21
640000 -- [-235.412] (-235.338) (-234.435) (-241.601) * (-237.452) (-236.557) [-236.066] (-235.548) -- 0:00:21
Average standard deviation of split frequencies: 0.011543
640500 -- (-238.401) (-235.486) (-235.693) [-235.686] * (-234.211) [-234.790] (-237.083) (-235.189) -- 0:00:21
641000 -- (-236.479) (-237.813) (-235.576) [-234.914] * (-234.706) (-235.226) (-236.067) [-233.706] -- 0:00:21
641500 -- (-241.282) (-237.058) [-235.239] (-241.364) * (-234.389) (-234.281) (-236.114) [-233.369] -- 0:00:21
642000 -- (-237.824) (-235.106) [-233.153] (-234.024) * (-238.731) (-233.598) [-234.096] (-239.487) -- 0:00:21
642500 -- (-234.942) (-234.027) (-233.998) [-238.501] * (-233.961) (-234.257) (-236.337) [-236.415] -- 0:00:21
643000 -- (-234.546) (-237.193) [-235.635] (-236.308) * (-239.468) [-233.406] (-234.139) (-236.829) -- 0:00:21
643500 -- [-233.517] (-236.262) (-239.683) (-245.489) * (-234.527) [-236.336] (-234.779) (-235.527) -- 0:00:21
644000 -- (-235.365) [-235.254] (-233.953) (-234.124) * (-239.711) (-235.968) [-236.207] (-235.126) -- 0:00:21
644500 -- (-233.927) (-234.537) (-235.129) [-235.376] * (-234.835) (-234.237) (-233.959) [-236.836] -- 0:00:21
645000 -- [-233.691] (-233.669) (-236.141) (-233.953) * (-233.731) [-233.881] (-235.751) (-235.536) -- 0:00:21
Average standard deviation of split frequencies: 0.011356
645500 -- (-235.381) (-234.853) [-234.571] (-239.231) * [-234.316] (-237.707) (-236.924) (-237.211) -- 0:00:21
646000 -- (-238.107) (-236.695) (-236.447) [-237.334] * [-236.024] (-237.821) (-237.385) (-234.206) -- 0:00:21
646500 -- [-234.152] (-237.959) (-239.268) (-235.092) * (-237.580) (-237.668) (-234.083) [-236.369] -- 0:00:21
647000 -- (-233.627) (-233.948) (-234.674) [-234.480] * (-239.013) [-236.955] (-237.621) (-235.157) -- 0:00:21
647500 -- (-235.376) (-233.709) [-236.259] (-233.633) * [-237.480] (-233.657) (-238.003) (-235.445) -- 0:00:21
648000 -- (-237.066) [-236.284] (-233.902) (-235.766) * (-234.906) (-234.682) (-233.338) [-233.153] -- 0:00:21
648500 -- (-238.215) [-235.569] (-239.917) (-234.140) * (-237.864) (-234.085) [-233.381] (-237.809) -- 0:00:21
649000 -- (-235.079) [-234.557] (-234.907) (-234.963) * (-235.437) (-234.530) (-237.418) [-235.570] -- 0:00:21
649500 -- [-236.184] (-235.090) (-239.461) (-234.926) * (-233.875) (-234.359) (-235.039) [-236.341] -- 0:00:21
650000 -- (-235.206) [-236.537] (-234.572) (-238.032) * (-233.850) (-234.995) [-234.778] (-236.699) -- 0:00:21
Average standard deviation of split frequencies: 0.011275
650500 -- (-233.349) (-233.441) [-235.525] (-237.146) * (-237.055) (-233.915) (-242.776) [-235.461] -- 0:00:20
651000 -- [-238.379] (-234.676) (-234.317) (-234.830) * (-235.028) (-237.439) (-234.275) [-233.550] -- 0:00:20
651500 -- (-232.992) [-235.515] (-235.712) (-235.490) * [-237.748] (-239.502) (-235.178) (-235.650) -- 0:00:20
652000 -- (-234.666) [-234.038] (-238.674) (-235.779) * [-235.977] (-239.787) (-234.661) (-233.290) -- 0:00:20
652500 -- [-233.842] (-237.411) (-238.742) (-237.102) * (-238.029) (-242.729) [-237.265] (-235.141) -- 0:00:20
653000 -- (-235.717) [-235.919] (-235.449) (-235.166) * (-238.596) (-238.205) [-236.846] (-234.882) -- 0:00:20
653500 -- (-240.323) [-235.162] (-239.090) (-235.269) * (-234.501) (-235.634) (-234.114) [-235.854] -- 0:00:20
654000 -- [-235.702] (-238.206) (-234.246) (-235.380) * (-235.593) (-233.251) [-237.883] (-234.344) -- 0:00:20
654500 -- [-236.821] (-240.428) (-233.959) (-233.526) * (-238.887) [-234.322] (-236.486) (-233.559) -- 0:00:20
655000 -- (-234.527) [-234.602] (-236.486) (-236.348) * (-235.236) (-234.516) (-237.391) [-236.614] -- 0:00:20
Average standard deviation of split frequencies: 0.011049
655500 -- (-235.142) [-234.328] (-234.270) (-237.684) * (-236.351) (-233.571) (-236.304) [-234.785] -- 0:00:20
656000 -- (-237.142) (-234.175) (-234.019) [-233.637] * (-237.831) (-235.310) (-234.121) [-234.291] -- 0:00:20
656500 -- (-235.324) (-234.202) (-237.593) [-234.799] * (-236.018) (-235.110) (-237.342) [-236.417] -- 0:00:20
657000 -- (-235.017) [-236.099] (-236.254) (-237.106) * (-234.905) (-235.931) (-236.392) [-235.758] -- 0:00:20
657500 -- [-233.320] (-233.797) (-236.543) (-237.557) * (-234.714) (-235.161) [-236.292] (-234.954) -- 0:00:20
658000 -- (-237.937) [-239.747] (-236.484) (-234.746) * (-238.848) (-236.057) (-233.713) [-234.435] -- 0:00:20
658500 -- [-234.189] (-236.203) (-233.520) (-235.495) * (-238.043) [-233.542] (-233.447) (-232.985) -- 0:00:20
659000 -- [-234.277] (-235.042) (-233.542) (-234.616) * (-238.056) (-234.671) [-234.818] (-234.748) -- 0:00:20
659500 -- [-238.255] (-237.171) (-235.913) (-236.927) * (-235.415) (-234.783) [-235.592] (-237.395) -- 0:00:20
660000 -- (-234.414) (-236.636) (-234.439) [-236.420] * (-236.174) (-236.528) [-233.979] (-239.343) -- 0:00:20
Average standard deviation of split frequencies: 0.011015
660500 -- (-233.471) (-240.259) [-237.705] (-233.411) * (-233.913) (-240.116) [-235.250] (-235.899) -- 0:00:20
661000 -- [-233.029] (-238.163) (-234.492) (-237.020) * (-236.945) (-237.168) (-235.039) [-236.023] -- 0:00:20
661500 -- (-233.198) (-239.387) [-236.209] (-235.343) * [-234.133] (-238.240) (-234.902) (-234.559) -- 0:00:20
662000 -- (-239.017) (-236.058) [-235.169] (-240.281) * (-240.347) (-234.539) [-235.718] (-234.314) -- 0:00:20
662500 -- [-235.622] (-234.501) (-234.858) (-237.149) * (-234.147) [-238.523] (-234.570) (-235.296) -- 0:00:20
663000 -- (-241.290) (-234.161) [-237.959] (-236.539) * (-236.510) (-237.361) [-235.377] (-237.173) -- 0:00:20
663500 -- (-234.625) [-233.364] (-234.573) (-234.120) * (-236.857) (-235.044) [-239.780] (-235.006) -- 0:00:20
664000 -- (-235.709) (-233.744) [-234.118] (-235.330) * (-239.034) [-234.793] (-236.822) (-234.685) -- 0:00:20
664500 -- (-234.247) (-233.645) [-237.552] (-238.087) * (-237.815) (-235.445) [-235.744] (-237.472) -- 0:00:20
665000 -- [-234.765] (-235.111) (-239.232) (-235.781) * (-235.026) (-238.799) [-233.083] (-234.019) -- 0:00:20
Average standard deviation of split frequencies: 0.011369
665500 -- (-234.653) [-234.495] (-237.408) (-233.747) * (-235.070) (-236.537) [-235.010] (-233.320) -- 0:00:20
666000 -- (-234.671) (-236.357) (-234.367) [-233.703] * [-237.527] (-234.983) (-234.286) (-234.031) -- 0:00:20
666500 -- (-233.786) (-234.453) (-234.704) [-234.606] * [-234.834] (-237.307) (-234.495) (-237.418) -- 0:00:20
667000 -- (-234.665) (-233.546) [-234.407] (-236.150) * (-237.604) (-233.441) [-234.732] (-234.751) -- 0:00:19
667500 -- (-235.065) (-233.873) (-235.966) [-239.279] * (-239.015) (-238.868) (-236.228) [-235.525] -- 0:00:19
668000 -- (-236.177) (-233.951) [-236.493] (-238.019) * (-235.865) [-236.494] (-236.687) (-240.800) -- 0:00:19
668500 -- [-238.348] (-233.632) (-234.694) (-235.210) * [-234.577] (-235.080) (-233.992) (-235.496) -- 0:00:19
669000 -- (-237.513) (-233.298) [-236.229] (-233.869) * (-235.328) [-233.347] (-237.095) (-235.146) -- 0:00:19
669500 -- [-237.164] (-234.073) (-235.827) (-239.636) * (-237.743) (-238.580) (-239.413) [-235.612] -- 0:00:19
670000 -- [-235.412] (-233.429) (-238.387) (-235.704) * (-235.146) (-237.911) (-235.035) [-237.566] -- 0:00:19
Average standard deviation of split frequencies: 0.011686
670500 -- (-235.246) (-234.995) (-237.179) [-235.587] * (-234.603) (-235.147) [-233.171] (-234.760) -- 0:00:19
671000 -- (-237.628) [-233.676] (-234.992) (-237.062) * (-234.021) (-236.673) [-234.638] (-238.146) -- 0:00:19
671500 -- [-236.173] (-237.153) (-235.038) (-235.260) * (-234.205) (-234.254) [-236.484] (-235.193) -- 0:00:19
672000 -- (-235.002) (-235.995) [-233.380] (-233.399) * (-236.558) [-234.788] (-236.953) (-239.409) -- 0:00:19
672500 -- (-237.444) (-236.005) (-234.268) [-234.900] * (-237.911) (-238.967) (-241.996) [-234.105] -- 0:00:19
673000 -- [-239.321] (-237.044) (-234.120) (-234.606) * (-234.158) (-235.606) (-243.218) [-234.085] -- 0:00:19
673500 -- (-234.639) [-238.576] (-235.619) (-233.824) * (-236.531) [-233.797] (-234.824) (-235.039) -- 0:00:19
674000 -- (-233.137) (-240.091) [-233.361] (-237.127) * [-235.049] (-234.755) (-236.128) (-236.543) -- 0:00:19
674500 -- (-237.547) (-235.676) [-234.047] (-233.843) * [-236.772] (-235.728) (-235.748) (-235.331) -- 0:00:19
675000 -- (-234.919) (-234.802) [-234.321] (-235.078) * (-234.932) [-235.555] (-234.090) (-238.722) -- 0:00:19
Average standard deviation of split frequencies: 0.011724
675500 -- (-237.336) (-233.455) (-233.723) [-234.563] * [-233.573] (-241.177) (-234.928) (-237.156) -- 0:00:19
676000 -- [-234.701] (-235.782) (-233.670) (-236.114) * (-238.313) (-235.046) [-235.330] (-235.637) -- 0:00:19
676500 -- (-234.371) (-233.865) (-234.690) [-237.538] * (-234.718) [-239.123] (-234.922) (-236.438) -- 0:00:19
677000 -- (-236.160) (-236.367) (-234.966) [-235.139] * (-234.836) [-235.412] (-237.289) (-236.625) -- 0:00:19
677500 -- (-234.659) (-236.284) (-236.089) [-234.182] * (-240.314) (-233.782) [-234.883] (-236.971) -- 0:00:19
678000 -- (-233.899) [-234.412] (-238.555) (-234.419) * (-240.569) (-235.095) (-235.862) [-234.581] -- 0:00:19
678500 -- (-234.915) (-235.264) [-234.818] (-237.477) * (-239.413) (-233.781) [-237.753] (-233.182) -- 0:00:19
679000 -- (-235.946) (-234.380) (-233.310) [-234.382] * (-239.112) (-244.165) (-235.392) [-241.664] -- 0:00:19
679500 -- (-237.848) (-236.972) (-237.243) [-233.780] * [-233.999] (-236.593) (-235.153) (-237.884) -- 0:00:19
680000 -- (-235.361) [-234.503] (-237.584) (-236.778) * (-235.639) (-237.693) (-233.848) [-237.018] -- 0:00:19
Average standard deviation of split frequencies: 0.011687
680500 -- [-236.490] (-234.124) (-239.449) (-235.378) * (-234.206) [-233.957] (-234.909) (-236.878) -- 0:00:19
681000 -- [-238.510] (-235.987) (-234.883) (-234.338) * (-233.914) [-234.553] (-235.773) (-233.211) -- 0:00:19
681500 -- (-235.124) (-235.434) [-233.513] (-233.595) * [-235.198] (-234.456) (-239.091) (-234.134) -- 0:00:19
682000 -- (-235.331) (-233.528) [-233.429] (-237.065) * (-234.582) [-233.636] (-236.721) (-233.930) -- 0:00:19
682500 -- (-236.078) (-234.834) (-233.977) [-234.808] * [-237.536] (-241.719) (-239.210) (-233.508) -- 0:00:19
683000 -- (-237.164) (-235.945) [-233.659] (-237.644) * (-235.329) (-237.256) [-239.337] (-235.320) -- 0:00:19
683500 -- (-237.396) (-234.106) (-235.339) [-234.763] * (-236.202) [-234.212] (-236.808) (-233.249) -- 0:00:18
684000 -- (-234.725) (-234.110) [-240.990] (-237.922) * [-233.565] (-234.224) (-235.765) (-236.017) -- 0:00:18
684500 -- [-234.580] (-233.645) (-237.843) (-235.367) * (-233.373) (-233.361) (-236.903) [-235.542] -- 0:00:18
685000 -- (-234.609) (-238.861) [-235.400] (-237.205) * (-234.894) [-233.926] (-235.796) (-240.130) -- 0:00:18
Average standard deviation of split frequencies: 0.011682
685500 -- [-234.718] (-235.667) (-236.443) (-234.517) * (-235.096) (-233.960) (-236.298) [-239.672] -- 0:00:18
686000 -- (-237.331) [-244.840] (-236.561) (-233.985) * [-235.566] (-233.657) (-234.055) (-236.662) -- 0:00:18
686500 -- [-234.792] (-242.925) (-235.807) (-234.532) * (-235.520) (-236.233) [-234.469] (-237.810) -- 0:00:18
687000 -- (-236.731) [-236.979] (-237.302) (-236.949) * (-240.682) (-233.784) [-234.657] (-234.378) -- 0:00:18
687500 -- (-237.633) [-233.899] (-233.975) (-234.389) * (-235.570) [-233.451] (-235.894) (-234.619) -- 0:00:18
688000 -- (-236.615) [-236.127] (-238.410) (-235.038) * [-235.031] (-233.784) (-234.599) (-237.086) -- 0:00:18
688500 -- (-235.488) (-235.263) [-235.526] (-235.069) * (-234.996) [-233.955] (-234.618) (-236.630) -- 0:00:18
689000 -- (-237.230) (-236.610) [-236.085] (-234.876) * (-236.241) (-236.779) (-234.791) [-234.314] -- 0:00:18
689500 -- (-241.336) [-237.578] (-234.389) (-235.799) * (-236.327) (-233.385) (-235.281) [-235.151] -- 0:00:18
690000 -- (-238.157) (-236.027) [-234.215] (-234.651) * (-237.761) [-234.908] (-237.141) (-233.494) -- 0:00:18
Average standard deviation of split frequencies: 0.011262
690500 -- [-234.881] (-235.870) (-234.751) (-236.533) * (-236.272) (-234.966) [-234.957] (-233.583) -- 0:00:18
691000 -- (-234.245) (-235.156) [-233.984] (-236.617) * [-233.941] (-235.116) (-234.679) (-243.496) -- 0:00:18
691500 -- (-233.621) (-236.833) [-234.683] (-235.260) * (-233.397) (-236.380) (-237.234) [-233.670] -- 0:00:18
692000 -- [-234.711] (-242.823) (-237.968) (-234.790) * (-234.721) (-235.855) (-235.360) [-234.371] -- 0:00:18
692500 -- (-233.809) (-237.248) (-238.139) [-233.085] * (-234.733) [-234.674] (-235.114) (-235.639) -- 0:00:18
693000 -- [-236.454] (-237.005) (-239.604) (-235.758) * (-236.097) (-235.929) (-236.180) [-234.957] -- 0:00:18
693500 -- (-235.904) (-234.324) (-237.031) [-233.381] * [-236.328] (-235.325) (-236.641) (-235.971) -- 0:00:18
694000 -- (-235.872) (-235.601) (-234.850) [-234.492] * [-235.553] (-237.930) (-236.664) (-236.916) -- 0:00:18
694500 -- [-233.235] (-235.972) (-235.810) (-234.762) * (-234.940) [-238.553] (-238.655) (-236.937) -- 0:00:18
695000 -- (-238.102) [-233.982] (-237.489) (-235.616) * [-233.256] (-238.487) (-234.109) (-235.202) -- 0:00:18
Average standard deviation of split frequencies: 0.010752
695500 -- (-235.964) (-233.136) (-234.950) [-235.871] * (-236.252) [-233.718] (-233.531) (-234.710) -- 0:00:18
696000 -- [-236.584] (-234.502) (-235.320) (-235.490) * (-234.227) [-233.795] (-233.851) (-234.355) -- 0:00:18
696500 -- (-235.669) (-236.176) (-233.235) [-236.686] * (-233.198) [-234.083] (-237.027) (-234.463) -- 0:00:18
697000 -- (-236.586) (-236.025) [-235.878] (-235.176) * [-237.406] (-233.123) (-236.102) (-235.663) -- 0:00:18
697500 -- (-237.831) [-235.191] (-235.851) (-234.346) * (-237.619) [-232.972] (-234.663) (-234.541) -- 0:00:18
698000 -- (-234.354) (-238.198) (-236.527) [-234.358] * [-236.813] (-233.688) (-234.763) (-233.688) -- 0:00:18
698500 -- [-237.280] (-238.263) (-233.349) (-234.232) * (-235.595) (-235.008) (-236.168) [-233.471] -- 0:00:18
699000 -- [-233.766] (-238.212) (-237.607) (-233.293) * [-234.166] (-234.515) (-236.117) (-235.622) -- 0:00:18
699500 -- (-236.018) (-234.166) [-237.228] (-233.623) * [-236.243] (-235.439) (-236.259) (-235.061) -- 0:00:18
700000 -- (-236.680) [-235.297] (-237.846) (-234.569) * [-234.384] (-236.539) (-235.092) (-237.310) -- 0:00:18
Average standard deviation of split frequencies: 0.010975
700500 -- (-234.063) (-234.971) [-236.404] (-238.622) * (-236.988) (-234.076) [-235.711] (-234.753) -- 0:00:17
701000 -- (-235.451) (-235.739) (-233.558) [-234.860] * (-237.112) [-233.921] (-236.825) (-236.209) -- 0:00:17
701500 -- (-234.966) (-233.332) (-235.368) [-235.304] * [-238.479] (-234.732) (-237.831) (-236.225) -- 0:00:17
702000 -- (-235.316) [-233.731] (-235.903) (-235.508) * (-238.021) (-236.606) (-234.441) [-237.539] -- 0:00:17
702500 -- [-236.728] (-239.914) (-234.943) (-234.633) * (-235.462) [-236.953] (-234.605) (-239.236) -- 0:00:17
703000 -- (-237.238) [-236.005] (-236.907) (-237.528) * (-239.069) (-234.767) (-234.462) [-236.666] -- 0:00:17
703500 -- (-238.293) [-233.032] (-235.676) (-234.173) * (-235.824) (-233.723) (-233.484) [-234.934] -- 0:00:17
704000 -- [-238.782] (-234.132) (-237.623) (-236.755) * (-235.291) (-237.848) [-234.008] (-234.586) -- 0:00:17
704500 -- (-233.936) (-236.591) (-234.296) [-239.782] * (-238.697) (-236.050) [-233.628] (-238.338) -- 0:00:17
705000 -- (-237.372) [-238.460] (-233.715) (-238.597) * (-236.797) (-238.395) (-237.768) [-235.098] -- 0:00:17
Average standard deviation of split frequencies: 0.010809
705500 -- (-237.438) (-234.328) (-234.132) [-238.672] * [-233.264] (-235.221) (-233.232) (-234.326) -- 0:00:17
706000 -- (-235.811) (-234.584) [-236.399] (-234.667) * (-233.252) (-237.088) [-235.909] (-233.408) -- 0:00:17
706500 -- [-235.447] (-238.980) (-236.788) (-235.953) * (-236.918) (-233.501) [-234.177] (-234.841) -- 0:00:17
707000 -- [-234.522] (-235.863) (-237.747) (-235.333) * (-236.051) (-236.702) [-235.639] (-238.027) -- 0:00:17
707500 -- (-235.853) [-233.173] (-237.345) (-233.371) * [-238.406] (-239.241) (-233.530) (-236.547) -- 0:00:17
708000 -- [-234.771] (-233.696) (-234.479) (-239.376) * (-237.039) [-235.893] (-235.006) (-234.370) -- 0:00:17
708500 -- (-236.378) (-234.949) [-233.707] (-234.172) * (-239.134) (-234.065) [-234.107] (-234.430) -- 0:00:17
709000 -- [-234.644] (-233.280) (-235.932) (-235.488) * (-233.200) (-234.819) (-235.999) [-236.293] -- 0:00:17
709500 -- (-235.299) [-234.893] (-234.949) (-236.098) * (-236.871) (-234.371) [-236.145] (-234.547) -- 0:00:17
710000 -- (-233.065) [-233.273] (-233.436) (-233.472) * (-238.754) (-238.496) [-234.319] (-237.042) -- 0:00:17
Average standard deviation of split frequencies: 0.010655
710500 -- (-233.863) [-237.487] (-233.974) (-235.352) * (-234.749) (-237.357) (-238.261) [-234.794] -- 0:00:17
711000 -- (-235.297) (-236.337) [-235.090] (-236.245) * (-236.492) [-237.601] (-235.002) (-236.669) -- 0:00:17
711500 -- (-237.769) (-235.347) [-234.694] (-234.570) * (-233.483) (-236.893) (-233.837) [-235.078] -- 0:00:17
712000 -- (-239.099) [-237.757] (-235.350) (-235.869) * [-235.160] (-234.013) (-233.696) (-241.074) -- 0:00:17
712500 -- [-234.730] (-237.826) (-236.128) (-241.113) * [-235.217] (-233.910) (-235.694) (-235.897) -- 0:00:17
713000 -- (-235.479) (-233.208) [-234.282] (-236.650) * [-235.344] (-236.291) (-236.228) (-234.460) -- 0:00:17
713500 -- (-234.124) (-233.880) [-236.731] (-237.518) * (-238.107) (-239.494) (-237.645) [-239.913] -- 0:00:17
714000 -- (-233.672) (-237.277) [-234.010] (-235.880) * [-234.277] (-237.581) (-236.473) (-238.009) -- 0:00:17
714500 -- [-233.708] (-233.609) (-239.135) (-235.088) * (-235.959) (-236.947) [-234.779] (-237.847) -- 0:00:17
715000 -- (-234.262) [-235.020] (-233.989) (-235.638) * (-236.284) [-235.138] (-235.667) (-233.729) -- 0:00:17
Average standard deviation of split frequencies: 0.010946
715500 -- (-235.028) (-238.102) (-233.242) [-235.570] * (-238.470) [-234.290] (-239.175) (-235.303) -- 0:00:17
716000 -- (-234.210) [-233.875] (-233.224) (-235.704) * (-238.074) (-237.140) (-240.636) [-236.222] -- 0:00:17
716500 -- (-234.124) [-235.967] (-235.146) (-237.369) * (-235.942) (-234.928) (-233.819) [-235.300] -- 0:00:17
717000 -- (-235.950) (-246.617) [-234.439] (-239.457) * (-235.318) (-235.038) [-236.906] (-235.580) -- 0:00:16
717500 -- [-240.134] (-241.373) (-238.888) (-234.433) * (-233.772) [-236.252] (-235.157) (-233.721) -- 0:00:16
718000 -- (-236.061) [-235.254] (-236.283) (-234.335) * (-236.237) (-235.404) (-237.364) [-233.821] -- 0:00:16
718500 -- (-234.887) [-233.757] (-235.565) (-234.614) * [-235.168] (-234.294) (-235.283) (-238.957) -- 0:00:16
719000 -- [-233.921] (-235.059) (-234.516) (-233.860) * (-234.275) [-235.082] (-235.255) (-235.664) -- 0:00:16
719500 -- (-235.393) [-235.369] (-234.512) (-234.638) * (-233.826) [-234.550] (-234.752) (-238.780) -- 0:00:16
720000 -- [-234.896] (-234.925) (-235.628) (-234.476) * (-236.063) (-235.388) [-236.093] (-236.837) -- 0:00:16
Average standard deviation of split frequencies: 0.010507
720500 -- (-235.141) (-235.891) (-235.661) [-235.198] * [-236.501] (-237.906) (-234.951) (-235.777) -- 0:00:16
721000 -- (-235.904) (-236.326) (-236.480) [-237.031] * (-235.894) [-235.663] (-235.118) (-235.109) -- 0:00:16
721500 -- (-237.700) (-239.299) [-234.747] (-234.050) * (-234.944) [-235.326] (-238.109) (-234.618) -- 0:00:16
722000 -- [-236.144] (-234.048) (-235.932) (-237.742) * [-234.576] (-239.237) (-234.293) (-238.002) -- 0:00:16
722500 -- (-237.552) (-234.455) (-236.745) [-236.896] * (-234.578) (-236.265) (-234.838) [-233.793] -- 0:00:16
723000 -- (-235.818) (-235.780) (-237.609) [-234.224] * [-234.229] (-236.838) (-233.885) (-234.523) -- 0:00:16
723500 -- [-235.251] (-238.728) (-237.203) (-235.195) * (-233.526) [-236.114] (-234.963) (-235.778) -- 0:00:16
724000 -- [-235.284] (-237.809) (-233.555) (-235.047) * (-234.442) [-241.538] (-235.502) (-234.088) -- 0:00:16
724500 -- (-235.662) (-237.049) [-233.736] (-240.201) * (-234.818) (-239.962) (-235.882) [-234.631] -- 0:00:16
725000 -- (-235.823) (-238.290) [-234.040] (-240.426) * (-233.406) (-233.158) [-233.798] (-236.487) -- 0:00:16
Average standard deviation of split frequencies: 0.010267
725500 -- (-234.670) [-233.936] (-235.375) (-242.826) * [-235.776] (-236.090) (-240.421) (-236.708) -- 0:00:16
726000 -- [-233.319] (-235.005) (-236.863) (-238.147) * (-234.922) [-234.353] (-239.936) (-234.590) -- 0:00:16
726500 -- (-233.690) (-238.366) (-233.262) [-236.997] * (-235.849) (-234.141) (-236.539) [-234.169] -- 0:00:16
727000 -- [-235.745] (-233.957) (-240.590) (-236.124) * [-233.589] (-233.852) (-233.950) (-236.495) -- 0:00:16
727500 -- (-235.649) [-234.841] (-235.211) (-241.862) * (-237.218) [-234.322] (-235.431) (-237.632) -- 0:00:16
728000 -- (-237.381) [-237.227] (-236.373) (-237.177) * (-235.580) [-236.371] (-233.169) (-234.820) -- 0:00:16
728500 -- (-238.355) (-240.851) [-236.875] (-236.861) * [-236.181] (-234.411) (-233.422) (-235.066) -- 0:00:16
729000 -- (-234.097) [-235.665] (-235.894) (-234.882) * [-234.168] (-236.002) (-235.163) (-235.636) -- 0:00:16
729500 -- (-234.286) [-234.702] (-235.010) (-234.978) * (-235.735) (-234.272) [-235.957] (-234.157) -- 0:00:16
730000 -- (-233.376) [-233.696] (-236.804) (-234.274) * (-235.784) (-235.956) [-237.878] (-233.632) -- 0:00:16
Average standard deviation of split frequencies: 0.010605
730500 -- (-237.209) (-234.967) [-234.901] (-234.972) * (-237.122) (-234.477) [-236.906] (-233.788) -- 0:00:16
731000 -- (-235.884) (-236.591) (-238.157) [-236.020] * (-240.221) [-236.988] (-235.783) (-233.614) -- 0:00:16
731500 -- (-236.241) (-234.196) (-236.343) [-237.357] * [-237.392] (-240.647) (-233.418) (-238.175) -- 0:00:16
732000 -- (-235.053) [-235.010] (-236.364) (-236.360) * (-236.250) (-240.335) [-236.028] (-234.404) -- 0:00:16
732500 -- (-237.943) (-234.986) (-234.619) [-235.994] * (-233.260) (-235.632) (-233.988) [-233.960] -- 0:00:16
733000 -- [-233.785] (-238.739) (-234.325) (-235.134) * (-233.465) (-236.852) (-236.405) [-238.758] -- 0:00:16
733500 -- (-234.934) (-237.543) (-236.704) [-235.456] * (-233.770) (-237.007) (-236.623) [-234.317] -- 0:00:15
734000 -- (-237.505) (-236.865) (-234.255) [-234.497] * (-237.509) (-234.225) (-234.352) [-233.422] -- 0:00:15
734500 -- (-239.517) [-236.719] (-233.750) (-235.401) * (-233.432) [-234.852] (-243.023) (-234.377) -- 0:00:15
735000 -- (-235.310) (-234.408) (-235.238) [-233.465] * (-236.318) (-239.202) [-237.780] (-234.412) -- 0:00:15
Average standard deviation of split frequencies: 0.010328
735500 -- (-236.300) (-235.028) [-239.066] (-234.535) * [-235.034] (-237.114) (-235.276) (-237.010) -- 0:00:15
736000 -- (-233.898) (-236.735) [-237.152] (-237.299) * [-233.865] (-234.267) (-234.246) (-234.430) -- 0:00:15
736500 -- [-234.254] (-234.153) (-234.921) (-237.232) * (-236.697) (-235.045) [-235.453] (-237.248) -- 0:00:15
737000 -- (-236.205) [-233.795] (-233.646) (-234.180) * (-237.390) (-234.884) [-233.514] (-233.977) -- 0:00:15
737500 -- [-235.610] (-237.437) (-233.830) (-234.288) * (-234.278) (-234.657) [-236.931] (-237.420) -- 0:00:15
738000 -- (-235.551) (-233.631) [-238.810] (-238.388) * (-234.806) [-233.510] (-237.277) (-235.899) -- 0:00:15
738500 -- [-237.391] (-236.575) (-236.024) (-239.235) * (-235.869) (-234.165) (-236.487) [-235.819] -- 0:00:15
739000 -- (-234.276) [-236.043] (-235.908) (-236.695) * (-236.501) [-234.320] (-235.639) (-236.200) -- 0:00:15
739500 -- (-237.652) [-234.849] (-236.755) (-240.153) * (-240.709) (-237.047) [-236.342] (-234.515) -- 0:00:15
740000 -- (-234.232) (-233.751) (-237.449) [-241.522] * (-240.653) (-233.737) [-234.789] (-234.901) -- 0:00:15
Average standard deviation of split frequencies: 0.009706
740500 -- [-237.182] (-238.712) (-236.651) (-234.843) * (-237.336) (-234.465) (-234.351) [-238.297] -- 0:00:15
741000 -- [-234.770] (-237.041) (-235.839) (-235.980) * [-234.802] (-234.327) (-236.480) (-235.713) -- 0:00:15
741500 -- [-237.662] (-236.258) (-234.714) (-241.085) * [-238.657] (-234.784) (-235.411) (-237.713) -- 0:00:15
742000 -- (-240.641) (-235.180) (-234.218) [-234.471] * (-234.761) [-234.383] (-235.194) (-239.552) -- 0:00:15
742500 -- [-236.225] (-237.527) (-235.534) (-236.331) * (-237.015) (-235.938) [-233.564] (-238.568) -- 0:00:15
743000 -- (-235.578) [-234.338] (-242.048) (-237.445) * (-236.965) (-233.035) (-234.776) [-236.005] -- 0:00:15
743500 -- [-236.247] (-236.366) (-238.435) (-237.588) * (-237.346) (-233.962) [-234.087] (-234.500) -- 0:00:15
744000 -- (-235.341) (-237.172) [-239.193] (-233.745) * (-236.783) [-234.565] (-233.906) (-233.833) -- 0:00:15
744500 -- (-234.950) [-236.137] (-233.068) (-234.306) * [-233.853] (-234.445) (-233.660) (-234.665) -- 0:00:15
745000 -- [-236.905] (-236.690) (-234.252) (-234.590) * (-234.173) (-234.432) (-235.317) [-233.510] -- 0:00:15
Average standard deviation of split frequencies: 0.009597
745500 -- (-234.669) (-237.149) [-234.677] (-234.518) * (-233.804) (-237.354) (-238.644) [-236.064] -- 0:00:15
746000 -- [-234.563] (-237.071) (-236.561) (-235.897) * [-236.174] (-235.487) (-235.790) (-238.592) -- 0:00:15
746500 -- (-238.166) [-239.783] (-240.738) (-238.658) * [-235.212] (-234.193) (-234.564) (-237.470) -- 0:00:15
747000 -- (-236.000) [-238.675] (-234.872) (-235.562) * (-234.976) (-234.804) (-235.190) [-234.612] -- 0:00:15
747500 -- (-234.405) (-236.855) (-235.778) [-234.842] * (-236.989) [-235.732] (-235.241) (-236.804) -- 0:00:15
748000 -- (-235.201) (-238.154) (-233.199) [-234.930] * [-239.640] (-236.032) (-237.695) (-234.112) -- 0:00:15
748500 -- [-235.541] (-235.658) (-233.993) (-237.179) * (-237.621) [-242.172] (-243.206) (-236.774) -- 0:00:15
749000 -- [-236.857] (-234.679) (-234.913) (-236.451) * (-244.624) (-236.142) [-234.467] (-240.396) -- 0:00:15
749500 -- (-236.923) (-236.834) [-234.263] (-241.179) * (-237.708) [-235.857] (-235.031) (-234.528) -- 0:00:15
750000 -- [-234.109] (-237.760) (-233.898) (-237.935) * [-234.259] (-233.774) (-238.004) (-235.246) -- 0:00:15
Average standard deviation of split frequencies: 0.009537
750500 -- (-235.809) (-234.497) (-235.246) [-234.590] * (-235.049) (-234.513) (-234.216) [-235.839] -- 0:00:14
751000 -- (-241.737) (-234.230) (-234.323) [-236.581] * (-234.590) [-234.587] (-235.037) (-237.004) -- 0:00:14
751500 -- (-237.038) [-234.468] (-233.697) (-233.512) * (-236.618) (-235.719) (-236.875) [-235.249] -- 0:00:14
752000 -- (-237.378) (-234.834) [-235.271] (-234.230) * (-237.832) (-235.694) [-233.782] (-237.001) -- 0:00:14
752500 -- [-235.945] (-234.632) (-239.549) (-237.458) * (-234.404) [-233.677] (-239.947) (-238.213) -- 0:00:14
753000 -- (-236.672) (-234.221) (-238.728) [-235.071] * [-234.629] (-241.377) (-235.042) (-236.405) -- 0:00:14
753500 -- (-234.162) [-233.654] (-237.004) (-236.844) * (-235.093) [-240.525] (-234.009) (-234.662) -- 0:00:14
754000 -- (-235.115) (-235.527) [-235.747] (-241.747) * [-236.417] (-237.172) (-233.846) (-233.491) -- 0:00:14
754500 -- (-235.504) (-235.426) [-233.351] (-236.531) * (-235.481) [-240.740] (-234.457) (-236.798) -- 0:00:14
755000 -- (-235.625) (-236.369) (-236.077) [-235.339] * (-235.917) (-238.176) (-233.055) [-235.268] -- 0:00:14
Average standard deviation of split frequencies: 0.009470
755500 -- [-235.643] (-237.811) (-236.725) (-237.570) * [-234.913] (-238.119) (-233.493) (-235.078) -- 0:00:14
756000 -- [-236.511] (-236.193) (-234.212) (-235.410) * (-239.170) (-238.094) (-234.260) [-237.844] -- 0:00:14
756500 -- (-233.474) [-233.966] (-235.493) (-234.022) * [-236.294] (-233.943) (-234.420) (-233.342) -- 0:00:14
757000 -- [-233.304] (-240.461) (-234.288) (-233.911) * (-234.404) (-234.578) [-234.022] (-234.410) -- 0:00:14
757500 -- (-238.634) (-234.565) (-234.167) [-236.856] * (-235.695) (-234.370) [-234.156] (-235.629) -- 0:00:14
758000 -- [-234.141] (-237.774) (-236.055) (-235.846) * (-236.233) (-234.473) [-234.559] (-235.409) -- 0:00:14
758500 -- [-234.198] (-235.349) (-234.043) (-234.939) * [-233.541] (-235.187) (-235.168) (-235.198) -- 0:00:14
759000 -- (-234.797) [-237.323] (-235.032) (-234.432) * (-234.063) [-234.222] (-236.862) (-236.047) -- 0:00:14
759500 -- [-235.814] (-233.537) (-237.808) (-236.829) * (-235.211) [-235.387] (-235.459) (-238.395) -- 0:00:14
760000 -- (-237.867) [-234.782] (-233.908) (-234.269) * (-236.218) (-235.971) [-234.753] (-235.206) -- 0:00:14
Average standard deviation of split frequencies: 0.009180
760500 -- [-234.079] (-235.604) (-233.933) (-235.233) * (-237.097) (-236.754) (-234.757) [-234.370] -- 0:00:14
761000 -- (-236.809) [-234.687] (-234.869) (-238.834) * [-235.947] (-235.416) (-237.289) (-238.267) -- 0:00:14
761500 -- (-237.571) (-235.001) [-233.958] (-236.134) * (-236.963) (-239.005) [-236.198] (-236.515) -- 0:00:14
762000 -- (-234.600) [-236.729] (-234.598) (-236.380) * (-235.108) [-237.326] (-234.138) (-236.849) -- 0:00:14
762500 -- (-236.013) (-235.339) [-235.718] (-234.178) * (-235.450) (-233.874) (-233.871) [-235.677] -- 0:00:14
763000 -- (-236.038) (-237.200) (-236.729) [-235.668] * (-234.577) (-235.815) (-235.411) [-234.749] -- 0:00:14
763500 -- (-233.885) [-234.219] (-237.503) (-235.753) * (-235.657) (-236.252) [-234.849] (-233.592) -- 0:00:14
764000 -- (-233.738) (-234.719) [-234.541] (-234.572) * (-237.377) [-234.816] (-234.460) (-235.177) -- 0:00:14
764500 -- (-235.466) (-235.859) (-237.366) [-235.638] * [-236.258] (-234.964) (-233.144) (-234.058) -- 0:00:14
765000 -- (-235.673) (-237.503) (-237.627) [-236.797] * (-238.198) (-237.391) (-237.463) [-235.181] -- 0:00:14
Average standard deviation of split frequencies: 0.009000
765500 -- (-236.646) [-234.572] (-234.117) (-235.179) * (-234.039) (-235.413) (-236.503) [-234.798] -- 0:00:14
766000 -- (-237.378) (-237.325) [-235.913] (-235.637) * (-234.778) (-235.343) [-234.753] (-237.570) -- 0:00:14
766500 -- (-236.193) (-234.214) (-235.922) [-234.712] * (-236.575) (-233.279) (-236.651) [-234.072] -- 0:00:14
767000 -- (-239.496) (-233.369) (-236.347) [-234.139] * (-233.978) (-235.889) [-235.018] (-236.643) -- 0:00:13
767500 -- (-233.602) (-233.491) (-236.975) [-236.363] * [-234.322] (-236.383) (-239.332) (-236.652) -- 0:00:13
768000 -- [-235.734] (-233.822) (-241.309) (-233.516) * (-236.221) (-237.407) [-235.834] (-233.840) -- 0:00:13
768500 -- (-238.578) (-233.632) (-233.732) [-233.583] * (-234.727) (-238.738) (-236.131) [-235.021] -- 0:00:13
769000 -- (-237.544) (-236.984) [-235.067] (-232.970) * [-235.292] (-237.548) (-233.748) (-237.904) -- 0:00:13
769500 -- (-236.383) [-237.295] (-235.761) (-235.336) * [-233.334] (-237.474) (-235.911) (-238.942) -- 0:00:13
770000 -- (-235.264) (-235.061) (-234.066) [-233.151] * [-236.095] (-236.144) (-234.095) (-239.664) -- 0:00:13
Average standard deviation of split frequencies: 0.009061
770500 -- [-233.641] (-236.026) (-234.627) (-238.322) * (-238.705) (-238.671) [-233.422] (-238.317) -- 0:00:13
771000 -- (-242.577) (-237.053) [-235.580] (-239.646) * (-234.495) (-235.665) (-238.738) [-239.221] -- 0:00:13
771500 -- (-237.352) (-236.584) [-237.073] (-236.009) * (-234.992) (-238.792) [-233.726] (-251.172) -- 0:00:13
772000 -- (-236.388) (-236.750) [-235.676] (-238.516) * (-239.064) [-234.325] (-239.352) (-238.540) -- 0:00:13
772500 -- [-236.199] (-235.095) (-234.898) (-237.819) * [-236.360] (-237.957) (-241.246) (-233.809) -- 0:00:13
773000 -- (-234.190) [-234.554] (-234.810) (-238.132) * [-235.685] (-238.490) (-240.443) (-236.214) -- 0:00:13
773500 -- (-235.839) [-234.866] (-235.626) (-233.089) * (-236.659) [-234.350] (-234.566) (-234.107) -- 0:00:13
774000 -- (-235.335) (-234.747) [-236.845] (-233.199) * [-233.627] (-234.313) (-234.189) (-234.821) -- 0:00:13
774500 -- (-241.405) [-234.526] (-234.480) (-235.225) * (-235.147) [-235.997] (-237.410) (-234.232) -- 0:00:13
775000 -- (-237.158) [-233.769] (-235.035) (-240.377) * (-234.777) (-235.482) (-236.626) [-236.367] -- 0:00:13
Average standard deviation of split frequencies: 0.009302
775500 -- [-237.419] (-237.723) (-243.986) (-233.318) * (-235.835) (-235.652) [-236.028] (-238.980) -- 0:00:13
776000 -- [-236.950] (-237.755) (-239.588) (-233.905) * (-234.629) (-236.842) (-241.676) [-234.007] -- 0:00:13
776500 -- (-233.563) (-237.456) (-234.950) [-233.273] * (-235.027) (-235.245) (-236.926) [-236.146] -- 0:00:13
777000 -- (-235.460) (-234.599) (-239.233) [-235.484] * [-235.271] (-234.236) (-234.994) (-236.036) -- 0:00:13
777500 -- (-234.131) [-234.247] (-235.353) (-233.743) * (-233.503) (-236.557) [-233.868] (-239.114) -- 0:00:13
778000 -- (-234.749) [-234.702] (-237.070) (-233.621) * (-235.257) [-235.137] (-236.647) (-237.024) -- 0:00:13
778500 -- [-236.163] (-235.062) (-237.704) (-234.977) * (-234.180) (-234.013) [-234.549] (-233.839) -- 0:00:13
779000 -- (-238.129) (-236.201) (-235.738) [-234.796] * (-234.606) (-235.296) (-233.961) [-238.268] -- 0:00:13
779500 -- (-242.779) (-235.259) [-235.906] (-235.625) * (-234.180) [-235.124] (-235.188) (-233.817) -- 0:00:13
780000 -- (-234.819) [-236.639] (-236.243) (-234.770) * [-236.135] (-236.363) (-235.818) (-236.429) -- 0:00:13
Average standard deviation of split frequencies: 0.009548
780500 -- [-235.112] (-242.079) (-234.513) (-238.799) * (-237.436) [-244.730] (-233.794) (-235.706) -- 0:00:13
781000 -- (-233.729) [-234.215] (-233.317) (-235.093) * (-234.150) [-243.566] (-235.788) (-235.181) -- 0:00:13
781500 -- (-235.013) (-233.570) [-234.840] (-240.308) * (-236.065) (-235.935) (-234.850) [-233.635] -- 0:00:13
782000 -- (-235.647) (-234.501) (-236.746) [-233.944] * (-237.237) (-235.658) (-235.425) [-238.813] -- 0:00:13
782500 -- (-234.266) (-233.537) (-233.454) [-234.916] * (-238.694) (-233.278) (-235.840) [-235.910] -- 0:00:13
783000 -- (-233.809) [-235.297] (-234.892) (-235.004) * (-241.259) [-234.580] (-236.550) (-235.862) -- 0:00:13
783500 -- [-234.556] (-237.566) (-234.462) (-234.697) * (-235.584) (-235.417) (-235.199) [-236.270] -- 0:00:12
784000 -- (-233.974) (-234.073) [-236.322] (-233.531) * (-239.020) (-234.690) [-233.401] (-235.520) -- 0:00:12
784500 -- (-238.118) (-239.603) (-233.873) [-235.583] * (-234.827) (-235.811) (-233.358) [-235.429] -- 0:00:12
785000 -- (-235.199) [-235.899] (-235.291) (-235.988) * (-235.163) (-234.860) [-234.494] (-233.571) -- 0:00:12
Average standard deviation of split frequencies: 0.008996
785500 -- [-233.392] (-234.376) (-238.753) (-234.257) * [-234.967] (-236.415) (-237.089) (-236.652) -- 0:00:12
786000 -- [-234.253] (-238.549) (-236.271) (-234.013) * (-235.144) (-235.510) (-233.773) [-233.867] -- 0:00:12
786500 -- (-234.365) (-236.320) [-236.989] (-233.801) * (-233.438) (-237.184) [-233.321] (-237.703) -- 0:00:12
787000 -- (-233.371) [-233.795] (-237.115) (-235.183) * [-233.672] (-235.588) (-234.963) (-235.166) -- 0:00:12
787500 -- [-236.212] (-235.745) (-237.960) (-234.226) * (-236.101) (-236.039) [-237.694] (-236.111) -- 0:00:12
788000 -- (-236.358) [-236.031] (-235.678) (-235.290) * (-238.268) [-234.078] (-237.857) (-236.604) -- 0:00:12
788500 -- (-236.279) (-233.379) [-237.546] (-236.049) * (-234.924) [-233.636] (-236.552) (-235.664) -- 0:00:12
789000 -- (-238.003) [-235.607] (-237.436) (-234.288) * (-237.290) (-236.058) [-235.362] (-236.949) -- 0:00:12
789500 -- (-239.757) (-234.683) (-235.161) [-233.854] * (-233.864) [-233.507] (-235.843) (-235.895) -- 0:00:12
790000 -- (-237.787) [-239.104] (-235.638) (-236.627) * (-239.322) [-233.723] (-234.825) (-236.488) -- 0:00:12
Average standard deviation of split frequencies: 0.009204
790500 -- (-242.932) [-233.717] (-234.836) (-236.569) * (-234.567) (-239.267) [-239.621] (-238.050) -- 0:00:12
791000 -- (-235.593) (-237.603) [-234.651] (-234.861) * (-238.624) [-237.239] (-234.152) (-233.980) -- 0:00:12
791500 -- [-235.511] (-240.409) (-234.696) (-238.270) * [-235.665] (-234.883) (-239.871) (-235.267) -- 0:00:12
792000 -- (-238.051) (-237.739) (-233.790) [-235.203] * (-236.283) (-235.901) (-234.608) [-235.229] -- 0:00:12
792500 -- (-234.487) (-240.382) (-233.618) [-235.351] * (-234.461) (-236.130) (-234.563) [-233.436] -- 0:00:12
793000 -- (-235.161) [-237.720] (-236.035) (-234.447) * (-235.772) (-234.713) [-234.606] (-234.566) -- 0:00:12
793500 -- (-233.501) (-235.575) [-235.023] (-234.886) * [-235.066] (-234.422) (-233.555) (-235.235) -- 0:00:12
794000 -- (-233.973) [-234.724] (-236.493) (-234.879) * (-235.587) (-238.888) [-234.272] (-233.878) -- 0:00:12
794500 -- (-234.641) (-234.390) [-233.894] (-234.224) * [-240.080] (-237.279) (-235.344) (-236.126) -- 0:00:12
795000 -- [-236.124] (-238.707) (-235.969) (-239.466) * (-238.018) (-236.524) [-233.424] (-241.016) -- 0:00:12
Average standard deviation of split frequencies: 0.008735
795500 -- (-237.450) (-237.045) (-234.477) [-236.894] * [-235.193] (-234.499) (-235.608) (-235.020) -- 0:00:12
796000 -- (-238.379) [-234.536] (-238.429) (-234.915) * (-240.836) (-238.239) (-235.620) [-235.208] -- 0:00:12
796500 -- (-237.731) (-235.516) (-237.269) [-234.314] * (-234.985) (-235.742) [-237.165] (-234.622) -- 0:00:12
797000 -- (-239.923) (-236.307) [-234.936] (-235.997) * (-235.363) [-234.358] (-236.023) (-236.595) -- 0:00:12
797500 -- (-235.779) [-237.916] (-234.927) (-233.687) * (-238.898) (-233.185) (-234.784) [-234.312] -- 0:00:12
798000 -- (-234.206) (-234.188) [-234.199] (-236.126) * (-235.497) (-234.713) (-234.645) [-236.522] -- 0:00:12
798500 -- (-234.674) [-234.468] (-234.676) (-236.697) * (-234.713) (-235.878) [-233.539] (-235.024) -- 0:00:12
799000 -- (-234.067) (-238.242) [-236.054] (-235.991) * (-234.823) [-236.723] (-234.154) (-233.942) -- 0:00:12
799500 -- [-233.251] (-236.460) (-233.716) (-238.317) * (-234.899) [-235.817] (-236.828) (-236.241) -- 0:00:12
800000 -- [-236.309] (-238.819) (-236.160) (-236.821) * [-235.304] (-234.453) (-234.692) (-233.787) -- 0:00:12
Average standard deviation of split frequencies: 0.008868
800500 -- [-235.029] (-233.524) (-235.000) (-240.910) * (-235.607) (-234.020) [-233.871] (-236.298) -- 0:00:11
801000 -- [-234.458] (-233.656) (-235.014) (-236.200) * (-234.534) (-233.131) (-236.902) [-235.038] -- 0:00:11
801500 -- [-234.633] (-234.417) (-236.520) (-234.056) * [-233.984] (-234.072) (-239.857) (-237.257) -- 0:00:11
802000 -- (-235.349) [-234.600] (-233.088) (-235.871) * (-238.137) (-235.541) [-236.335] (-240.853) -- 0:00:11
802500 -- (-234.519) [-235.557] (-236.110) (-235.378) * [-236.138] (-234.530) (-240.282) (-237.596) -- 0:00:11
803000 -- (-236.496) [-233.349] (-236.859) (-237.862) * (-235.113) (-235.097) (-233.959) [-234.145] -- 0:00:11
803500 -- [-236.731] (-236.649) (-236.744) (-235.522) * (-235.804) [-236.526] (-233.210) (-235.850) -- 0:00:11
804000 -- [-239.349] (-234.086) (-239.187) (-233.355) * (-241.850) (-236.805) [-233.762] (-237.531) -- 0:00:11
804500 -- (-234.472) (-239.132) [-238.487] (-233.870) * (-234.968) (-237.251) [-235.328] (-240.553) -- 0:00:11
805000 -- (-234.552) (-234.896) [-233.896] (-234.608) * [-241.029] (-239.484) (-235.020) (-236.672) -- 0:00:11
Average standard deviation of split frequencies: 0.009248
805500 -- [-236.698] (-234.549) (-233.834) (-234.993) * (-241.918) [-233.362] (-237.510) (-237.233) -- 0:00:11
806000 -- [-239.867] (-234.837) (-234.399) (-236.515) * (-234.170) (-235.917) (-238.829) [-234.716] -- 0:00:11
806500 -- (-238.504) [-233.679] (-236.054) (-241.266) * (-234.398) (-233.668) (-239.087) [-234.365] -- 0:00:11
807000 -- [-239.061] (-236.412) (-235.593) (-234.803) * [-234.851] (-235.202) (-235.226) (-234.099) -- 0:00:11
807500 -- [-233.983] (-237.116) (-236.567) (-233.480) * (-239.398) (-234.695) [-236.881] (-235.017) -- 0:00:11
808000 -- (-235.995) (-239.098) [-235.168] (-233.295) * (-235.814) (-235.719) [-234.717] (-234.497) -- 0:00:11
808500 -- (-233.445) [-235.459] (-234.334) (-234.159) * (-233.454) [-234.623] (-236.783) (-238.090) -- 0:00:11
809000 -- [-235.084] (-235.158) (-233.554) (-233.795) * (-233.800) (-233.893) (-235.598) [-236.322] -- 0:00:11
809500 -- (-234.603) (-234.311) [-233.419] (-237.673) * (-235.004) (-238.913) (-237.942) [-233.748] -- 0:00:11
810000 -- (-234.624) (-243.316) (-233.233) [-235.129] * (-234.038) [-234.424] (-236.544) (-235.439) -- 0:00:11
Average standard deviation of split frequencies: 0.009050
810500 -- (-235.393) (-236.315) (-233.726) [-235.096] * (-243.554) [-233.258] (-233.128) (-234.529) -- 0:00:11
811000 -- (-237.257) (-237.557) [-234.336] (-234.569) * (-235.930) [-235.439] (-233.314) (-236.890) -- 0:00:11
811500 -- [-234.403] (-235.344) (-235.124) (-234.768) * (-234.989) (-237.721) (-233.845) [-235.155] -- 0:00:11
812000 -- [-240.731] (-234.222) (-234.849) (-234.840) * (-234.443) [-235.178] (-235.309) (-237.629) -- 0:00:11
812500 -- (-234.002) (-238.773) (-234.187) [-234.928] * [-234.092] (-235.306) (-234.432) (-237.360) -- 0:00:11
813000 -- (-234.970) (-234.453) (-235.150) [-234.521] * [-235.782] (-236.087) (-235.263) (-236.348) -- 0:00:11
813500 -- (-239.599) (-237.275) [-234.368] (-235.537) * (-235.157) (-234.948) (-238.834) [-237.596] -- 0:00:11
814000 -- (-236.734) [-237.236] (-235.063) (-236.385) * (-235.006) (-236.979) [-234.188] (-238.189) -- 0:00:11
814500 -- [-237.879] (-234.650) (-238.612) (-239.653) * [-235.649] (-233.964) (-237.392) (-237.247) -- 0:00:11
815000 -- (-234.322) (-234.018) (-234.237) [-235.381] * (-237.071) [-235.457] (-234.661) (-234.226) -- 0:00:11
Average standard deviation of split frequencies: 0.009135
815500 -- (-234.541) (-236.342) [-238.419] (-234.516) * (-240.693) (-238.030) (-233.452) [-233.412] -- 0:00:11
816000 -- (-233.566) [-235.653] (-236.395) (-237.558) * (-237.627) (-237.739) (-235.607) [-234.121] -- 0:00:11
816500 -- [-235.050] (-237.571) (-236.159) (-236.809) * [-235.185] (-237.796) (-234.624) (-234.998) -- 0:00:11
817000 -- (-243.339) (-236.007) [-238.437] (-236.855) * (-235.659) (-234.092) (-233.801) [-235.727] -- 0:00:10
817500 -- (-238.848) [-233.862] (-237.535) (-234.300) * (-237.962) (-240.004) (-233.609) [-235.640] -- 0:00:10
818000 -- (-238.435) (-237.408) (-233.965) [-235.515] * [-237.702] (-238.499) (-234.909) (-234.167) -- 0:00:10
818500 -- (-236.093) (-233.127) (-235.975) [-233.016] * (-238.183) (-236.615) (-234.988) [-233.466] -- 0:00:10
819000 -- (-235.095) (-235.957) [-234.005] (-237.629) * (-235.822) (-236.737) (-235.774) [-234.212] -- 0:00:10
819500 -- (-234.166) [-233.470] (-237.551) (-235.375) * (-235.029) [-234.042] (-240.383) (-235.047) -- 0:00:10
820000 -- (-234.432) [-232.937] (-243.407) (-234.450) * (-234.199) (-235.186) [-235.235] (-237.791) -- 0:00:10
Average standard deviation of split frequencies: 0.008796
820500 -- [-233.449] (-236.460) (-237.877) (-234.772) * (-234.642) (-234.620) [-235.281] (-238.486) -- 0:00:10
821000 -- (-235.136) [-234.283] (-234.556) (-233.543) * (-234.778) (-237.423) [-235.047] (-236.205) -- 0:00:10
821500 -- (-237.721) [-237.334] (-234.473) (-233.329) * (-236.241) [-233.600] (-233.179) (-235.040) -- 0:00:10
822000 -- (-234.348) (-235.914) (-234.298) [-234.225] * [-235.464] (-234.254) (-233.983) (-235.817) -- 0:00:10
822500 -- [-233.620] (-237.575) (-234.923) (-234.092) * (-235.125) (-234.909) [-234.079] (-234.783) -- 0:00:10
823000 -- (-233.987) [-233.990] (-233.652) (-234.964) * (-234.979) (-233.970) (-234.857) [-234.853] -- 0:00:10
823500 -- (-236.800) (-235.046) (-236.624) [-234.479] * (-235.192) (-234.220) (-234.754) [-234.414] -- 0:00:10
824000 -- (-235.136) (-237.020) (-235.844) [-234.340] * [-236.408] (-234.248) (-236.400) (-235.415) -- 0:00:10
824500 -- (-235.911) (-233.534) [-233.845] (-234.334) * (-233.972) (-235.446) [-236.989] (-234.947) -- 0:00:10
825000 -- (-233.923) (-239.279) [-234.774] (-234.943) * (-235.902) (-238.327) (-237.310) [-235.756] -- 0:00:10
Average standard deviation of split frequencies: 0.008953
825500 -- (-233.000) [-233.074] (-235.331) (-239.728) * (-235.545) (-233.808) [-235.760] (-237.733) -- 0:00:10
826000 -- (-234.146) (-233.440) [-234.589] (-235.887) * (-239.029) [-234.047] (-241.673) (-233.206) -- 0:00:10
826500 -- (-236.013) (-234.085) (-237.025) [-234.487] * (-234.701) (-235.497) (-242.798) [-233.869] -- 0:00:10
827000 -- (-236.152) [-234.379] (-235.744) (-235.013) * (-233.484) (-233.873) [-242.109] (-236.742) -- 0:00:10
827500 -- (-235.285) [-237.714] (-235.330) (-234.851) * [-234.781] (-234.430) (-238.661) (-234.784) -- 0:00:10
828000 -- (-236.843) [-234.339] (-235.564) (-236.978) * (-234.417) [-233.378] (-234.915) (-235.903) -- 0:00:10
828500 -- (-236.680) (-235.723) (-233.866) [-234.166] * [-233.686] (-233.594) (-234.345) (-240.142) -- 0:00:10
829000 -- (-237.171) (-236.614) [-235.764] (-240.106) * (-236.817) [-235.384] (-239.451) (-235.381) -- 0:00:10
829500 -- [-234.115] (-235.787) (-235.440) (-234.848) * (-238.016) [-237.138] (-240.296) (-234.692) -- 0:00:10
830000 -- (-233.942) (-237.454) [-235.679] (-234.822) * (-234.315) (-233.768) (-235.157) [-239.100] -- 0:00:10
Average standard deviation of split frequencies: 0.008938
830500 -- (-235.970) [-232.978] (-237.028) (-237.079) * (-236.665) (-237.796) (-238.104) [-235.446] -- 0:00:10
831000 -- (-237.565) (-236.717) [-233.650] (-238.922) * [-236.538] (-239.052) (-237.666) (-237.336) -- 0:00:10
831500 -- (-236.416) [-234.748] (-234.419) (-234.287) * [-233.203] (-237.763) (-233.941) (-237.968) -- 0:00:10
832000 -- (-234.766) [-236.675] (-235.244) (-235.612) * [-234.474] (-236.911) (-234.144) (-235.663) -- 0:00:10
832500 -- (-233.641) (-233.666) (-236.300) [-236.830] * (-234.706) [-238.693] (-236.450) (-235.017) -- 0:00:10
833000 -- (-234.158) [-233.627] (-238.967) (-240.631) * (-238.658) (-236.731) (-235.529) [-234.163] -- 0:00:10
833500 -- (-235.354) (-235.968) [-235.547] (-236.116) * (-234.682) [-234.341] (-236.889) (-233.492) -- 0:00:09
834000 -- (-234.390) [-233.231] (-234.792) (-235.200) * (-238.821) (-237.165) [-234.317] (-238.332) -- 0:00:09
834500 -- [-237.527] (-235.207) (-234.335) (-234.085) * [-235.481] (-236.702) (-233.649) (-236.842) -- 0:00:09
835000 -- (-235.864) [-235.125] (-236.884) (-235.063) * (-238.911) [-235.920] (-233.955) (-238.799) -- 0:00:09
Average standard deviation of split frequencies: 0.009304
835500 -- (-234.780) (-234.214) [-238.064] (-238.674) * (-234.959) (-238.121) (-235.058) [-233.727] -- 0:00:09
836000 -- (-239.982) [-236.159] (-234.359) (-240.420) * (-234.620) (-236.698) (-234.178) [-233.603] -- 0:00:09
836500 -- (-233.447) (-240.520) [-235.189] (-239.493) * (-235.208) (-235.694) [-234.169] (-234.474) -- 0:00:09
837000 -- [-234.094] (-235.707) (-236.892) (-240.414) * (-234.969) (-234.684) [-238.959] (-234.660) -- 0:00:09
837500 -- (-241.811) (-234.041) [-234.706] (-238.114) * (-233.799) (-233.433) [-236.081] (-234.241) -- 0:00:09
838000 -- (-238.127) (-234.004) (-234.525) [-239.088] * (-236.733) (-234.274) [-235.251] (-235.892) -- 0:00:09
838500 -- (-237.713) (-234.900) [-235.216] (-235.411) * [-234.784] (-233.482) (-235.196) (-235.832) -- 0:00:09
839000 -- (-234.885) (-234.829) [-234.146] (-236.037) * (-236.964) [-234.703] (-235.821) (-236.481) -- 0:00:09
839500 -- (-238.599) (-236.950) (-235.681) [-234.790] * (-234.782) (-236.009) [-234.070] (-234.957) -- 0:00:09
840000 -- (-235.033) (-235.603) [-236.558] (-236.019) * (-239.320) (-238.521) (-239.630) [-236.081] -- 0:00:09
Average standard deviation of split frequencies: 0.009568
840500 -- [-233.420] (-233.724) (-233.140) (-233.487) * (-242.901) (-237.924) [-234.354] (-239.467) -- 0:00:09
841000 -- [-236.031] (-237.091) (-235.473) (-234.595) * (-237.680) (-239.994) (-234.619) [-236.806] -- 0:00:09
841500 -- (-234.209) (-235.640) (-235.642) [-235.524] * (-238.018) (-236.146) [-236.697] (-239.472) -- 0:00:09
842000 -- [-233.421] (-234.154) (-234.847) (-239.045) * (-239.875) [-234.667] (-238.608) (-236.877) -- 0:00:09
842500 -- (-236.578) (-234.122) [-234.425] (-235.623) * [-239.268] (-237.650) (-240.431) (-234.042) -- 0:00:09
843000 -- (-233.653) [-235.230] (-237.853) (-236.586) * (-235.746) [-237.171] (-235.992) (-235.421) -- 0:00:09
843500 -- (-236.734) (-234.468) (-235.230) [-236.125] * (-237.289) (-233.615) [-234.701] (-236.660) -- 0:00:09
844000 -- [-238.104] (-234.692) (-236.992) (-234.741) * (-235.358) [-234.883] (-234.737) (-236.083) -- 0:00:09
844500 -- (-238.078) (-235.503) (-236.987) [-234.308] * (-234.259) (-240.993) (-234.630) [-234.896] -- 0:00:09
845000 -- [-237.473] (-236.627) (-235.894) (-233.444) * (-234.181) (-237.869) (-236.790) [-234.900] -- 0:00:09
Average standard deviation of split frequencies: 0.009507
845500 -- (-236.915) (-234.158) (-236.849) [-233.916] * (-235.407) (-234.886) [-234.090] (-234.902) -- 0:00:09
846000 -- (-233.781) (-235.195) [-234.655] (-237.019) * (-234.171) [-233.718] (-233.545) (-234.328) -- 0:00:09
846500 -- [-233.541] (-234.003) (-237.221) (-233.329) * (-236.162) [-233.730] (-234.856) (-234.485) -- 0:00:09
847000 -- (-234.633) (-235.006) (-237.627) [-233.859] * [-236.869] (-236.320) (-235.178) (-235.078) -- 0:00:09
847500 -- (-234.951) (-243.720) (-235.861) [-233.223] * (-233.537) (-234.646) (-236.055) [-234.509] -- 0:00:09
848000 -- (-236.574) (-244.049) (-235.743) [-234.016] * (-235.843) (-238.175) [-233.969] (-236.629) -- 0:00:09
848500 -- (-236.075) (-237.704) [-234.983] (-236.985) * (-237.425) (-235.608) [-234.873] (-238.224) -- 0:00:09
849000 -- (-234.327) [-235.866] (-234.743) (-233.488) * (-234.130) [-238.618] (-236.592) (-236.559) -- 0:00:09
849500 -- (-234.883) (-235.036) [-235.300] (-236.915) * (-233.882) (-234.180) [-235.241] (-235.789) -- 0:00:09
850000 -- (-235.134) (-233.278) (-233.984) [-234.112] * (-236.587) [-234.352] (-233.534) (-234.742) -- 0:00:09
Average standard deviation of split frequencies: 0.009282
850500 -- (-236.496) [-236.168] (-235.058) (-235.391) * (-235.045) (-235.755) (-235.130) [-235.079] -- 0:00:08
851000 -- (-233.675) (-237.657) (-234.529) [-235.684] * [-233.734] (-234.417) (-234.200) (-236.668) -- 0:00:08
851500 -- [-234.597] (-237.319) (-236.212) (-233.399) * (-235.519) (-238.447) (-236.083) [-234.095] -- 0:00:08
852000 -- (-237.679) (-234.203) (-233.459) [-234.488] * (-236.354) [-237.720] (-239.212) (-236.578) -- 0:00:08
852500 -- [-235.778] (-237.096) (-234.566) (-237.102) * (-235.194) (-233.374) [-235.431] (-235.318) -- 0:00:08
853000 -- (-234.149) (-234.287) (-236.562) [-237.611] * (-240.527) (-234.568) (-234.213) [-233.710] -- 0:00:08
853500 -- [-235.458] (-235.201) (-237.331) (-236.836) * (-235.733) [-238.659] (-235.272) (-236.724) -- 0:00:08
854000 -- (-236.350) [-235.217] (-237.439) (-235.867) * (-234.245) (-236.671) (-235.355) [-237.182] -- 0:00:08
854500 -- (-233.943) [-233.388] (-239.716) (-234.883) * (-233.550) (-235.501) [-233.967] (-235.437) -- 0:00:08
855000 -- [-238.176] (-238.866) (-235.733) (-237.434) * (-237.137) (-234.806) [-233.864] (-233.309) -- 0:00:08
Average standard deviation of split frequencies: 0.009259
855500 -- (-237.598) (-236.555) (-234.183) [-236.331] * (-234.987) (-235.268) [-234.479] (-236.481) -- 0:00:08
856000 -- (-238.699) (-235.465) [-234.895] (-233.296) * [-234.558] (-235.704) (-238.862) (-238.912) -- 0:00:08
856500 -- [-237.212] (-235.553) (-241.183) (-235.123) * (-235.968) (-233.991) [-236.662] (-236.181) -- 0:00:08
857000 -- [-234.134] (-235.043) (-241.278) (-236.745) * [-235.940] (-236.170) (-235.013) (-234.961) -- 0:00:08
857500 -- (-234.704) [-236.599] (-235.618) (-237.030) * (-233.166) [-235.724] (-238.799) (-234.634) -- 0:00:08
858000 -- (-233.865) (-233.759) (-233.930) [-235.088] * (-233.979) (-235.811) (-233.039) [-236.044] -- 0:00:08
858500 -- (-239.277) (-233.894) (-235.925) [-233.863] * [-235.891] (-233.615) (-234.129) (-235.918) -- 0:00:08
859000 -- (-234.785) (-235.645) [-237.823] (-236.257) * (-235.951) [-233.530] (-234.088) (-237.103) -- 0:00:08
859500 -- (-234.921) (-234.931) (-238.081) [-233.874] * (-236.606) (-238.322) [-233.898] (-242.098) -- 0:00:08
860000 -- (-234.036) [-234.875] (-234.201) (-233.377) * (-235.748) (-234.806) (-238.330) [-234.107] -- 0:00:08
Average standard deviation of split frequencies: 0.008935
860500 -- (-235.074) (-234.382) [-234.396] (-236.408) * [-235.579] (-233.926) (-233.013) (-236.365) -- 0:00:08
861000 -- (-238.063) (-237.387) (-234.087) [-234.530] * (-235.025) (-234.401) (-235.624) [-236.983] -- 0:00:08
861500 -- [-235.903] (-235.799) (-233.739) (-234.781) * [-233.828] (-237.037) (-238.890) (-235.294) -- 0:00:08
862000 -- (-237.920) [-236.960] (-237.454) (-234.978) * [-234.414] (-234.384) (-237.314) (-236.875) -- 0:00:08
862500 -- (-238.039) [-236.642] (-236.358) (-233.844) * [-238.361] (-234.828) (-239.980) (-235.883) -- 0:00:08
863000 -- (-238.267) (-237.526) (-234.928) [-235.203] * (-235.129) [-233.688] (-237.624) (-238.565) -- 0:00:08
863500 -- (-234.375) (-235.705) [-234.917] (-234.942) * (-235.963) [-236.807] (-233.977) (-235.561) -- 0:00:08
864000 -- (-235.784) (-235.051) [-233.814] (-236.256) * [-238.423] (-234.667) (-235.149) (-236.388) -- 0:00:08
864500 -- (-235.037) (-235.903) [-233.380] (-237.095) * (-236.752) [-236.966] (-234.273) (-234.261) -- 0:00:08
865000 -- (-234.041) (-237.239) [-236.648] (-234.438) * (-234.636) (-236.775) [-234.487] (-234.888) -- 0:00:08
Average standard deviation of split frequencies: 0.008846
865500 -- (-235.363) [-234.416] (-239.157) (-242.534) * (-233.867) (-234.785) (-235.118) [-233.460] -- 0:00:08
866000 -- (-238.206) (-233.529) [-236.470] (-236.464) * (-240.894) [-234.591] (-237.408) (-234.298) -- 0:00:08
866500 -- (-235.285) (-239.021) (-235.884) [-238.398] * (-234.473) [-235.077] (-237.025) (-233.903) -- 0:00:08
867000 -- (-236.434) (-233.359) (-237.070) [-235.052] * [-233.682] (-235.166) (-236.959) (-234.601) -- 0:00:07
867500 -- (-234.987) [-236.929] (-234.833) (-237.916) * (-233.086) (-234.858) (-235.557) [-234.688] -- 0:00:07
868000 -- (-235.884) (-237.622) (-233.920) [-237.134] * (-233.878) [-234.122] (-236.479) (-238.896) -- 0:00:07
868500 -- (-237.518) [-237.392] (-236.041) (-235.234) * (-233.598) [-235.342] (-233.968) (-234.431) -- 0:00:07
869000 -- (-238.430) [-236.646] (-237.515) (-235.295) * (-237.036) [-234.473] (-234.167) (-236.345) -- 0:00:07
869500 -- [-238.778] (-237.996) (-233.902) (-233.579) * (-234.069) [-238.169] (-234.766) (-235.288) -- 0:00:07
870000 -- (-234.832) [-235.259] (-234.036) (-233.908) * (-233.252) [-238.509] (-235.366) (-234.816) -- 0:00:07
Average standard deviation of split frequencies: 0.008900
870500 -- [-236.613] (-234.688) (-238.639) (-234.205) * [-233.761] (-233.757) (-234.683) (-233.152) -- 0:00:07
871000 -- (-234.039) (-238.789) (-235.608) [-233.947] * (-234.919) (-234.666) (-236.375) [-236.537] -- 0:00:07
871500 -- [-233.720] (-237.397) (-237.424) (-237.515) * (-233.398) [-235.619] (-236.814) (-236.334) -- 0:00:07
872000 -- [-234.753] (-240.657) (-234.015) (-235.382) * (-237.980) [-236.412] (-233.741) (-233.300) -- 0:00:07
872500 -- (-240.861) [-236.042] (-234.058) (-235.175) * (-236.639) (-234.865) (-235.797) [-234.148] -- 0:00:07
873000 -- (-236.050) [-236.598] (-236.172) (-238.785) * [-235.118] (-235.828) (-238.436) (-235.212) -- 0:00:07
873500 -- (-237.121) (-237.481) [-235.518] (-238.788) * (-237.899) [-235.053] (-235.926) (-234.319) -- 0:00:07
874000 -- (-236.253) (-236.354) (-237.710) [-237.772] * [-236.477] (-234.977) (-235.199) (-233.095) -- 0:00:07
874500 -- (-237.461) (-233.702) [-238.509] (-241.550) * (-235.710) [-234.542] (-235.412) (-238.304) -- 0:00:07
875000 -- (-234.948) [-234.800] (-233.944) (-235.039) * (-237.702) (-235.742) [-235.233] (-237.479) -- 0:00:07
Average standard deviation of split frequencies: 0.008476
875500 -- (-234.360) (-234.498) (-234.329) [-235.571] * [-235.905] (-234.145) (-234.629) (-238.904) -- 0:00:07
876000 -- (-234.417) (-238.033) [-238.974] (-237.303) * (-234.508) (-234.799) (-234.640) [-235.788] -- 0:00:07
876500 -- (-234.209) (-238.987) [-235.650] (-237.758) * [-235.797] (-238.531) (-235.125) (-234.329) -- 0:00:07
877000 -- (-234.812) (-234.080) (-234.263) [-236.535] * (-235.437) [-234.066] (-233.837) (-234.036) -- 0:00:07
877500 -- (-233.779) [-235.771] (-236.818) (-239.671) * [-235.106] (-234.209) (-233.588) (-235.672) -- 0:00:07
878000 -- [-234.328] (-235.177) (-235.704) (-236.657) * (-235.597) (-233.803) (-235.396) [-235.136] -- 0:00:07
878500 -- (-241.841) (-238.079) [-238.572] (-234.918) * (-235.552) (-235.177) [-235.826] (-235.321) -- 0:00:07
879000 -- (-237.469) (-236.424) [-239.615] (-234.355) * [-236.611] (-235.513) (-236.611) (-236.000) -- 0:00:07
879500 -- (-235.676) (-236.428) [-236.469] (-238.983) * (-234.791) (-235.972) [-234.199] (-234.963) -- 0:00:07
880000 -- [-234.446] (-234.074) (-236.963) (-233.852) * (-235.096) [-233.944] (-235.135) (-234.861) -- 0:00:07
Average standard deviation of split frequencies: 0.008297
880500 -- [-234.241] (-234.157) (-233.953) (-236.485) * (-238.306) (-236.261) (-235.237) [-234.840] -- 0:00:07
881000 -- [-232.988] (-236.328) (-233.630) (-237.647) * [-238.099] (-237.267) (-236.902) (-237.964) -- 0:00:07
881500 -- (-233.422) (-236.071) (-233.473) [-233.604] * (-237.691) [-234.827] (-234.548) (-238.200) -- 0:00:07
882000 -- (-235.206) (-235.458) [-235.028] (-235.640) * (-235.012) (-237.197) [-234.592] (-239.253) -- 0:00:07
882500 -- (-237.955) (-234.811) [-239.582] (-233.802) * (-234.387) [-235.621] (-238.495) (-234.642) -- 0:00:07
883000 -- (-241.339) [-236.842] (-237.155) (-233.821) * (-232.947) [-235.528] (-236.522) (-238.638) -- 0:00:07
883500 -- [-235.340] (-233.319) (-237.636) (-233.629) * (-235.198) (-233.617) [-239.426] (-238.177) -- 0:00:06
884000 -- (-236.610) (-240.873) (-237.281) [-237.437] * (-233.714) (-233.479) [-240.502] (-236.467) -- 0:00:06
884500 -- [-235.514] (-239.476) (-236.040) (-235.253) * (-235.918) (-235.842) [-233.764] (-235.634) -- 0:00:06
885000 -- (-234.306) [-234.695] (-235.563) (-233.246) * (-233.348) (-236.697) (-234.127) [-234.865] -- 0:00:06
Average standard deviation of split frequencies: 0.008413
885500 -- [-233.805] (-234.062) (-235.958) (-235.575) * [-234.760] (-234.920) (-235.817) (-233.364) -- 0:00:06
886000 -- (-234.637) (-235.644) (-236.675) [-239.711] * (-235.266) (-234.799) [-235.344] (-234.215) -- 0:00:06
886500 -- (-233.976) (-237.285) [-234.220] (-240.034) * [-236.197] (-237.846) (-234.669) (-234.147) -- 0:00:06
887000 -- [-234.990] (-233.300) (-234.570) (-237.484) * (-235.975) (-233.457) (-236.637) [-234.204] -- 0:00:06
887500 -- (-237.112) [-235.628] (-235.494) (-237.515) * (-235.885) (-233.426) [-233.663] (-238.335) -- 0:00:06
888000 -- (-234.469) [-237.603] (-234.149) (-236.977) * [-233.787] (-234.526) (-238.188) (-237.960) -- 0:00:06
888500 -- (-235.345) (-237.739) [-235.159] (-235.109) * (-236.187) (-234.739) (-236.818) [-235.659] -- 0:00:06
889000 -- [-236.224] (-235.753) (-234.089) (-235.906) * (-236.180) [-235.836] (-234.450) (-236.658) -- 0:00:06
889500 -- (-236.583) (-237.817) (-238.435) [-237.575] * (-234.180) (-236.750) (-235.052) [-235.368] -- 0:00:06
890000 -- (-235.269) [-234.904] (-235.735) (-236.442) * [-234.285] (-235.766) (-234.718) (-235.452) -- 0:00:06
Average standard deviation of split frequencies: 0.008303
890500 -- (-234.450) (-236.236) [-234.254] (-238.217) * (-233.727) (-234.733) [-236.795] (-238.314) -- 0:00:06
891000 -- [-239.849] (-235.102) (-235.812) (-238.116) * [-235.141] (-235.862) (-236.074) (-239.450) -- 0:00:06
891500 -- (-238.030) (-233.824) [-236.320] (-237.821) * (-235.256) [-236.800] (-236.413) (-238.646) -- 0:00:06
892000 -- (-235.974) [-238.156] (-233.668) (-236.822) * [-235.357] (-235.235) (-233.939) (-235.091) -- 0:00:06
892500 -- [-234.828] (-235.202) (-236.800) (-237.321) * (-235.769) [-237.996] (-236.158) (-234.088) -- 0:00:06
893000 -- [-234.806] (-234.818) (-235.405) (-242.685) * (-235.667) (-236.312) (-235.287) [-235.319] -- 0:00:06
893500 -- (-236.703) [-235.885] (-234.566) (-237.012) * (-237.335) (-233.229) (-237.955) [-235.577] -- 0:00:06
894000 -- (-233.848) (-235.399) (-234.045) [-235.758] * (-238.057) (-233.499) (-235.377) [-235.603] -- 0:00:06
894500 -- (-234.677) [-234.438] (-241.244) (-235.853) * (-234.990) (-236.909) (-235.134) [-236.195] -- 0:00:06
895000 -- (-238.294) [-234.152] (-235.021) (-233.895) * (-237.670) (-234.809) (-234.826) [-234.821] -- 0:00:06
Average standard deviation of split frequencies: 0.007859
895500 -- [-233.277] (-233.479) (-236.003) (-234.276) * [-234.188] (-235.887) (-237.123) (-234.531) -- 0:00:06
896000 -- (-236.623) [-235.109] (-236.501) (-235.581) * (-235.726) [-233.682] (-234.348) (-234.563) -- 0:00:06
896500 -- [-234.555] (-235.442) (-235.491) (-236.596) * (-235.524) (-233.977) (-234.322) [-235.231] -- 0:00:06
897000 -- (-235.363) (-234.422) [-236.522] (-238.435) * [-235.805] (-238.001) (-234.955) (-233.677) -- 0:00:06
897500 -- (-233.541) [-234.765] (-238.826) (-237.781) * (-234.832) [-235.224] (-239.476) (-233.344) -- 0:00:06
898000 -- (-235.231) (-234.987) [-236.662] (-233.503) * (-236.472) (-237.013) (-239.353) [-235.409] -- 0:00:06
898500 -- (-237.334) (-234.404) (-234.122) [-234.916] * [-237.199] (-235.525) (-234.752) (-234.803) -- 0:00:06
899000 -- (-238.662) (-237.329) [-234.621] (-238.063) * [-235.084] (-234.781) (-238.072) (-236.343) -- 0:00:06
899500 -- (-234.989) (-236.363) (-237.509) [-239.278] * (-235.223) (-234.162) [-235.004] (-235.324) -- 0:00:06
900000 -- (-238.146) [-235.164] (-236.262) (-236.620) * (-235.499) (-233.661) [-236.718] (-236.289) -- 0:00:06
Average standard deviation of split frequencies: 0.007786
900500 -- (-235.947) (-234.317) (-235.056) [-236.408] * (-234.363) (-234.763) [-236.778] (-238.077) -- 0:00:05
901000 -- (-233.858) [-236.025] (-234.550) (-235.149) * [-234.170] (-235.568) (-239.347) (-233.895) -- 0:00:05
901500 -- [-234.937] (-236.639) (-235.883) (-241.491) * [-235.705] (-237.117) (-233.996) (-233.846) -- 0:00:05
902000 -- [-234.663] (-234.003) (-234.216) (-238.371) * [-234.091] (-235.813) (-234.687) (-235.869) -- 0:00:05
902500 -- [-234.982] (-234.796) (-238.427) (-236.995) * (-235.212) [-236.740] (-237.368) (-233.943) -- 0:00:05
903000 -- (-242.412) (-236.846) [-234.542] (-235.288) * (-234.471) [-233.986] (-236.128) (-234.405) -- 0:00:05
903500 -- (-240.426) (-236.768) (-234.642) [-236.345] * (-234.043) (-236.077) (-237.966) [-233.673] -- 0:00:05
904000 -- (-233.554) [-234.492] (-234.427) (-234.528) * (-238.142) (-233.710) (-234.977) [-243.697] -- 0:00:05
904500 -- (-235.923) (-236.873) (-234.478) [-235.294] * [-234.667] (-243.251) (-235.370) (-239.654) -- 0:00:05
905000 -- (-237.646) (-236.790) [-233.915] (-235.244) * (-239.365) (-246.171) (-234.089) [-236.730] -- 0:00:05
Average standard deviation of split frequencies: 0.007805
905500 -- (-234.375) [-236.251] (-237.034) (-234.714) * (-236.285) (-242.858) [-235.058] (-235.038) -- 0:00:05
906000 -- [-234.437] (-237.332) (-238.877) (-234.658) * (-233.878) (-240.000) (-234.291) [-234.472] -- 0:00:05
906500 -- [-235.181] (-235.311) (-237.848) (-235.359) * (-235.180) [-233.597] (-237.434) (-235.329) -- 0:00:05
907000 -- [-233.849] (-236.371) (-233.438) (-234.540) * (-235.391) (-235.877) [-235.267] (-234.469) -- 0:00:05
907500 -- (-236.708) (-236.273) [-236.175] (-233.903) * [-234.686] (-235.010) (-235.999) (-233.864) -- 0:00:05
908000 -- (-237.770) (-238.198) (-236.230) [-236.949] * [-233.618] (-236.620) (-234.003) (-234.892) -- 0:00:05
908500 -- (-235.449) (-236.119) (-236.772) [-235.208] * (-235.568) (-236.683) [-235.285] (-233.821) -- 0:00:05
909000 -- (-233.517) (-234.132) [-234.814] (-236.767) * (-233.672) (-234.227) [-233.896] (-236.167) -- 0:00:05
909500 -- [-234.386] (-237.454) (-234.456) (-235.748) * [-233.929] (-234.729) (-233.843) (-237.119) -- 0:00:05
910000 -- [-236.900] (-242.552) (-236.171) (-234.515) * [-233.997] (-238.528) (-234.418) (-235.070) -- 0:00:05
Average standard deviation of split frequencies: 0.007118
910500 -- (-236.657) (-236.698) [-236.009] (-234.728) * (-235.852) (-237.221) (-233.624) [-234.804] -- 0:00:05
911000 -- (-234.515) (-233.803) [-233.151] (-235.009) * (-234.639) [-234.777] (-234.422) (-241.868) -- 0:00:05
911500 -- (-235.723) (-235.216) (-235.397) [-236.694] * (-234.053) (-236.432) (-233.949) [-235.968] -- 0:00:05
912000 -- (-235.861) [-238.308] (-233.852) (-235.664) * (-235.264) [-234.680] (-235.389) (-235.714) -- 0:00:05
912500 -- [-235.056] (-238.975) (-235.694) (-235.303) * (-235.669) (-236.362) (-234.640) [-234.299] -- 0:00:05
913000 -- [-235.895] (-235.730) (-236.186) (-234.811) * [-235.269] (-234.768) (-237.405) (-236.946) -- 0:00:05
913500 -- (-234.763) (-236.918) [-235.361] (-240.804) * (-235.195) [-235.152] (-235.079) (-235.895) -- 0:00:05
914000 -- (-237.695) (-234.803) (-233.540) [-236.452] * (-235.744) (-235.008) [-234.199] (-234.123) -- 0:00:05
914500 -- [-233.158] (-235.799) (-233.217) (-235.833) * (-236.964) (-236.451) (-234.383) [-234.616] -- 0:00:05
915000 -- [-234.123] (-235.896) (-234.685) (-234.624) * (-236.209) (-236.057) (-233.876) [-234.033] -- 0:00:05
Average standard deviation of split frequencies: 0.007655
915500 -- [-236.289] (-233.693) (-237.189) (-235.398) * [-234.776] (-236.065) (-234.146) (-238.513) -- 0:00:05
916000 -- [-234.858] (-234.259) (-234.261) (-236.785) * (-234.347) (-240.940) (-233.102) [-233.621] -- 0:00:05
916500 -- (-234.403) (-233.960) (-233.981) [-233.971] * (-233.684) (-238.260) (-236.208) [-235.509] -- 0:00:05
917000 -- (-236.552) (-233.939) [-235.341] (-238.892) * [-233.562] (-234.060) (-239.446) (-232.900) -- 0:00:04
917500 -- (-236.849) (-234.423) [-234.708] (-236.037) * (-237.153) [-241.649] (-235.647) (-237.603) -- 0:00:04
918000 -- [-236.756] (-233.984) (-234.570) (-237.069) * (-235.011) (-238.089) [-233.657] (-234.435) -- 0:00:04
918500 -- [-236.259] (-239.620) (-235.546) (-237.032) * [-235.553] (-235.214) (-233.574) (-235.133) -- 0:00:04
919000 -- (-239.545) [-234.413] (-237.663) (-239.020) * [-235.012] (-239.158) (-234.064) (-237.490) -- 0:00:04
919500 -- (-235.561) (-234.624) (-240.355) [-234.014] * (-233.256) (-235.710) [-235.089] (-237.600) -- 0:00:04
920000 -- (-236.295) [-234.407] (-233.873) (-234.201) * (-236.401) (-235.896) (-234.883) [-235.776] -- 0:00:04
Average standard deviation of split frequencies: 0.007520
920500 -- (-236.678) [-234.418] (-237.970) (-239.291) * (-234.737) (-236.796) (-233.410) [-235.757] -- 0:00:04
921000 -- (-236.953) (-233.575) [-236.592] (-233.810) * (-236.613) (-235.204) [-235.724] (-234.312) -- 0:00:04
921500 -- (-233.289) [-234.775] (-238.204) (-235.477) * (-236.659) (-236.588) (-233.277) [-233.440] -- 0:00:04
922000 -- (-237.224) [-233.493] (-237.666) (-234.586) * (-236.814) (-235.793) [-235.248] (-234.447) -- 0:00:04
922500 -- [-233.502] (-236.790) (-236.516) (-233.904) * (-239.832) (-236.275) [-234.868] (-233.516) -- 0:00:04
923000 -- (-235.010) [-234.245] (-236.762) (-233.687) * (-237.008) [-234.936] (-239.951) (-237.140) -- 0:00:04
923500 -- (-233.983) [-237.227] (-236.756) (-234.591) * (-235.587) (-234.875) [-233.871] (-246.662) -- 0:00:04
924000 -- (-237.233) (-239.315) (-237.270) [-235.709] * [-234.572] (-241.517) (-235.293) (-235.406) -- 0:00:04
924500 -- (-239.813) (-234.546) (-233.498) [-234.596] * (-235.436) (-236.792) [-234.486] (-235.599) -- 0:00:04
925000 -- (-235.245) (-234.557) [-234.974] (-235.968) * [-235.086] (-234.099) (-234.281) (-238.312) -- 0:00:04
Average standard deviation of split frequencies: 0.007827
925500 -- (-235.064) (-234.831) [-235.978] (-235.838) * (-234.270) [-235.145] (-235.794) (-238.721) -- 0:00:04
926000 -- (-236.681) (-234.600) (-234.773) [-234.826] * [-236.076] (-235.312) (-234.468) (-237.244) -- 0:00:04
926500 -- (-235.669) (-237.471) (-235.070) [-234.131] * (-235.442) [-237.924] (-235.685) (-233.355) -- 0:00:04
927000 -- (-234.233) (-235.530) (-234.230) [-234.692] * [-233.760] (-234.095) (-234.602) (-239.120) -- 0:00:04
927500 -- [-236.472] (-236.880) (-234.204) (-237.731) * (-235.557) (-236.769) (-234.573) [-238.733] -- 0:00:04
928000 -- (-240.257) (-237.177) (-236.403) [-240.020] * (-235.668) (-234.275) [-234.731] (-235.571) -- 0:00:04
928500 -- (-234.284) (-234.842) (-235.102) [-237.542] * [-240.496] (-233.734) (-234.156) (-233.505) -- 0:00:04
929000 -- (-236.277) (-235.236) (-233.213) [-240.050] * (-236.742) (-233.921) (-234.037) [-233.853] -- 0:00:04
929500 -- (-234.911) (-234.199) [-236.066] (-234.871) * (-234.554) [-234.972] (-234.437) (-234.471) -- 0:00:04
930000 -- (-233.939) (-234.934) (-235.097) [-234.682] * (-234.490) [-234.172] (-233.794) (-235.174) -- 0:00:04
Average standard deviation of split frequencies: 0.008104
930500 -- (-236.866) [-235.519] (-235.691) (-235.124) * (-233.882) (-234.331) [-235.282] (-235.689) -- 0:00:04
931000 -- (-236.412) [-236.311] (-235.371) (-236.815) * (-233.514) (-239.680) [-233.275] (-235.431) -- 0:00:04
931500 -- (-233.780) (-239.480) [-233.801] (-237.967) * (-236.923) (-236.106) [-233.215] (-235.148) -- 0:00:04
932000 -- [-234.408] (-234.408) (-237.343) (-238.263) * (-236.008) [-236.529] (-234.176) (-235.510) -- 0:00:04
932500 -- [-235.808] (-233.357) (-235.815) (-239.409) * (-237.745) (-234.457) [-235.303] (-234.374) -- 0:00:04
933000 -- (-235.716) (-234.548) (-236.691) [-237.933] * [-233.351] (-235.699) (-233.583) (-234.957) -- 0:00:04
933500 -- [-237.626] (-233.694) (-235.190) (-235.307) * (-234.383) (-236.921) [-233.106] (-235.316) -- 0:00:03
934000 -- (-238.039) (-233.927) (-236.024) [-234.818] * [-233.020] (-234.887) (-233.317) (-233.518) -- 0:00:03
934500 -- (-236.783) [-234.006] (-235.553) (-234.268) * (-233.696) (-236.016) [-235.543] (-235.624) -- 0:00:03
935000 -- (-236.096) [-235.848] (-235.773) (-233.559) * (-233.478) [-234.415] (-239.165) (-233.794) -- 0:00:03
Average standard deviation of split frequencies: 0.007932
935500 -- (-233.614) (-238.323) [-234.763] (-235.684) * (-237.152) [-234.706] (-234.085) (-233.419) -- 0:00:03
936000 -- [-233.779] (-236.730) (-233.768) (-237.814) * (-235.671) (-236.291) [-241.132] (-233.139) -- 0:00:03
936500 -- (-234.847) (-235.328) (-241.192) [-235.926] * (-235.382) (-236.240) (-240.281) [-233.336] -- 0:00:03
937000 -- (-240.574) [-235.964] (-234.087) (-234.137) * (-235.149) (-234.605) (-235.727) [-237.890] -- 0:00:03
937500 -- (-234.908) (-233.970) [-234.896] (-233.499) * (-236.773) (-234.712) (-235.942) [-236.513] -- 0:00:03
938000 -- (-235.252) (-235.980) (-233.783) [-233.552] * (-235.939) [-234.375] (-238.987) (-236.925) -- 0:00:03
938500 -- (-236.068) [-235.634] (-235.258) (-234.456) * (-234.047) [-237.217] (-243.813) (-237.201) -- 0:00:03
939000 -- (-236.047) (-237.206) [-233.564] (-234.333) * (-235.477) (-237.562) (-238.644) [-233.267] -- 0:00:03
939500 -- (-234.161) [-234.599] (-236.932) (-238.778) * (-235.339) [-234.009] (-238.596) (-235.001) -- 0:00:03
940000 -- (-236.127) (-234.179) (-233.975) [-235.543] * (-237.011) [-233.277] (-234.997) (-233.508) -- 0:00:03
Average standard deviation of split frequencies: 0.007611
940500 -- (-235.361) (-234.212) (-235.293) [-235.459] * [-239.469] (-233.235) (-237.400) (-237.372) -- 0:00:03
941000 -- [-235.287] (-235.400) (-233.820) (-236.952) * [-234.134] (-235.863) (-235.714) (-240.836) -- 0:00:03
941500 -- (-238.330) (-234.779) [-235.777] (-237.491) * (-236.954) [-238.934] (-238.257) (-236.053) -- 0:00:03
942000 -- (-237.999) (-235.192) (-238.695) [-234.110] * [-236.164] (-238.625) (-238.080) (-235.931) -- 0:00:03
942500 -- (-235.577) [-236.404] (-234.284) (-234.532) * [-236.192] (-237.941) (-234.569) (-238.173) -- 0:00:03
943000 -- (-235.085) [-235.311] (-235.996) (-234.810) * (-233.697) [-235.359] (-236.419) (-234.727) -- 0:00:03
943500 -- [-235.498] (-236.685) (-235.542) (-235.465) * (-232.985) [-234.670] (-234.579) (-235.575) -- 0:00:03
944000 -- (-233.646) (-235.518) (-236.588) [-234.193] * (-235.344) (-235.889) (-235.151) [-235.557] -- 0:00:03
944500 -- [-235.512] (-236.867) (-236.733) (-236.757) * (-240.858) [-233.650] (-234.867) (-234.992) -- 0:00:03
945000 -- (-237.651) [-235.274] (-235.996) (-234.172) * (-236.702) [-235.344] (-239.654) (-235.136) -- 0:00:03
Average standard deviation of split frequencies: 0.007568
945500 -- (-233.888) (-236.205) [-235.333] (-234.363) * (-235.830) (-235.103) (-236.198) [-234.673] -- 0:00:03
946000 -- (-233.808) [-233.572] (-235.765) (-234.927) * (-240.466) (-234.459) [-235.654] (-237.059) -- 0:00:03
946500 -- (-234.643) (-235.243) [-233.675] (-235.233) * (-234.206) (-235.728) (-234.382) [-236.127] -- 0:00:03
947000 -- (-235.806) [-233.957] (-241.027) (-236.181) * [-234.937] (-235.663) (-234.182) (-233.571) -- 0:00:03
947500 -- (-234.271) (-236.430) (-240.005) [-238.546] * (-234.378) (-236.233) (-233.437) [-233.460] -- 0:00:03
948000 -- (-235.294) (-235.820) [-234.455] (-238.192) * (-234.262) (-235.176) (-233.168) [-234.096] -- 0:00:03
948500 -- (-235.736) (-237.026) (-236.114) [-234.065] * (-234.453) [-233.893] (-233.374) (-235.818) -- 0:00:03
949000 -- (-237.914) [-236.794] (-236.542) (-234.440) * [-234.016] (-234.241) (-234.227) (-236.966) -- 0:00:03
949500 -- [-236.197] (-236.609) (-238.216) (-234.109) * (-235.172) [-235.112] (-235.705) (-237.658) -- 0:00:03
950000 -- [-233.204] (-236.435) (-237.778) (-233.414) * (-236.278) [-236.514] (-236.023) (-234.922) -- 0:00:03
Average standard deviation of split frequencies: 0.007655
950500 -- (-235.324) (-237.481) [-237.342] (-238.186) * (-236.997) (-233.929) [-236.010] (-236.860) -- 0:00:02
951000 -- [-237.602] (-236.891) (-234.257) (-234.757) * (-234.517) (-235.629) [-233.688] (-235.225) -- 0:00:02
951500 -- (-234.597) [-233.721] (-234.064) (-236.798) * (-233.980) (-234.128) (-234.993) [-236.123] -- 0:00:02
952000 -- (-236.472) [-235.094] (-236.284) (-234.158) * (-234.160) (-233.109) [-234.095] (-234.983) -- 0:00:02
952500 -- (-236.847) (-238.736) [-234.244] (-235.702) * [-237.067] (-233.187) (-238.380) (-236.101) -- 0:00:02
953000 -- (-236.142) (-237.863) (-234.378) [-233.559] * (-235.555) [-233.814] (-234.559) (-234.463) -- 0:00:02
953500 -- (-237.924) [-233.655] (-234.706) (-234.461) * (-235.442) (-235.000) (-235.361) [-237.931] -- 0:00:02
954000 -- [-235.206] (-234.882) (-234.571) (-234.401) * (-235.842) [-234.831] (-233.457) (-235.026) -- 0:00:02
954500 -- (-235.016) (-235.435) (-234.888) [-234.154] * (-233.973) (-235.743) [-235.717] (-234.215) -- 0:00:02
955000 -- (-234.868) [-233.895] (-234.683) (-233.605) * (-235.710) (-235.493) (-242.808) [-237.979] -- 0:00:02
Average standard deviation of split frequencies: 0.008259
955500 -- (-234.871) (-233.959) (-234.957) [-233.700] * (-237.812) [-234.523] (-233.504) (-237.763) -- 0:00:02
956000 -- (-238.455) [-235.969] (-233.320) (-235.160) * (-236.503) [-233.462] (-233.380) (-237.078) -- 0:00:02
956500 -- (-233.953) (-235.011) (-235.221) [-237.547] * (-235.723) (-233.376) (-235.279) [-233.576] -- 0:00:02
957000 -- (-234.624) (-235.415) (-235.503) [-235.703] * (-234.477) (-236.505) (-235.267) [-234.442] -- 0:00:02
957500 -- (-240.274) (-235.464) [-234.311] (-235.124) * [-236.644] (-236.209) (-239.105) (-235.133) -- 0:00:02
958000 -- (-234.761) (-238.781) [-236.499] (-236.651) * (-240.871) [-234.435] (-235.903) (-235.117) -- 0:00:02
958500 -- [-234.611] (-235.442) (-234.846) (-239.275) * [-236.399] (-234.828) (-235.576) (-235.028) -- 0:00:02
959000 -- (-237.769) (-234.991) [-233.714] (-234.245) * [-233.521] (-233.723) (-237.976) (-235.649) -- 0:00:02
959500 -- (-238.114) [-236.184] (-234.516) (-236.073) * (-233.167) (-233.972) (-235.878) [-234.345] -- 0:00:02
960000 -- (-236.425) (-236.016) [-233.674] (-236.336) * (-235.562) [-234.719] (-233.867) (-233.439) -- 0:00:02
Average standard deviation of split frequencies: 0.008495
960500 -- (-237.128) [-235.467] (-233.857) (-239.659) * (-238.291) [-234.237] (-234.624) (-235.996) -- 0:00:02
961000 -- (-235.011) [-236.067] (-234.650) (-238.252) * (-236.595) [-233.312] (-240.171) (-236.256) -- 0:00:02
961500 -- [-235.553] (-234.688) (-236.327) (-237.481) * (-235.528) [-235.721] (-238.577) (-234.190) -- 0:00:02
962000 -- [-234.740] (-235.096) (-236.880) (-234.927) * [-235.194] (-235.469) (-235.959) (-233.930) -- 0:00:02
962500 -- (-237.556) (-234.449) [-233.288] (-236.916) * (-234.774) (-233.514) [-236.653] (-234.452) -- 0:00:02
963000 -- (-234.203) (-241.229) (-239.454) [-234.562] * [-234.237] (-235.606) (-236.887) (-234.883) -- 0:00:02
963500 -- (-234.679) (-235.952) (-235.141) [-237.499] * (-236.570) (-234.574) (-236.757) [-234.887] -- 0:00:02
964000 -- (-236.127) (-235.200) (-236.074) [-237.698] * (-236.196) (-233.700) (-235.521) [-234.114] -- 0:00:02
964500 -- (-236.327) (-235.268) [-234.115] (-234.649) * [-235.583] (-234.303) (-234.462) (-233.609) -- 0:00:02
965000 -- [-235.609] (-237.080) (-233.697) (-237.113) * (-236.371) (-233.716) [-235.015] (-236.415) -- 0:00:02
Average standard deviation of split frequencies: 0.008235
965500 -- (-235.252) [-234.574] (-236.784) (-237.840) * (-242.026) [-234.180] (-234.075) (-236.373) -- 0:00:02
966000 -- [-235.868] (-236.269) (-236.157) (-234.680) * (-233.921) (-238.015) [-234.951] (-236.019) -- 0:00:02
966500 -- (-234.840) (-234.774) [-235.758] (-238.515) * (-234.048) (-237.258) (-235.942) [-237.159] -- 0:00:02
967000 -- (-234.760) (-235.002) (-235.892) [-236.969] * (-233.601) [-238.162] (-235.547) (-238.108) -- 0:00:01
967500 -- (-239.495) [-233.926] (-234.850) (-239.044) * (-235.310) (-234.787) (-235.094) [-233.963] -- 0:00:01
968000 -- (-235.612) (-235.689) [-235.069] (-235.295) * (-233.758) (-234.396) (-235.523) [-238.355] -- 0:00:01
968500 -- (-238.240) (-237.785) (-238.162) [-233.645] * [-234.528] (-235.362) (-234.776) (-236.743) -- 0:00:01
969000 -- [-234.004] (-233.706) (-236.436) (-233.856) * (-236.039) (-234.665) [-235.871] (-235.834) -- 0:00:01
969500 -- [-235.225] (-233.770) (-235.952) (-235.921) * (-234.828) (-234.992) [-236.941] (-236.262) -- 0:00:01
970000 -- [-234.599] (-233.882) (-235.010) (-233.419) * [-234.928] (-240.831) (-235.736) (-237.107) -- 0:00:01
Average standard deviation of split frequencies: 0.008195
970500 -- (-235.271) (-238.789) (-233.881) [-235.094] * (-238.075) [-237.935] (-235.611) (-237.063) -- 0:00:01
971000 -- [-233.496] (-235.817) (-238.215) (-234.427) * (-235.663) (-233.858) [-235.708] (-236.492) -- 0:00:01
971500 -- (-234.232) [-235.583] (-237.144) (-235.672) * [-235.608] (-236.510) (-235.008) (-237.797) -- 0:00:01
972000 -- [-233.528] (-236.424) (-234.608) (-237.895) * (-234.888) [-237.695] (-235.353) (-234.976) -- 0:00:01
972500 -- [-235.190] (-234.938) (-233.515) (-235.892) * (-237.115) [-238.076] (-235.078) (-233.800) -- 0:00:01
973000 -- (-234.868) (-234.187) (-235.320) [-234.650] * (-236.514) (-237.037) [-235.320] (-236.813) -- 0:00:01
973500 -- (-236.190) [-233.901] (-235.386) (-236.159) * (-236.698) (-237.335) [-233.457] (-237.660) -- 0:00:01
974000 -- [-236.760] (-234.681) (-235.195) (-238.527) * (-235.838) [-234.609] (-236.355) (-235.836) -- 0:00:01
974500 -- [-234.360] (-234.203) (-236.968) (-239.675) * (-234.539) [-234.188] (-237.352) (-235.338) -- 0:00:01
975000 -- [-234.255] (-234.748) (-233.000) (-238.380) * (-234.615) (-233.963) [-235.898] (-235.799) -- 0:00:01
Average standard deviation of split frequencies: 0.008090
975500 -- [-234.681] (-236.581) (-234.784) (-243.875) * (-234.959) [-234.730] (-236.198) (-234.927) -- 0:00:01
976000 -- [-235.768] (-235.915) (-233.649) (-236.714) * (-237.764) [-233.546] (-239.194) (-238.274) -- 0:00:01
976500 -- (-236.361) (-237.046) (-234.909) [-236.704] * (-234.653) (-235.351) (-237.157) [-236.819] -- 0:00:01
977000 -- (-236.787) (-233.514) (-237.904) [-234.239] * (-234.861) [-235.003] (-237.176) (-234.950) -- 0:00:01
977500 -- [-234.965] (-234.637) (-238.298) (-233.707) * (-236.479) (-235.176) (-234.861) [-236.673] -- 0:00:01
978000 -- [-235.346] (-236.957) (-235.713) (-236.469) * (-237.009) (-234.115) [-233.698] (-237.412) -- 0:00:01
978500 -- (-234.216) (-235.500) [-236.445] (-236.206) * (-235.138) (-239.830) [-234.236] (-235.884) -- 0:00:01
979000 -- (-234.513) (-240.335) (-234.952) [-237.624] * (-236.802) (-235.882) [-238.515] (-233.366) -- 0:00:01
979500 -- (-234.661) (-236.218) (-241.861) [-233.968] * (-233.661) (-245.427) (-237.493) [-234.465] -- 0:00:01
980000 -- (-239.423) (-234.233) (-241.669) [-233.914] * [-235.259] (-238.094) (-234.578) (-235.614) -- 0:00:01
Average standard deviation of split frequencies: 0.008172
980500 -- (-233.751) [-238.062] (-236.416) (-235.821) * (-235.208) (-236.086) (-235.658) [-234.650] -- 0:00:01
981000 -- (-235.428) [-236.910] (-237.986) (-237.222) * (-239.639) (-236.969) [-235.294] (-235.577) -- 0:00:01
981500 -- [-239.699] (-235.412) (-236.737) (-237.821) * [-236.908] (-235.597) (-236.389) (-234.348) -- 0:00:01
982000 -- (-234.601) (-233.824) (-234.831) [-234.258] * (-234.807) (-235.754) (-238.857) [-235.651] -- 0:00:01
982500 -- (-236.209) [-235.399] (-233.902) (-233.894) * (-234.760) [-235.342] (-233.995) (-234.416) -- 0:00:01
983000 -- (-235.748) [-232.883] (-234.949) (-235.310) * (-236.417) (-234.045) (-233.742) [-234.541] -- 0:00:01
983500 -- (-235.325) (-233.753) (-233.895) [-235.351] * (-235.291) (-234.141) [-234.582] (-239.727) -- 0:00:00
984000 -- (-233.591) [-234.573] (-234.926) (-235.275) * (-233.986) [-237.724] (-235.466) (-237.596) -- 0:00:00
984500 -- (-236.145) [-235.949] (-234.841) (-240.481) * [-235.726] (-238.674) (-235.027) (-237.084) -- 0:00:00
985000 -- (-236.838) [-234.886] (-235.381) (-233.411) * (-237.639) (-236.510) (-233.736) [-234.704] -- 0:00:00
Average standard deviation of split frequencies: 0.008068
985500 -- (-233.842) (-234.913) [-233.653] (-234.759) * [-234.548] (-233.709) (-238.519) (-234.059) -- 0:00:00
986000 -- (-233.857) (-240.228) (-235.633) [-234.208] * (-238.357) (-237.499) [-235.060] (-234.621) -- 0:00:00
986500 -- (-236.661) (-235.434) (-234.970) [-234.029] * (-234.522) (-236.618) (-235.810) [-237.557] -- 0:00:00
987000 -- (-237.327) [-239.270] (-236.218) (-234.554) * (-238.329) [-235.007] (-236.309) (-236.207) -- 0:00:00
987500 -- [-235.050] (-238.282) (-234.825) (-235.962) * (-237.015) [-237.568] (-234.574) (-238.600) -- 0:00:00
988000 -- (-235.490) [-236.187] (-235.748) (-237.570) * (-237.969) [-234.873] (-236.295) (-236.982) -- 0:00:00
988500 -- (-234.183) (-235.235) (-234.739) [-238.022] * (-237.825) (-238.149) (-237.121) [-234.338] -- 0:00:00
989000 -- (-235.053) (-237.579) [-235.897] (-233.986) * [-234.838] (-238.981) (-234.867) (-234.558) -- 0:00:00
989500 -- (-238.750) [-236.250] (-236.113) (-238.696) * [-234.972] (-241.439) (-234.252) (-236.606) -- 0:00:00
990000 -- (-235.337) (-234.136) (-235.181) [-235.464] * [-238.100] (-234.327) (-234.363) (-237.892) -- 0:00:00
Average standard deviation of split frequencies: 0.008179
990500 -- (-234.275) (-234.186) (-236.428) [-236.300] * (-234.873) [-233.608] (-240.592) (-237.367) -- 0:00:00
991000 -- [-238.946] (-233.764) (-233.423) (-233.565) * [-243.385] (-233.394) (-236.619) (-235.437) -- 0:00:00
991500 -- (-236.354) (-235.434) (-235.188) [-234.090] * [-235.836] (-235.049) (-236.020) (-236.445) -- 0:00:00
992000 -- (-235.360) [-235.556] (-233.256) (-235.572) * [-235.931] (-235.687) (-236.397) (-234.017) -- 0:00:00
992500 -- (-237.458) (-234.756) [-235.171] (-236.330) * [-238.566] (-235.480) (-233.938) (-234.317) -- 0:00:00
993000 -- [-234.276] (-237.983) (-235.865) (-234.839) * [-234.662] (-235.648) (-236.751) (-235.188) -- 0:00:00
993500 -- (-234.063) [-234.884] (-240.274) (-235.156) * [-235.934] (-233.809) (-235.670) (-233.988) -- 0:00:00
994000 -- (-234.779) (-234.868) [-233.352] (-234.324) * (-233.987) (-235.679) (-235.275) [-234.181] -- 0:00:00
994500 -- (-234.908) [-235.705] (-237.182) (-234.353) * [-233.491] (-235.135) (-235.620) (-234.760) -- 0:00:00
995000 -- (-237.305) (-234.784) (-237.425) [-234.350] * (-233.941) (-237.443) (-238.498) [-235.440] -- 0:00:00
Average standard deviation of split frequencies: 0.007898
995500 -- (-235.930) [-234.063] (-235.938) (-237.285) * [-234.266] (-234.157) (-236.346) (-235.420) -- 0:00:00
996000 -- (-236.153) [-235.749] (-234.864) (-236.539) * (-235.465) (-234.233) [-235.505] (-237.862) -- 0:00:00
996500 -- [-236.239] (-234.184) (-235.283) (-236.246) * (-240.133) (-236.881) (-234.041) [-235.619] -- 0:00:00
997000 -- (-234.954) [-233.181] (-233.922) (-235.778) * (-238.668) (-236.016) (-234.416) [-237.887] -- 0:00:00
997500 -- (-235.321) (-235.162) [-235.340] (-236.422) * (-235.637) (-233.952) (-234.369) [-233.975] -- 0:00:00
998000 -- [-234.453] (-235.837) (-237.086) (-235.376) * (-235.896) (-238.117) [-235.477] (-233.539) -- 0:00:00
998500 -- [-235.220] (-234.343) (-238.616) (-236.381) * (-234.215) (-234.959) (-234.274) [-234.923] -- 0:00:00
999000 -- (-238.361) [-236.516] (-234.355) (-237.346) * (-233.995) (-234.414) (-237.485) [-235.649] -- 0:00:00
999500 -- (-237.615) [-235.835] (-238.337) (-234.886) * (-234.785) (-234.422) (-235.787) [-234.201] -- 0:00:00
1000000 -- (-239.073) (-233.937) [-234.276] (-236.984) * (-239.060) [-235.166] (-236.037) (-233.824) -- 0:00:00
Average standard deviation of split frequencies: 0.008185
Analysis completed in 60 seconds
Analysis used 57.97 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -232.88
Likelihood of best state for "cold" chain of run 2 was -232.88
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
49.9 % ( 33 %) Dirichlet(Pi{all})
45.9 % ( 32 %) Slider(Pi{all})
78.5 % ( 44 %) Multiplier(Alpha{1,2})
78.0 % ( 52 %) Multiplier(Alpha{3})
27.6 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 19 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.3 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
50.4 % ( 45 %) Dirichlet(Pi{all})
46.1 % ( 34 %) Slider(Pi{all})
78.4 % ( 50 %) Multiplier(Alpha{1,2})
77.5 % ( 54 %) Multiplier(Alpha{3})
28.3 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 90 %) ParsSPR(Tau{all},V{all})
28.3 % ( 28 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.1 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167106 0.82 0.67
3 | 165998 167470 0.84
4 | 166897 165901 166628
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166279 0.82 0.66
3 | 166964 166928 0.84
4 | 166841 166396 166592
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -234.65
| 1 |
| 2 2 2 |
| 1 2 1 1 * 11 |
| 2 * *2 2 1 1 * 2 1 21 22112 12 |
| * 2 2 2 * 1 1 2 2 |
|2 2 1111 * 1 2 * 2 2 21 2 21|
| *11 * 1 2 1 211 * 2 2 1 2 12 1 |
| 21 22 1 1 11 2 2 2 2|
|11 2 2 2 1 2 1 1 1 |
| 1 2 2 2 1 |
| 2 2 1 |
| 1 |
| 1 |
| 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -236.64
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -234.64 -238.51
2 -234.63 -238.64
--------------------------------------
TOTAL -234.64 -238.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890759 0.093035 0.373417 1.515343 0.855872 1501.00 1501.00 1.000
r(A<->C){all} 0.163547 0.021189 0.000030 0.477694 0.120179 139.96 175.00 1.003
r(A<->G){all} 0.169576 0.022093 0.000038 0.473322 0.127536 213.96 215.36 1.000
r(A<->T){all} 0.171954 0.020561 0.000073 0.464065 0.133910 166.40 218.23 1.000
r(C<->G){all} 0.160595 0.019227 0.000011 0.443425 0.123870 291.16 396.32 1.001
r(C<->T){all} 0.171234 0.020441 0.000216 0.458397 0.135919 300.04 311.01 1.000
r(G<->T){all} 0.163093 0.018908 0.000037 0.440438 0.127398 202.54 217.82 1.000
pi(A){all} 0.136184 0.000695 0.087296 0.188564 0.135216 1316.51 1394.38 1.001
pi(C){all} 0.280537 0.001168 0.216484 0.347255 0.280108 976.58 1082.87 1.000
pi(G){all} 0.331519 0.001300 0.259578 0.398590 0.330319 1192.81 1279.22 1.000
pi(T){all} 0.251760 0.001055 0.191203 0.318041 0.252001 779.19 1054.80 1.000
alpha{1,2} 0.407429 0.234626 0.000111 1.363863 0.237115 1285.23 1315.56 1.000
alpha{3} 0.449963 0.225913 0.000185 1.421668 0.287054 1247.09 1374.05 1.000
pinvar{all} 0.990120 0.000142 0.968609 0.999994 0.993812 1081.51 1162.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .****.
9 -- ..**..
10 -- ...**.
11 -- ...*.*
12 -- .*.*..
13 -- ..****
14 -- ..*..*
15 -- .**...
16 -- .***.*
17 -- .*.***
18 -- .*...*
19 -- ..*.*.
20 -- .**.**
21 -- ....**
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 497 0.165556 0.000471 0.165223 0.165889 2
8 453 0.150899 0.003298 0.148568 0.153231 2
9 443 0.147568 0.010835 0.139907 0.155230 2
10 443 0.147568 0.006124 0.143238 0.151899 2
11 431 0.143571 0.007066 0.138574 0.148568 2
12 430 0.143238 0.007537 0.137908 0.148568 2
13 430 0.143238 0.016959 0.131246 0.155230 2
14 429 0.142905 0.014604 0.132578 0.153231 2
15 426 0.141905 0.004711 0.138574 0.145237 2
16 421 0.140240 0.013662 0.130580 0.149900 2
17 412 0.137242 0.004711 0.133911 0.140573 2
18 409 0.136243 0.000471 0.135909 0.136576 2
19 401 0.133578 0.004240 0.130580 0.136576 2
20 396 0.131912 0.003769 0.129247 0.134577 2
21 393 0.130913 0.016488 0.119254 0.142572 2
22 302 0.100600 0.016017 0.089274 0.111925 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097016 0.009248 0.000042 0.288024 0.067298 1.000 2
length{all}[2] 0.097475 0.009334 0.000116 0.293745 0.066380 1.001 2
length{all}[3] 0.101468 0.010057 0.000015 0.300563 0.069787 1.000 2
length{all}[4] 0.098051 0.009613 0.000000 0.299235 0.067187 1.000 2
length{all}[5] 0.100525 0.009797 0.000074 0.303704 0.072162 1.000 2
length{all}[6] 0.098531 0.009547 0.000002 0.292134 0.068363 1.000 2
length{all}[7] 0.092405 0.007563 0.000147 0.278331 0.068396 0.998 2
length{all}[8] 0.106923 0.011310 0.000258 0.321372 0.076486 1.010 2
length{all}[9] 0.097121 0.008553 0.001149 0.291034 0.071453 0.998 2
length{all}[10] 0.097665 0.008381 0.000166 0.284064 0.070450 0.998 2
length{all}[11] 0.095927 0.010064 0.000176 0.281814 0.061469 0.998 2
length{all}[12] 0.099988 0.009886 0.000156 0.312826 0.070300 1.002 2
length{all}[13] 0.101950 0.009572 0.000152 0.307501 0.072662 1.001 2
length{all}[14] 0.106141 0.012222 0.000022 0.324001 0.068220 1.008 2
length{all}[15] 0.097784 0.011041 0.000084 0.292041 0.067043 1.005 2
length{all}[16] 0.099304 0.012506 0.000051 0.332336 0.062590 0.998 2
length{all}[17] 0.102713 0.011321 0.000158 0.285815 0.070646 0.998 2
length{all}[18] 0.099413 0.009064 0.000182 0.282176 0.072587 1.018 2
length{all}[19] 0.101135 0.009239 0.000502 0.303390 0.078578 0.998 2
length{all}[20] 0.100308 0.010926 0.000023 0.301881 0.064061 0.998 2
length{all}[21] 0.102955 0.009834 0.000793 0.301627 0.071741 0.998 2
length{all}[22] 0.096873 0.009267 0.000316 0.279737 0.074019 1.011 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008185
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.002
Maximum PSRF for parameter values = 1.018
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 174
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 35 patterns at 58 / 58 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 35 patterns at 58 / 58 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
34160 bytes for conP
3080 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.071499 0.090990 0.108625 0.050221 0.062209 0.067630 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -254.960575
Iterating by ming2
Initial: fx= 254.960575
x= 0.07150 0.09099 0.10863 0.05022 0.06221 0.06763 0.30000 1.30000
1 h-m-p 0.0000 0.0009 138.6297 ++++ 237.908147 m 0.0009 15 | 1/8
2 h-m-p 0.0048 0.0241 17.1247 ------------.. | 1/8
3 h-m-p 0.0000 0.0002 127.5509 +++ 234.466143 m 0.0002 48 | 2/8
4 h-m-p 0.0018 0.0468 13.0260 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 114.2337 ++ 233.217349 m 0.0001 80 | 3/8
6 h-m-p 0.0009 0.0652 10.9246 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 98.9244 ++ 232.548519 m 0.0001 111 | 4/8
8 h-m-p 0.0006 0.0845 8.8197 -----------.. | 4/8
9 h-m-p 0.0000 0.0003 80.6923 +++ 230.295940 m 0.0003 143 | 5/8
10 h-m-p 0.0032 0.1345 6.1580 ------------.. | 5/8
11 h-m-p 0.0000 0.0003 57.1644 +++ 229.270030 m 0.0003 176 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 229.270030 m 8.0000 187 | 6/8
13 h-m-p 0.3808 8.0000 0.0000 --------C 229.270030 0 0.0000 208
Out..
lnL = -229.270030
209 lfun, 209 eigenQcodon, 1254 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056792 0.095938 0.060410 0.079837 0.093336 0.016672 0.299866 0.698002 0.370416
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.767697
np = 9
lnL0 = -251.752810
Iterating by ming2
Initial: fx= 251.752810
x= 0.05679 0.09594 0.06041 0.07984 0.09334 0.01667 0.29987 0.69800 0.37042
1 h-m-p 0.0000 0.0003 133.6224 +++ 246.324085 m 0.0003 15 | 1/9
2 h-m-p 0.0004 0.0022 84.8989 ++ 235.089273 m 0.0022 27 | 2/9
3 h-m-p 0.0000 0.0000 2071.3647 ++ 234.302056 m 0.0000 39 | 3/9
4 h-m-p 0.0001 0.0017 103.4689 ++ 230.689025 m 0.0017 51 | 4/9
5 h-m-p 0.0000 0.0000 30856.2107 ++ 230.325469 m 0.0000 63 | 5/9
6 h-m-p 0.0017 0.1270 3.1949 ------------.. | 5/9
7 h-m-p 0.0000 0.0001 79.9569 ++ 229.392284 m 0.0001 97 | 6/9
8 h-m-p 0.0040 0.2211 2.0283 ------------.. | 6/9
9 h-m-p 0.0000 0.0000 57.0466 ++ 229.270025 m 0.0000 131 | 7/9
10 h-m-p 0.0901 8.0000 0.0000 --C 229.270025 0 0.0014 145 | 7/9
11 h-m-p 0.0508 8.0000 0.0000 ----Y 229.270025 0 0.0000 163
Out..
lnL = -229.270025
164 lfun, 492 eigenQcodon, 1968 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.083796 0.108119 0.097325 0.052115 0.077045 0.054495 0.257463 1.048022 0.431851 0.189237 1.510898
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.922095
np = 11
lnL0 = -254.575464
Iterating by ming2
Initial: fx= 254.575464
x= 0.08380 0.10812 0.09732 0.05212 0.07705 0.05449 0.25746 1.04802 0.43185 0.18924 1.51090
1 h-m-p 0.0000 0.0010 122.7959 ++++ 238.319860 m 0.0010 18 | 1/11
2 h-m-p 0.0001 0.0003 52.4706 ++ 237.647314 m 0.0003 32 | 2/11
3 h-m-p 0.0000 0.0000 224902.1835 ++ 232.570063 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0001 764.0142 ++ 231.836322 m 0.0001 60 | 4/11
5 h-m-p 0.0043 0.0519 3.0651 ------------.. | 4/11
6 h-m-p 0.0000 0.0000 96.7360 ++ 231.408421 m 0.0000 98 | 5/11
7 h-m-p 0.0016 0.2001 2.2916 -----------.. | 5/11
8 h-m-p 0.0000 0.0002 79.1563 +++ 229.886626 m 0.0002 136 | 6/11
9 h-m-p 0.0082 0.2495 1.6364 -------------.. | 6/11
10 h-m-p 0.0000 0.0002 56.7632 +++ 229.270027 m 0.0002 176 | 7/11
11 h-m-p 0.4018 8.0000 0.0000 +++ 229.270027 m 8.0000 191 | 7/11
12 h-m-p 0.0160 8.0000 0.0080 -------------.. | 7/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 229.270027 m 8.0000 241 | 7/11
14 h-m-p 0.0160 8.0000 3.2826 -----------C 229.270027 0 0.0000 270 | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 229.270027 m 8.0000 287 | 7/11
16 h-m-p 0.0016 0.8094 0.5663 +++++ 229.270023 m 0.8094 308 | 8/11
17 h-m-p 0.4603 8.0000 0.8499 --------------C 229.270023 0 0.0000 340 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 229.270023 m 8.0000 360 | 8/11
19 h-m-p 0.0160 8.0000 2.4473 -------------.. | 8/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 229.270023 m 8.0000 405 | 8/11
21 h-m-p 0.0160 8.0000 0.0176 -------------.. | 8/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 229.270023 m 8.0000 453 | 8/11
23 h-m-p 0.0160 8.0000 0.2782 ----------N 229.270023 0 0.0000 480 | 8/11
24 h-m-p 0.0160 8.0000 0.0002 +++++ 229.270023 m 8.0000 500 | 8/11
25 h-m-p 0.0160 8.0000 2.6919 -------------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0000 +++++ 229.270023 m 8.0000 545 | 8/11
27 h-m-p 0.0160 8.0000 0.0078 +++++ 229.270023 m 8.0000 565 | 8/11
28 h-m-p 0.0233 8.0000 2.6978 ------------N 229.270023 0 0.0000 594 | 8/11
29 h-m-p 0.0160 8.0000 0.0000 +++++ 229.270023 m 8.0000 611 | 8/11
30 h-m-p 0.0160 8.0000 3.2699 -----------Y 229.270023 0 0.0000 639 | 8/11
31 h-m-p 0.0160 8.0000 0.0000 +++++ 229.270023 m 8.0000 656 | 8/11
32 h-m-p 0.0024 1.2078 4.3166 +++++ 229.270011 m 1.2078 676 | 8/11
33 h-m-p -0.0000 -0.0000 0.1363
h-m-p: -0.00000000e+00 -0.00000000e+00 1.36275540e-01 229.270011
.. | 9/11
34 h-m-p 0.0160 8.0000 0.0000 +Y 229.270011 0 0.0640 705 | 9/11
35 h-m-p 0.0160 8.0000 0.0000 -----------Y 229.270011 0 0.0000 732
Out..
lnL = -229.270011
733 lfun, 2932 eigenQcodon, 13194 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -229.278082 S = -229.270166 -0.003027
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 35 patterns 0:04
did 20 / 35 patterns 0:04
did 30 / 35 patterns 0:05
did 35 / 35 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.091883 0.101852 0.046479 0.102119 0.045517 0.045415 0.000100 0.839063 1.414637
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.295779
np = 9
lnL0 = -253.031735
Iterating by ming2
Initial: fx= 253.031735
x= 0.09188 0.10185 0.04648 0.10212 0.04552 0.04541 0.00011 0.83906 1.41464
1 h-m-p 0.0000 0.0000 129.6367 ++ 252.910356 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0574 14.5555 ----------.. | 1/9
3 h-m-p 0.0000 0.0008 129.6852 ++++ 238.403199 m 0.0008 48 | 2/9
4 h-m-p 0.0093 0.0787 10.6794 -------------.. | 2/9
5 h-m-p 0.0000 0.0000 123.7262 ++ 238.374751 m 0.0000 83 | 3/9
6 h-m-p 0.0003 0.1318 6.5996 ----------.. | 3/9
7 h-m-p 0.0000 0.0000 110.3798 ++ 238.161847 m 0.0000 115 | 4/9
8 h-m-p 0.0003 0.1378 6.3346 ----------.. | 4/9
9 h-m-p 0.0000 0.0008 95.2486 ++++ 230.453772 m 0.0008 149 | 5/9
10 h-m-p 0.0156 0.2294 4.1660 -------------.. | 5/9
11 h-m-p 0.0000 0.0002 80.1632 +++ 229.285727 m 0.0002 185 | 6/9
12 h-m-p 0.0050 0.8368 2.0664 ------------.. | 6/9
13 h-m-p 0.0000 0.0000 57.0111 ++ 229.270022 m 0.0000 219 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 N 229.270022 0 0.0040 231 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 ---------N 229.270022 0 0.0000 254
Out..
lnL = -229.270022
255 lfun, 2805 eigenQcodon, 15300 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069319 0.018381 0.105862 0.021159 0.069623 0.103443 0.000100 0.900000 0.618581 1.946392 1.299965
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.820722
np = 11
lnL0 = -250.040115
Iterating by ming2
Initial: fx= 250.040115
x= 0.06932 0.01838 0.10586 0.02116 0.06962 0.10344 0.00011 0.90000 0.61858 1.94639 1.29996
1 h-m-p 0.0000 0.0000 124.5792 ++ 249.936272 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0015 69.9810 ++++ 244.266527 m 0.0015 32 | 2/11
3 h-m-p 0.0000 0.0002 53.6186 ++ 243.476275 m 0.0002 46 | 3/11
4 h-m-p 0.0003 0.0194 29.7575 ++++ 234.005214 m 0.0194 62 | 4/11
5 h-m-p 0.0000 0.0000 1014.5773 ++ 233.954918 m 0.0000 76 | 5/11
6 h-m-p 0.0000 0.0011 254.9451 ++++ 232.627403 m 0.0011 92 | 6/11
7 h-m-p 0.0034 0.0170 57.6232 ------------.. | 6/11
8 h-m-p 0.0000 0.0005 75.9493 +++ 229.447525 m 0.0005 131 | 7/11
9 h-m-p 0.0069 0.0782 4.1702 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 56.9257 ++ 229.270026 m 0.0001 170 | 8/11
11 h-m-p 0.1222 8.0000 0.0000 ++++ 229.270026 m 8.0000 186 | 8/11
12 h-m-p 0.0423 8.0000 0.0003 ++++ 229.270026 m 8.0000 205 | 8/11
13 h-m-p 0.0111 5.5478 0.6267 ---------C 229.270026 0 0.0000 231 | 8/11
14 h-m-p 0.0160 8.0000 0.0001 ----C 229.270026 0 0.0000 252 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 229.270026 m 8.0000 272 | 8/11
16 h-m-p 0.0137 6.8383 0.1376 +++++ 229.270023 m 6.8383 292 | 9/11
17 h-m-p 0.2243 1.5128 0.3969 ------------Y 229.270023 0 0.0000 321 | 9/11
18 h-m-p 0.0003 0.1733 2.4175 +++++ 229.270011 m 0.1733 340 | 10/11
19 h-m-p 1.6000 8.0000 0.0000 N 229.270011 0 1.6000 354 | 10/11
20 h-m-p 0.0160 8.0000 0.0000 Y 229.270011 0 0.0160 369
Out..
lnL = -229.270011
370 lfun, 4440 eigenQcodon, 24420 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -229.280556 S = -229.270174 -0.004555
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 35 patterns 0:14
did 20 / 35 patterns 0:15
did 30 / 35 patterns 0:15
did 35 / 35 patterns 0:15
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=58
NC_011896_1_WP_010907774_1_542_MLBR_RS02575 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
NC_002677_1_NP_301450_1_322_ML0525 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV
**************************************************
NC_011896_1_WP_010907774_1_542_MLBR_RS02575 LDVPQPAP
NC_002677_1_NP_301450_1_322_ML0525 LDVPQPAP
NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495 LDVPQPAP
NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900 LDVPQPAP
NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840 LDVPQPAP
NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930 LDVPQPAP
********
>NC_011896_1_WP_010907774_1_542_MLBR_RS02575 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC TTGGATGTCCCGCAGCCTGCCCCC >NC_002677_1_NP_301450_1_322_ML0525 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC TTGGATGTCCCGCAGCCTGCCCCC >NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC TTGGATGTCCCGCAGCCTGCCCCC >NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC TTGGATGTCCCGCAGCCTGCCCCC >NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC TTGGATGTCCCGCAGCCTGCCCCC >NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930 GTGATTTGGTCTCCTGTCTCAAAGCGATGTTCTGGAAGGGTGCGTAACAT CGCGCAGCCAGGCGGCCATTCGGTCGGTGTGATGATTTCTGGCCTTGCAC GAAGCCCGCTTCGTCCAGGTGGGGTTGTCGAGGTCGACGGGTTGCCCGTC TTGGATGTCCCGCAGCCTGCCCCC
>NC_011896_1_WP_010907774_1_542_MLBR_RS02575 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV LDVPQPAP >NC_002677_1_NP_301450_1_322_ML0525 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV LDVPQPAP >NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV LDVPQPAP >NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV LDVPQPAP >NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV LDVPQPAP >NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930 VIWSPVSKRCSGRVRNIAQPGGHSVGVMISGLARSPLRPGGVVEVDGLPV LDVPQPAP
#NEXUS
[ID: 1247554456]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907774_1_542_MLBR_RS02575
NC_002677_1_NP_301450_1_322_ML0525
NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495
NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900
NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840
NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907774_1_542_MLBR_RS02575,
2 NC_002677_1_NP_301450_1_322_ML0525,
3 NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495,
4 NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900,
5 NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840,
6 NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06729759,2:0.06638017,3:0.06978686,4:0.06718726,5:0.07216214,6:0.06836316);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06729759,2:0.06638017,3:0.06978686,4:0.06718726,5:0.07216214,6:0.06836316);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -234.64 -238.51
2 -234.63 -238.64
--------------------------------------
TOTAL -234.64 -238.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890759 0.093035 0.373417 1.515343 0.855872 1501.00 1501.00 1.000
r(A<->C){all} 0.163547 0.021189 0.000030 0.477694 0.120179 139.96 175.00 1.003
r(A<->G){all} 0.169576 0.022093 0.000038 0.473322 0.127536 213.96 215.36 1.000
r(A<->T){all} 0.171954 0.020561 0.000073 0.464065 0.133910 166.40 218.23 1.000
r(C<->G){all} 0.160595 0.019227 0.000011 0.443425 0.123870 291.16 396.32 1.001
r(C<->T){all} 0.171234 0.020441 0.000216 0.458397 0.135919 300.04 311.01 1.000
r(G<->T){all} 0.163093 0.018908 0.000037 0.440438 0.127398 202.54 217.82 1.000
pi(A){all} 0.136184 0.000695 0.087296 0.188564 0.135216 1316.51 1394.38 1.001
pi(C){all} 0.280537 0.001168 0.216484 0.347255 0.280108 976.58 1082.87 1.000
pi(G){all} 0.331519 0.001300 0.259578 0.398590 0.330319 1192.81 1279.22 1.000
pi(T){all} 0.251760 0.001055 0.191203 0.318041 0.252001 779.19 1054.80 1.000
alpha{1,2} 0.407429 0.234626 0.000111 1.363863 0.237115 1285.23 1315.56 1.000
alpha{3} 0.449963 0.225913 0.000185 1.421668 0.287054 1247.09 1374.05 1.000
pinvar{all} 0.990120 0.000142 0.968609 0.999994 0.993812 1081.51 1162.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0525/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 58
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 0 0 0 0 0 0 | CCC 2 2 2 2 2 2 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 0 0 0 0 0 0 | CGA 2 2 2 2 2 2
CTG 0 0 0 0 0 0 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 1 1 1 1 1 1 | ACC 0 0 0 0 0 0 | AAC 1 1 1 1 1 1 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 0 0 0 0 0 0 | Asp GAT 1 1 1 1 1 1 | Gly GGT 2 2 2 2 2 2
GTC 6 6 6 6 6 6 | GCC 1 1 1 1 1 1 | GAC 1 1 1 1 1 1 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 3 | GCG 1 1 1 1 1 1 | GAG 1 1 1 1 1 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907774_1_542_MLBR_RS02575
position 1: T:0.15517 C:0.29310 A:0.13793 G:0.41379
position 2: T:0.31034 C:0.27586 A:0.13793 G:0.27586
position 3: T:0.29310 C:0.27586 A:0.12069 G:0.31034
Average T:0.25287 C:0.28161 A:0.13218 G:0.33333
#2: NC_002677_1_NP_301450_1_322_ML0525
position 1: T:0.15517 C:0.29310 A:0.13793 G:0.41379
position 2: T:0.31034 C:0.27586 A:0.13793 G:0.27586
position 3: T:0.29310 C:0.27586 A:0.12069 G:0.31034
Average T:0.25287 C:0.28161 A:0.13218 G:0.33333
#3: NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495
position 1: T:0.15517 C:0.29310 A:0.13793 G:0.41379
position 2: T:0.31034 C:0.27586 A:0.13793 G:0.27586
position 3: T:0.29310 C:0.27586 A:0.12069 G:0.31034
Average T:0.25287 C:0.28161 A:0.13218 G:0.33333
#4: NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900
position 1: T:0.15517 C:0.29310 A:0.13793 G:0.41379
position 2: T:0.31034 C:0.27586 A:0.13793 G:0.27586
position 3: T:0.29310 C:0.27586 A:0.12069 G:0.31034
Average T:0.25287 C:0.28161 A:0.13218 G:0.33333
#5: NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840
position 1: T:0.15517 C:0.29310 A:0.13793 G:0.41379
position 2: T:0.31034 C:0.27586 A:0.13793 G:0.27586
position 3: T:0.29310 C:0.27586 A:0.12069 G:0.31034
Average T:0.25287 C:0.28161 A:0.13218 G:0.33333
#6: NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930
position 1: T:0.15517 C:0.29310 A:0.13793 G:0.41379
position 2: T:0.31034 C:0.27586 A:0.13793 G:0.27586
position 3: T:0.29310 C:0.27586 A:0.12069 G:0.31034
Average T:0.25287 C:0.28161 A:0.13218 G:0.33333
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 18 | Tyr Y TAT 0 | Cys C TGT 6
TTC 0 | TCC 0 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 12
CTC 0 | CCC 12 | CAC 0 | CGC 0
CTA 0 | CCA 12 | Gln Q CAA 0 | CGA 12
CTG 0 | CCG 12 | CAG 12 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 0
ATC 6 | ACC 0 | AAC 6 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 6 | ACG 0 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 0 | Asp D GAT 6 | Gly G GGT 12
GTC 36 | GCC 6 | GAC 6 | GGC 18
GTA 0 | GCA 6 | Glu E GAA 0 | GGA 6
GTG 18 | GCG 6 | GAG 6 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15517 C:0.29310 A:0.13793 G:0.41379
position 2: T:0.31034 C:0.27586 A:0.13793 G:0.27586
position 3: T:0.29310 C:0.27586 A:0.12069 G:0.31034
Average T:0.25287 C:0.28161 A:0.13218 G:0.33333
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -229.270030 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299866 1.299965
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907774_1_542_MLBR_RS02575: 0.000004, NC_002677_1_NP_301450_1_322_ML0525: 0.000004, NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495: 0.000004, NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900: 0.000004, NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840: 0.000004, NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29987
omega (dN/dS) = 1.29996
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 120.6 53.4 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 120.6 53.4 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 120.6 53.4 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 120.6 53.4 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 120.6 53.4 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 120.6 53.4 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -229.270025 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.257463 0.664866 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907774_1_542_MLBR_RS02575: 0.000004, NC_002677_1_NP_301450_1_322_ML0525: 0.000004, NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495: 0.000004, NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900: 0.000004, NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840: 0.000004, NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.25746
MLEs of dN/dS (w) for site classes (K=2)
p: 0.66487 0.33513
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 120.8 53.2 0.3351 0.0000 0.0000 0.0 0.0
7..2 0.000 120.8 53.2 0.3351 0.0000 0.0000 0.0 0.0
7..3 0.000 120.8 53.2 0.3351 0.0000 0.0000 0.0 0.0
7..4 0.000 120.8 53.2 0.3351 0.0000 0.0000 0.0 0.0
7..5 0.000 120.8 53.2 0.3351 0.0000 0.0000 0.0 0.0
7..6 0.000 120.8 53.2 0.3351 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -229.270011 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.997925 0.000458 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907774_1_542_MLBR_RS02575: 0.000004, NC_002677_1_NP_301450_1_322_ML0525: 0.000004, NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495: 0.000004, NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900: 0.000004, NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840: 0.000004, NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99793 0.00046 0.00162
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 122.1 51.9 0.0021 0.0000 0.0000 0.0 0.0
7..2 0.000 122.1 51.9 0.0021 0.0000 0.0000 0.0 0.0
7..3 0.000 122.1 51.9 0.0021 0.0000 0.0000 0.0 0.0
7..4 0.000 122.1 51.9 0.0021 0.0000 0.0000 0.0 0.0
7..5 0.000 122.1 51.9 0.0021 0.0000 0.0000 0.0 0.0
7..6 0.000 122.1 51.9 0.0021 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907774_1_542_MLBR_RS02575)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -229.270022 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.838456 1.414683
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907774_1_542_MLBR_RS02575: 0.000004, NC_002677_1_NP_301450_1_322_ML0525: 0.000004, NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495: 0.000004, NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900: 0.000004, NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840: 0.000004, NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.83846 q = 1.41468
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.01956 0.07343 0.13712 0.20852 0.28730 0.37394 0.46973 0.57722 0.70197 0.86116
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 122.1 51.9 0.3710 0.0000 0.0000 0.0 0.0
7..2 0.000 122.1 51.9 0.3710 0.0000 0.0000 0.0 0.0
7..3 0.000 122.1 51.9 0.3710 0.0000 0.0000 0.0 0.0
7..4 0.000 122.1 51.9 0.3710 0.0000 0.0000 0.0 0.0
7..5 0.000 122.1 51.9 0.3710 0.0000 0.0000 0.0 0.0
7..6 0.000 122.1 51.9 0.3710 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -229.270011 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.021778 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907774_1_542_MLBR_RS02575: 0.000004, NC_002677_1_NP_301450_1_322_ML0525: 0.000004, NZ_LVXE01000008_1_WP_010907774_1_2740_A3216_RS04495: 0.000004, NZ_LYPH01000055_1_WP_010907774_1_2067_A8144_RS09900: 0.000004, NZ_CP029543_1_WP_010907774_1_556_DIJ64_RS02840: 0.000004, NZ_AP014567_1_WP_010907774_1_574_JK2ML_RS02930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.02178
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 122.1 51.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 122.1 51.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 122.1 51.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 122.1 51.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 122.1 51.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 122.1 51.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907774_1_542_MLBR_RS02575)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:15
Model 1: NearlyNeutral -229.270025 Model 2: PositiveSelection -229.270011 Model 0: one-ratio -229.27003 Model 7: beta -229.270022 Model 8: beta&w>1 -229.270011 Model 0 vs 1 9.999999974752427E-6 Model 2 vs 1 2.7999999986150215E-5 Model 8 vs 7 2.200000000129876E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
