--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:55:47 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0527/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.03 -349.26
2 -346.02 -349.39
--------------------------------------
TOTAL -346.02 -349.33
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884730 0.090761 0.344674 1.477935 0.850715 1242.47 1371.73 1.001
r(A<->C){all} 0.163038 0.019956 0.000172 0.454469 0.124131 224.93 316.08 1.000
r(A<->G){all} 0.169389 0.018423 0.000073 0.446691 0.136658 192.60 208.38 1.001
r(A<->T){all} 0.162901 0.019882 0.000014 0.443531 0.127209 350.23 371.60 1.012
r(C<->G){all} 0.169271 0.021190 0.000132 0.469464 0.129201 175.02 219.91 1.000
r(C<->T){all} 0.169131 0.020621 0.000072 0.462240 0.131507 192.04 229.92 1.001
r(G<->T){all} 0.166271 0.018987 0.000054 0.444800 0.131469 102.44 123.35 1.012
pi(A){all} 0.273041 0.000800 0.218223 0.326822 0.272116 1249.78 1252.02 1.000
pi(C){all} 0.301753 0.000832 0.248654 0.360734 0.300761 1097.64 1207.23 1.000
pi(G){all} 0.253722 0.000775 0.201716 0.310862 0.252750 1149.26 1232.56 1.000
pi(T){all} 0.171484 0.000583 0.126406 0.220804 0.170318 1217.32 1337.20 1.000
alpha{1,2} 0.416432 0.231621 0.000267 1.393386 0.241164 1206.63 1220.68 1.000
alpha{3} 0.457414 0.235989 0.000207 1.453281 0.288222 1345.71 1365.76 1.000
pinvar{all} 0.993284 0.000064 0.978762 0.999996 0.995798 1151.18 1303.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -339.659937
Model 2: PositiveSelection -339.659916
Model 0: one-ratio -339.659916
Model 7: beta -339.659947
Model 8: beta&w>1 -339.659916
Model 0 vs 1 4.200000000764703E-5
Model 2 vs 1 4.200000000764703E-5
Model 8 vs 7 6.199999995715189E-5
>C1
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C2
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C3
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C4
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C5
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C6
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=84
C1 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C2 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C3 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C4 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C5 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C6 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
**************************************************
C1 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C2 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C3 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C4 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C5 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C6 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
**********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2520]--->[2520]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.606 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C2 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C3 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C4 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C5 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C6 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
**************************************************
C1 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C2 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C3 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C4 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C5 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C6 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
**********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C2 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C3 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C4 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C5 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C6 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
**************************************************
C1 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C2 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C3 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C4 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C5 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C6 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
**************************************************
C1 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C2 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C3 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C4 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C5 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C6 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
**************************************************
C1 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C2 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C3 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C4 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C5 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C6 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
**************************************************
C1 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C2 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C3 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C4 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C5 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C6 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
**************************************************
C1 CA
C2 CA
C3 CA
C4 CA
C5 CA
C6 CA
**
>C1
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C2
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C3
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C4
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C5
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C6
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C1
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C2
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C3
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C4
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C5
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C6
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 252 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579802067
Setting output file names to "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1252515960
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1584819900
Seed = 656765123
Swapseed = 1579802067
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -563.987998 -- -24.965149
Chain 2 -- -563.988084 -- -24.965149
Chain 3 -- -563.988052 -- -24.965149
Chain 4 -- -563.988084 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -563.987998 -- -24.965149
Chain 2 -- -563.988052 -- -24.965149
Chain 3 -- -563.987998 -- -24.965149
Chain 4 -- -563.988052 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-563.988] (-563.988) (-563.988) (-563.988) * [-563.988] (-563.988) (-563.988) (-563.988)
500 -- (-349.393) (-361.555) (-355.441) [-364.108] * (-352.098) (-352.385) (-357.447) [-353.844] -- 0:00:00
1000 -- (-355.388) (-352.805) [-357.592] (-354.124) * (-354.693) [-353.508] (-355.368) (-354.200) -- 0:00:00
1500 -- (-360.843) (-357.847) [-358.187] (-360.876) * (-357.364) (-353.351) (-351.981) [-353.167] -- 0:00:00
2000 -- [-350.659] (-363.327) (-362.491) (-353.936) * (-356.511) (-355.643) [-353.354] (-351.638) -- 0:00:00
2500 -- (-350.387) (-357.564) (-350.810) [-357.417] * (-358.477) [-349.639] (-361.637) (-354.008) -- 0:06:39
3000 -- (-358.227) [-353.015] (-352.682) (-361.198) * (-355.085) [-351.972] (-361.658) (-359.611) -- 0:05:32
3500 -- [-353.713] (-354.084) (-362.861) (-366.329) * (-358.728) (-351.733) [-356.078] (-355.999) -- 0:04:44
4000 -- (-360.731) (-355.518) (-357.781) [-357.846] * (-363.374) (-363.040) (-361.907) [-354.854] -- 0:04:09
4500 -- (-350.673) [-351.050] (-358.539) (-360.084) * [-355.274] (-358.440) (-350.020) (-352.710) -- 0:03:41
5000 -- (-354.262) [-357.343] (-356.994) (-361.796) * (-355.188) (-355.540) (-361.461) [-353.076] -- 0:03:19
Average standard deviation of split frequencies: 0.092852
5500 -- (-359.947) (-358.245) (-359.522) [-353.473] * (-357.866) [-352.882] (-360.551) (-352.284) -- 0:03:00
6000 -- (-356.546) (-357.450) [-353.926] (-355.876) * (-358.312) (-352.052) (-355.597) [-356.096] -- 0:02:45
6500 -- (-358.905) (-357.121) [-352.296] (-358.677) * (-362.290) (-361.924) [-360.944] (-373.805) -- 0:02:32
7000 -- [-350.622] (-358.003) (-359.293) (-361.613) * (-358.297) (-364.066) [-353.151] (-354.547) -- 0:02:21
7500 -- (-355.593) (-353.543) [-352.507] (-359.958) * (-365.231) (-357.556) (-357.828) [-353.439] -- 0:02:12
8000 -- (-352.961) [-356.479] (-354.032) (-359.213) * (-355.659) (-356.584) [-352.551] (-356.278) -- 0:02:04
8500 -- [-355.513] (-355.098) (-350.802) (-364.256) * (-353.442) (-345.385) (-351.534) [-354.982] -- 0:01:56
9000 -- (-355.476) [-354.305] (-360.467) (-358.152) * (-354.942) (-346.546) [-356.290] (-358.260) -- 0:01:50
9500 -- (-355.054) (-356.175) [-359.660] (-349.528) * (-357.111) [-346.257] (-360.329) (-353.520) -- 0:01:44
10000 -- (-357.320) (-360.755) (-353.913) [-345.072] * (-360.767) [-345.979] (-358.481) (-356.980) -- 0:01:39
Average standard deviation of split frequencies: 0.056821
10500 -- (-352.548) [-358.516] (-364.695) (-344.974) * (-358.648) (-347.542) (-364.111) [-356.319] -- 0:01:34
11000 -- (-360.814) (-361.657) (-366.357) [-346.322] * (-352.094) (-348.701) (-356.814) [-361.925] -- 0:01:29
11500 -- (-359.376) (-357.139) [-353.501] (-352.941) * (-355.299) [-346.022] (-368.719) (-351.033) -- 0:01:25
12000 -- (-357.108) (-371.782) (-355.407) [-346.568] * [-356.737] (-350.086) (-356.712) (-360.537) -- 0:01:22
12500 -- (-366.398) (-371.809) (-354.505) [-347.687] * (-358.163) (-346.326) (-345.786) [-356.422] -- 0:01:19
13000 -- [-346.070] (-371.240) (-356.141) (-347.582) * (-362.636) [-346.564] (-350.412) (-353.903) -- 0:01:15
13500 -- (-345.709) (-367.567) [-352.241] (-348.410) * [-357.824] (-346.471) (-347.193) (-361.030) -- 0:01:13
14000 -- (-344.865) (-366.602) (-362.400) [-346.974] * (-355.415) (-345.661) [-345.285] (-358.195) -- 0:01:10
14500 -- (-351.282) (-358.930) (-365.948) [-350.594] * (-375.198) (-345.022) [-347.335] (-352.606) -- 0:01:07
15000 -- (-348.428) [-357.014] (-357.364) (-347.093) * [-357.619] (-345.661) (-347.229) (-351.804) -- 0:01:05
Average standard deviation of split frequencies: 0.053314
15500 -- (-346.466) (-358.494) (-355.533) [-345.472] * (-354.430) (-346.642) [-346.784] (-354.231) -- 0:01:03
16000 -- [-349.439] (-358.751) (-351.035) (-349.081) * (-363.425) (-346.578) (-347.667) [-354.888] -- 0:01:01
16500 -- (-348.293) (-358.783) [-353.396] (-345.363) * (-362.665) (-346.932) (-347.926) [-357.729] -- 0:00:59
17000 -- (-345.723) (-360.172) [-352.663] (-347.737) * (-359.262) [-352.866] (-346.937) (-353.595) -- 0:00:57
17500 -- (-346.141) [-353.620] (-353.990) (-345.676) * (-348.543) (-346.939) [-346.702] (-360.303) -- 0:01:52
18000 -- (-345.986) [-346.142] (-366.974) (-346.167) * (-347.737) (-349.066) (-348.426) [-351.243] -- 0:01:49
18500 -- (-347.927) (-345.482) (-361.230) [-346.856] * (-349.845) [-346.501] (-345.799) (-354.291) -- 0:01:46
19000 -- (-349.572) (-347.535) [-352.951] (-347.347) * (-346.999) [-346.380] (-350.448) (-360.662) -- 0:01:43
19500 -- (-347.449) (-345.845) (-351.813) [-345.438] * [-348.417] (-348.590) (-345.623) (-358.484) -- 0:01:40
20000 -- (-348.545) [-344.736] (-364.686) (-346.185) * (-347.051) (-348.249) (-348.931) [-358.390] -- 0:01:38
Average standard deviation of split frequencies: 0.044419
20500 -- (-348.833) (-350.987) (-367.630) [-346.127] * [-345.915] (-348.057) (-345.100) (-354.957) -- 0:01:35
21000 -- [-348.430] (-347.118) (-355.795) (-345.183) * [-348.046] (-345.376) (-348.262) (-361.047) -- 0:01:33
21500 -- (-350.117) [-346.677] (-345.090) (-347.573) * (-345.420) [-349.959] (-346.591) (-354.412) -- 0:01:31
22000 -- (-347.331) (-346.901) [-346.484] (-348.445) * (-345.150) (-345.142) (-346.743) [-348.738] -- 0:01:28
22500 -- (-347.650) (-344.536) (-346.270) [-346.557] * [-346.772] (-348.712) (-349.870) (-357.272) -- 0:01:26
23000 -- (-346.106) [-348.706] (-346.310) (-345.526) * (-348.616) (-346.870) [-345.905] (-348.751) -- 0:01:24
23500 -- [-345.766] (-346.873) (-345.916) (-347.519) * (-346.493) [-346.486] (-344.826) (-355.848) -- 0:01:23
24000 -- (-345.839) [-345.913] (-345.351) (-345.888) * (-351.760) [-344.605] (-346.120) (-352.150) -- 0:01:21
24500 -- (-351.843) (-349.319) [-349.713] (-347.543) * (-348.440) (-347.111) [-346.059] (-357.641) -- 0:01:19
25000 -- (-351.488) [-346.452] (-347.066) (-347.619) * [-348.088] (-345.321) (-347.681) (-358.351) -- 0:01:18
Average standard deviation of split frequencies: 0.042608
25500 -- (-345.384) (-347.075) [-345.929] (-347.646) * (-344.639) (-348.214) (-346.360) [-349.309] -- 0:01:16
26000 -- (-345.664) (-351.005) (-345.878) [-347.790] * (-351.107) [-345.730] (-346.480) (-352.521) -- 0:01:14
26500 -- (-344.775) (-346.762) [-345.377] (-345.984) * [-347.268] (-345.614) (-345.934) (-357.531) -- 0:01:13
27000 -- (-345.339) (-345.637) [-346.060] (-345.230) * [-346.924] (-345.680) (-344.955) (-360.090) -- 0:01:12
27500 -- (-347.038) [-346.013] (-349.054) (-346.128) * (-347.372) (-345.174) [-346.137] (-362.245) -- 0:01:10
28000 -- (-345.838) (-346.806) [-346.749] (-350.597) * (-346.818) [-345.957] (-352.560) (-361.341) -- 0:01:09
28500 -- [-347.927] (-344.978) (-347.947) (-347.855) * (-347.172) (-346.952) (-345.606) [-349.365] -- 0:01:08
29000 -- [-346.833] (-346.213) (-346.658) (-345.851) * (-346.575) (-345.637) [-347.345] (-355.629) -- 0:01:06
29500 -- (-349.256) (-345.938) (-347.491) [-348.628] * [-346.262] (-345.339) (-346.097) (-359.906) -- 0:01:05
30000 -- (-349.773) (-347.029) [-346.181] (-350.063) * (-345.254) (-347.824) (-348.144) [-352.323] -- 0:01:04
Average standard deviation of split frequencies: 0.031598
30500 -- (-348.047) (-345.673) [-345.059] (-352.630) * (-345.209) (-346.413) [-345.993] (-361.129) -- 0:01:35
31000 -- (-348.720) [-346.417] (-353.103) (-353.432) * (-348.384) [-345.819] (-345.728) (-356.444) -- 0:01:33
31500 -- (-347.986) [-346.644] (-349.298) (-347.538) * (-348.457) [-345.730] (-346.407) (-355.083) -- 0:01:32
32000 -- (-347.086) (-349.134) [-346.779] (-346.133) * (-346.532) [-345.089] (-345.745) (-353.273) -- 0:01:30
32500 -- (-345.099) (-345.770) [-345.398] (-346.732) * (-345.783) (-345.334) (-348.099) [-354.057] -- 0:01:29
33000 -- (-344.995) (-345.055) (-346.456) [-347.447] * (-348.756) [-347.038] (-347.435) (-356.330) -- 0:01:27
33500 -- (-349.759) (-347.083) (-345.434) [-350.692] * [-346.511] (-346.105) (-344.898) (-362.158) -- 0:01:26
34000 -- [-346.876] (-345.775) (-346.940) (-346.023) * (-348.094) (-346.007) (-345.602) [-350.282] -- 0:01:25
34500 -- (-346.157) (-347.822) (-347.348) [-344.890] * [-346.898] (-344.702) (-348.429) (-361.740) -- 0:01:23
35000 -- [-346.464] (-346.235) (-346.941) (-345.518) * [-346.136] (-345.037) (-344.625) (-355.433) -- 0:01:22
Average standard deviation of split frequencies: 0.032736
35500 -- [-346.267] (-348.297) (-346.578) (-346.154) * (-348.413) [-345.644] (-347.515) (-365.369) -- 0:01:21
36000 -- (-346.755) (-347.345) [-345.490] (-346.822) * [-346.616] (-346.802) (-346.785) (-359.176) -- 0:01:20
36500 -- (-346.280) (-354.628) (-346.900) [-348.166] * (-345.899) [-345.123] (-347.153) (-366.849) -- 0:01:19
37000 -- (-348.299) (-348.353) [-349.727] (-347.147) * (-347.412) [-344.947] (-346.028) (-359.033) -- 0:01:18
37500 -- (-347.546) (-346.552) (-347.689) [-344.893] * (-347.574) [-344.976] (-348.856) (-349.634) -- 0:01:17
38000 -- (-347.389) [-347.960] (-350.228) (-350.676) * (-346.139) (-348.683) (-344.892) [-348.329] -- 0:01:15
38500 -- [-345.839] (-346.783) (-347.124) (-349.418) * (-345.038) [-345.655] (-347.982) (-345.955) -- 0:01:14
39000 -- (-345.438) (-345.678) (-348.117) [-349.107] * [-345.411] (-346.561) (-345.557) (-345.834) -- 0:01:13
39500 -- (-348.263) (-345.409) [-345.639] (-345.939) * (-349.403) (-347.708) [-348.181] (-348.091) -- 0:01:12
40000 -- (-348.792) (-346.642) (-349.717) [-346.458] * (-351.099) (-346.737) (-346.560) [-348.569] -- 0:01:12
Average standard deviation of split frequencies: 0.034094
40500 -- (-351.020) (-350.410) (-345.106) [-345.523] * (-345.584) (-347.813) [-345.812] (-346.112) -- 0:01:11
41000 -- (-350.716) (-352.678) [-350.763] (-344.788) * (-346.666) [-346.104] (-346.335) (-351.781) -- 0:01:10
41500 -- (-350.408) (-352.023) [-346.691] (-345.784) * [-349.255] (-351.209) (-345.585) (-348.006) -- 0:01:09
42000 -- (-345.666) [-347.775] (-349.973) (-345.288) * (-346.569) (-348.642) [-345.338] (-345.369) -- 0:01:08
42500 -- (-345.083) [-345.819] (-345.910) (-346.344) * (-346.736) (-353.347) (-347.198) [-348.113] -- 0:01:07
43000 -- [-345.562] (-346.565) (-344.704) (-349.443) * (-345.950) (-349.130) (-345.062) [-349.158] -- 0:01:06
43500 -- [-345.406] (-346.202) (-346.320) (-348.573) * (-346.122) (-347.106) (-346.635) [-345.708] -- 0:01:05
44000 -- (-348.456) (-345.503) (-346.084) [-346.331] * (-346.549) (-345.115) [-345.940] (-347.406) -- 0:01:05
44500 -- (-347.496) (-344.942) (-346.433) [-346.221] * [-348.157] (-346.818) (-348.714) (-345.808) -- 0:01:04
45000 -- (-349.148) (-346.645) (-346.307) [-345.630] * (-344.487) (-349.019) (-352.528) [-345.540] -- 0:01:03
Average standard deviation of split frequencies: 0.036091
45500 -- (-352.389) (-347.893) (-345.622) [-345.718] * (-344.855) (-346.939) (-346.283) [-344.650] -- 0:01:02
46000 -- (-345.262) (-348.494) [-348.143] (-348.129) * (-346.024) (-345.028) [-344.710] (-345.827) -- 0:01:02
46500 -- (-346.095) (-345.843) [-345.120] (-347.864) * (-345.865) (-348.500) [-347.684] (-346.797) -- 0:01:01
47000 -- (-346.538) [-350.186] (-345.162) (-348.130) * (-345.565) (-347.090) [-345.179] (-346.107) -- 0:01:00
47500 -- (-345.346) (-347.450) [-346.640] (-349.400) * (-347.049) (-352.051) (-347.257) [-346.039] -- 0:01:00
48000 -- (-346.174) [-351.394] (-346.723) (-345.290) * (-349.184) (-351.353) [-346.549] (-347.206) -- 0:01:19
48500 -- (-349.343) (-348.465) (-346.358) [-346.645] * [-350.995] (-350.885) (-347.395) (-346.267) -- 0:01:18
49000 -- (-346.922) (-347.057) (-350.602) [-346.280] * [-346.734] (-345.668) (-345.106) (-347.838) -- 0:01:17
49500 -- (-347.540) [-349.927] (-346.584) (-348.643) * (-345.254) [-345.928] (-345.172) (-347.191) -- 0:01:16
50000 -- (-348.343) (-350.238) (-346.119) [-348.177] * (-351.868) (-347.727) (-345.629) [-347.258] -- 0:01:16
Average standard deviation of split frequencies: 0.031295
50500 -- [-347.296] (-348.345) (-345.119) (-346.355) * (-348.129) [-350.163] (-344.839) (-346.000) -- 0:01:15
51000 -- (-345.004) (-345.307) (-347.163) [-348.533] * (-347.201) [-346.491] (-350.532) (-345.482) -- 0:01:14
51500 -- (-347.279) [-346.484] (-345.466) (-350.986) * (-346.666) (-350.282) (-350.102) [-345.193] -- 0:01:13
52000 -- (-345.163) (-347.783) (-348.153) [-345.502] * (-344.577) [-345.841] (-348.240) (-345.458) -- 0:01:12
52500 -- (-353.236) (-346.912) (-353.492) [-344.900] * (-350.849) (-347.451) (-347.708) [-344.743] -- 0:01:12
53000 -- (-346.046) (-346.620) [-346.912] (-350.780) * (-347.425) [-345.739] (-348.748) (-348.329) -- 0:01:11
53500 -- (-345.528) [-351.395] (-349.273) (-345.667) * (-348.008) [-347.873] (-346.828) (-346.344) -- 0:01:10
54000 -- (-346.625) (-348.230) (-346.171) [-348.678] * (-346.786) [-345.812] (-346.679) (-347.660) -- 0:01:10
54500 -- (-346.295) [-349.051] (-345.779) (-346.069) * (-345.957) (-345.791) [-347.251] (-346.284) -- 0:01:09
55000 -- (-345.924) (-349.624) (-345.086) [-346.970] * (-347.347) [-344.516] (-345.116) (-345.193) -- 0:01:08
Average standard deviation of split frequencies: 0.032906
55500 -- [-344.772] (-348.966) (-347.016) (-348.403) * (-348.847) (-346.008) (-347.388) [-346.767] -- 0:01:08
56000 -- [-345.918] (-346.309) (-346.328) (-347.964) * [-345.698] (-346.638) (-344.975) (-346.641) -- 0:01:07
56500 -- (-344.549) [-348.975] (-346.625) (-345.348) * (-347.035) (-345.512) (-344.718) [-348.435] -- 0:01:06
57000 -- (-347.507) (-346.255) (-346.300) [-345.503] * [-345.465] (-355.091) (-345.551) (-352.239) -- 0:01:06
57500 -- [-344.882] (-348.259) (-345.154) (-345.523) * [-345.436] (-348.679) (-344.812) (-350.222) -- 0:01:05
58000 -- (-348.512) (-344.989) [-347.833] (-345.630) * (-345.097) (-347.021) (-352.033) [-347.482] -- 0:01:04
58500 -- (-347.041) [-347.022] (-348.689) (-347.510) * (-348.267) (-347.263) (-353.081) [-345.455] -- 0:01:04
59000 -- [-346.780] (-345.543) (-349.626) (-346.382) * [-350.719] (-354.600) (-350.183) (-345.472) -- 0:01:03
59500 -- (-346.105) [-346.174] (-347.902) (-348.896) * [-348.028] (-353.810) (-348.844) (-346.642) -- 0:01:03
60000 -- (-348.125) [-344.863] (-352.145) (-345.948) * [-344.604] (-354.261) (-345.313) (-345.307) -- 0:01:02
Average standard deviation of split frequencies: 0.032141
60500 -- (-347.215) [-346.415] (-356.059) (-344.976) * (-345.280) (-350.091) (-347.456) [-346.196] -- 0:01:02
61000 -- (-345.988) [-347.547] (-346.299) (-345.970) * (-346.686) (-348.592) (-345.369) [-347.584] -- 0:01:01
61500 -- (-347.134) (-350.610) (-351.291) [-345.264] * (-347.078) (-346.405) (-346.024) [-346.609] -- 0:01:01
62000 -- (-346.451) (-348.511) [-344.767] (-351.180) * (-347.713) [-345.002] (-344.609) (-349.273) -- 0:01:00
62500 -- (-345.572) (-346.735) (-345.613) [-347.820] * (-348.883) (-346.115) [-345.936] (-348.129) -- 0:01:00
63000 -- (-346.997) (-345.254) [-348.079] (-346.043) * [-347.496] (-347.697) (-346.812) (-346.978) -- 0:00:59
63500 -- [-347.545] (-345.761) (-348.189) (-345.609) * (-350.023) (-348.438) (-345.408) [-346.920] -- 0:00:58
64000 -- [-345.814] (-346.078) (-346.665) (-349.704) * (-345.201) (-347.320) (-346.266) [-346.107] -- 0:00:58
64500 -- (-348.514) [-345.086] (-346.820) (-346.623) * (-347.551) (-349.670) [-346.246] (-352.062) -- 0:00:58
65000 -- (-347.180) (-346.377) (-346.821) [-347.229] * (-348.631) (-347.044) [-346.075] (-349.383) -- 0:01:11
Average standard deviation of split frequencies: 0.036037
65500 -- (-345.257) [-346.019] (-346.953) (-350.589) * (-347.421) (-349.887) (-345.742) [-347.501] -- 0:01:11
66000 -- (-347.131) (-347.478) [-346.182] (-348.156) * (-345.459) (-348.642) [-346.770] (-346.189) -- 0:01:10
66500 -- (-347.520) (-347.146) (-345.711) [-350.856] * (-345.606) (-345.717) [-347.321] (-345.667) -- 0:01:10
67000 -- (-349.366) (-345.045) [-345.716] (-345.708) * (-346.293) (-348.253) (-345.777) [-347.354] -- 0:01:09
67500 -- (-346.058) [-345.188] (-347.346) (-345.641) * (-348.552) [-346.331] (-347.011) (-348.890) -- 0:01:09
68000 -- (-345.764) (-346.360) (-348.352) [-346.969] * (-347.087) (-348.332) (-346.540) [-346.301] -- 0:01:08
68500 -- [-348.201] (-345.876) (-347.221) (-350.623) * (-346.287) (-350.328) (-345.052) [-349.002] -- 0:01:07
69000 -- [-345.510] (-345.345) (-347.563) (-346.245) * (-346.219) (-351.284) [-346.335] (-345.348) -- 0:01:07
69500 -- (-346.302) (-346.782) (-345.295) [-344.885] * (-345.737) (-350.399) (-347.450) [-345.056] -- 0:01:06
70000 -- (-345.728) [-346.164] (-346.109) (-347.046) * (-346.143) (-346.248) [-348.924] (-353.429) -- 0:01:06
Average standard deviation of split frequencies: 0.037357
70500 -- (-348.003) [-344.800] (-350.219) (-346.497) * (-349.571) (-346.214) [-349.414] (-344.880) -- 0:01:05
71000 -- (-351.776) [-347.820] (-345.962) (-350.898) * (-349.203) (-347.588) [-349.051] (-345.293) -- 0:01:05
71500 -- (-348.650) (-347.955) [-347.932] (-345.306) * [-345.631] (-348.651) (-347.309) (-345.763) -- 0:01:04
72000 -- (-351.025) (-346.548) [-346.924] (-347.185) * (-346.886) (-351.418) (-347.214) [-344.791] -- 0:01:04
72500 -- [-346.599] (-345.815) (-345.550) (-345.699) * (-346.823) (-345.926) [-349.798] (-348.344) -- 0:01:03
73000 -- (-346.853) (-348.020) [-345.950] (-346.218) * (-348.065) (-345.550) [-348.783] (-345.921) -- 0:01:03
73500 -- (-347.626) (-346.020) [-344.940] (-353.280) * (-348.250) (-348.285) [-345.600] (-347.353) -- 0:01:03
74000 -- [-345.855] (-346.299) (-349.878) (-349.497) * (-346.294) (-345.391) (-345.978) [-346.129] -- 0:01:02
74500 -- (-351.780) (-345.732) (-345.342) [-347.460] * (-348.375) [-346.557] (-347.828) (-346.692) -- 0:01:02
75000 -- [-347.653] (-345.670) (-345.585) (-347.780) * [-344.785] (-347.768) (-349.582) (-345.851) -- 0:01:01
Average standard deviation of split frequencies: 0.039077
75500 -- [-345.664] (-346.738) (-346.255) (-351.836) * (-348.467) (-349.895) (-347.967) [-345.474] -- 0:01:01
76000 -- [-347.971] (-347.200) (-346.673) (-349.700) * (-349.557) (-348.330) [-346.601] (-347.916) -- 0:01:00
76500 -- (-348.083) (-350.760) [-346.329] (-349.152) * [-348.047] (-346.941) (-346.274) (-346.835) -- 0:01:00
77000 -- (-345.990) (-346.680) [-346.662] (-348.330) * (-350.952) [-345.594] (-346.873) (-345.294) -- 0:00:59
77500 -- (-352.293) [-347.338] (-346.767) (-346.151) * (-345.230) (-346.966) (-344.523) [-345.603] -- 0:00:59
78000 -- (-345.857) (-345.145) (-348.458) [-346.316] * (-350.032) (-347.183) [-346.179] (-346.564) -- 0:00:59
78500 -- (-344.898) (-344.946) (-352.057) [-345.389] * (-351.021) (-345.734) (-346.794) [-345.826] -- 0:00:58
79000 -- (-345.775) (-345.796) (-346.944) [-346.231] * (-349.641) [-345.558] (-345.651) (-347.181) -- 0:00:58
79500 -- (-346.018) (-345.938) (-345.180) [-347.845] * (-346.503) [-345.249] (-347.060) (-349.690) -- 0:00:57
80000 -- (-345.123) (-344.955) (-344.742) [-345.797] * (-344.981) (-347.257) [-347.488] (-345.081) -- 0:00:57
Average standard deviation of split frequencies: 0.039237
80500 -- (-348.938) (-346.789) [-346.483] (-345.715) * (-348.384) (-349.090) [-345.323] (-345.208) -- 0:00:57
81000 -- (-347.223) (-347.061) [-347.480] (-346.876) * [-346.553] (-344.707) (-346.786) (-352.244) -- 0:00:56
81500 -- (-346.839) (-348.369) (-344.668) [-345.216] * (-349.035) (-345.948) (-345.694) [-350.097] -- 0:00:56
82000 -- (-344.964) (-352.988) [-345.381] (-346.437) * [-346.495] (-346.955) (-345.055) (-348.422) -- 0:01:07
82500 -- (-345.557) [-350.595] (-347.485) (-344.972) * (-347.958) (-346.126) (-346.027) [-345.215] -- 0:01:06
83000 -- (-346.008) (-345.961) [-350.353] (-345.467) * (-346.712) (-351.568) (-345.607) [-346.837] -- 0:01:06
83500 -- (-344.432) (-348.270) [-345.513] (-348.157) * (-345.326) (-345.291) [-345.406] (-348.384) -- 0:01:05
84000 -- (-346.960) (-345.560) [-345.406] (-347.033) * (-344.457) (-345.150) [-346.237] (-347.791) -- 0:01:05
84500 -- [-346.863] (-345.005) (-349.039) (-346.856) * (-346.273) (-345.573) (-346.476) [-347.769] -- 0:01:05
85000 -- [-346.240] (-346.229) (-344.735) (-352.402) * (-345.022) (-346.727) [-346.210] (-347.826) -- 0:01:04
Average standard deviation of split frequencies: 0.033574
85500 -- (-347.132) (-347.990) (-346.357) [-350.624] * (-346.018) (-345.669) [-348.648] (-351.179) -- 0:01:04
86000 -- [-345.320] (-349.853) (-347.856) (-349.155) * (-346.825) (-350.058) (-348.034) [-347.666] -- 0:01:03
86500 -- [-345.890] (-349.105) (-346.236) (-345.938) * (-345.620) (-346.728) (-346.172) [-344.804] -- 0:01:03
87000 -- [-345.310] (-348.714) (-346.678) (-346.570) * (-346.047) (-347.864) (-349.435) [-345.682] -- 0:01:02
87500 -- (-345.579) (-348.877) (-347.399) [-345.345] * [-346.959] (-347.775) (-351.674) (-348.602) -- 0:01:02
88000 -- (-347.306) (-345.904) (-346.329) [-346.914] * (-347.060) (-346.757) [-345.414] (-348.160) -- 0:01:02
88500 -- [-347.686] (-348.485) (-346.593) (-344.579) * (-347.713) [-349.898] (-348.180) (-351.096) -- 0:01:01
89000 -- [-345.997] (-348.502) (-346.805) (-345.034) * [-346.067] (-345.043) (-346.989) (-346.548) -- 0:01:01
89500 -- (-345.993) (-351.282) (-344.937) [-346.405] * (-346.570) (-344.857) (-349.809) [-346.643] -- 0:01:01
90000 -- (-347.619) (-345.953) (-347.937) [-346.119] * (-346.779) [-348.530] (-347.829) (-348.998) -- 0:01:00
Average standard deviation of split frequencies: 0.033796
90500 -- (-346.371) (-346.340) (-346.537) [-346.040] * (-346.636) [-348.089] (-345.622) (-348.157) -- 0:01:00
91000 -- [-346.634] (-345.005) (-346.919) (-348.676) * (-345.894) [-346.298] (-349.392) (-353.786) -- 0:00:59
91500 -- (-351.851) (-352.039) [-347.518] (-344.614) * [-352.617] (-346.862) (-347.330) (-350.438) -- 0:00:59
92000 -- (-345.280) (-345.465) (-347.785) [-344.970] * (-345.916) (-349.000) (-346.271) [-346.183] -- 0:00:59
92500 -- (-348.480) [-348.260] (-347.088) (-348.567) * (-352.633) (-349.287) (-347.887) [-345.421] -- 0:00:58
93000 -- [-345.547] (-348.786) (-345.899) (-348.185) * (-348.511) (-346.331) (-347.490) [-345.853] -- 0:00:58
93500 -- [-345.307] (-346.625) (-348.989) (-351.767) * [-349.210] (-345.978) (-345.572) (-347.175) -- 0:00:58
94000 -- (-346.934) (-345.211) [-347.076] (-346.865) * (-345.548) [-347.206] (-346.132) (-349.292) -- 0:00:57
94500 -- (-344.984) (-345.227) [-347.158] (-349.205) * (-347.062) (-348.697) [-345.800] (-344.883) -- 0:00:57
95000 -- (-347.236) [-347.350] (-346.396) (-344.888) * (-347.686) (-345.482) (-347.132) [-344.906] -- 0:00:57
Average standard deviation of split frequencies: 0.034373
95500 -- [-345.571] (-347.619) (-347.326) (-345.582) * (-345.435) (-346.089) (-348.293) [-347.378] -- 0:00:56
96000 -- [-345.147] (-347.370) (-346.486) (-347.536) * (-352.717) [-345.785] (-345.208) (-347.605) -- 0:00:56
96500 -- (-347.381) (-345.024) (-345.490) [-346.908] * [-351.086] (-345.773) (-345.962) (-351.172) -- 0:00:56
97000 -- (-346.699) (-347.151) (-345.984) [-349.847] * (-345.758) (-345.313) [-346.375] (-348.588) -- 0:00:55
97500 -- (-345.889) (-346.353) [-346.052] (-346.727) * [-345.830] (-345.333) (-344.972) (-348.790) -- 0:00:55
98000 -- [-345.944] (-345.989) (-349.436) (-345.328) * (-345.130) [-345.260] (-348.621) (-346.508) -- 0:00:55
98500 -- (-346.377) (-345.910) [-348.954] (-344.807) * (-346.584) [-344.781] (-347.302) (-344.609) -- 0:00:54
99000 -- [-346.299] (-348.906) (-346.694) (-346.298) * (-346.841) (-346.978) [-346.579] (-344.795) -- 0:01:03
99500 -- (-345.793) (-345.172) (-347.035) [-346.738] * [-345.936] (-346.051) (-344.886) (-345.046) -- 0:01:03
100000 -- (-350.353) [-345.148] (-347.585) (-345.865) * [-346.575] (-345.966) (-346.812) (-349.281) -- 0:01:02
Average standard deviation of split frequencies: 0.033170
100500 -- (-346.584) [-348.395] (-350.100) (-347.634) * (-345.141) [-345.484] (-348.482) (-347.465) -- 0:01:02
101000 -- (-346.091) (-347.424) [-350.528] (-344.869) * (-344.790) (-345.316) (-348.007) [-347.326] -- 0:01:02
101500 -- (-346.339) (-349.443) [-345.180] (-347.013) * (-345.768) [-347.929] (-346.236) (-347.804) -- 0:01:01
102000 -- (-346.564) [-346.966] (-347.864) (-345.975) * (-346.431) (-346.295) [-347.033] (-348.337) -- 0:01:01
102500 -- (-349.759) (-346.364) (-344.656) [-348.025] * (-344.833) (-345.719) (-345.635) [-348.882] -- 0:01:01
103000 -- (-351.667) (-345.708) (-345.713) [-346.963] * (-347.278) (-345.687) [-344.697] (-346.611) -- 0:01:00
103500 -- [-347.248] (-345.458) (-345.568) (-347.092) * [-345.393] (-348.578) (-345.841) (-347.735) -- 0:01:00
104000 -- [-348.008] (-345.981) (-345.548) (-347.335) * (-345.329) (-347.114) [-345.820] (-349.614) -- 0:01:00
104500 -- (-344.633) (-348.894) (-346.974) [-348.669] * (-345.491) [-348.707] (-346.546) (-347.932) -- 0:00:59
105000 -- (-344.429) (-346.344) [-346.389] (-349.840) * (-346.413) (-350.817) [-345.704] (-347.145) -- 0:00:59
Average standard deviation of split frequencies: 0.031686
105500 -- [-345.808] (-345.146) (-345.746) (-346.961) * (-347.067) (-349.388) [-346.450] (-345.819) -- 0:00:59
106000 -- (-344.459) (-348.041) [-346.266] (-348.647) * (-348.809) (-345.933) (-346.025) [-347.637] -- 0:00:59
106500 -- (-344.334) (-349.382) (-347.140) [-348.757] * (-346.311) (-349.038) (-346.025) [-345.925] -- 0:00:58
107000 -- [-346.311] (-349.891) (-349.688) (-348.533) * (-347.428) [-346.308] (-347.574) (-347.741) -- 0:00:58
107500 -- [-345.177] (-345.899) (-353.441) (-346.428) * (-345.458) (-346.310) [-348.472] (-346.000) -- 0:00:58
108000 -- [-351.008] (-345.450) (-350.359) (-345.973) * (-347.120) [-344.859] (-345.885) (-346.979) -- 0:00:57
108500 -- (-346.112) [-345.314] (-352.264) (-346.707) * (-345.381) [-349.613] (-344.310) (-347.777) -- 0:00:57
109000 -- (-347.078) (-346.037) [-354.634] (-347.927) * (-346.287) (-347.518) [-348.697] (-346.090) -- 0:00:57
109500 -- (-346.275) (-346.492) (-357.638) [-346.341] * (-347.531) (-348.264) [-347.241] (-345.631) -- 0:00:56
110000 -- [-347.334] (-347.822) (-350.051) (-348.695) * (-347.839) (-345.278) [-348.341] (-348.971) -- 0:00:56
Average standard deviation of split frequencies: 0.032303
110500 -- [-345.963] (-348.291) (-348.695) (-346.965) * (-346.906) (-346.467) [-346.996] (-346.742) -- 0:00:56
111000 -- (-346.614) [-345.243] (-350.279) (-346.833) * (-344.982) (-345.712) [-347.769] (-345.554) -- 0:00:56
111500 -- (-347.924) (-345.314) (-347.190) [-345.593] * (-346.683) (-345.933) [-347.207] (-347.784) -- 0:00:55
112000 -- (-349.937) [-345.243] (-346.298) (-345.956) * (-344.614) (-346.433) (-346.334) [-345.676] -- 0:00:55
112500 -- (-347.139) (-345.866) [-346.016] (-346.565) * [-345.386] (-349.210) (-351.448) (-345.202) -- 0:00:55
113000 -- [-348.295] (-345.919) (-345.897) (-349.594) * [-346.827] (-344.889) (-348.020) (-345.462) -- 0:00:54
113500 -- (-349.123) [-346.312] (-345.262) (-347.919) * (-349.793) (-346.043) [-345.596] (-350.457) -- 0:00:54
114000 -- (-344.961) (-347.530) [-347.530] (-354.383) * [-348.896] (-347.692) (-350.298) (-350.986) -- 0:00:54
114500 -- (-346.187) [-347.573] (-347.028) (-344.924) * (-346.434) [-345.358] (-350.114) (-351.187) -- 0:00:54
115000 -- (-346.379) (-346.335) (-348.679) [-345.590] * (-344.886) [-346.484] (-347.583) (-346.487) -- 0:00:53
Average standard deviation of split frequencies: 0.029971
115500 -- (-345.568) [-344.687] (-351.165) (-345.151) * (-351.336) (-346.420) [-348.722] (-345.186) -- 0:00:53
116000 -- (-344.766) (-347.641) [-346.057] (-349.219) * (-346.987) (-346.142) (-349.220) [-346.526] -- 0:01:00
116500 -- (-348.877) [-344.710] (-345.113) (-345.308) * [-346.656] (-347.542) (-347.398) (-345.322) -- 0:01:00
117000 -- (-351.570) [-345.427] (-345.317) (-346.410) * (-349.517) [-344.637] (-345.453) (-344.695) -- 0:01:00
117500 -- (-348.364) (-347.560) (-345.123) [-349.127] * (-344.991) (-351.024) (-345.942) [-347.753] -- 0:01:00
118000 -- (-346.575) (-348.417) (-348.114) [-348.725] * (-344.522) (-344.542) [-345.915] (-346.310) -- 0:00:59
118500 -- (-347.162) (-345.858) [-350.312] (-351.892) * (-351.131) [-347.416] (-345.549) (-346.070) -- 0:00:59
119000 -- [-345.846] (-345.577) (-349.129) (-344.997) * (-345.802) (-345.364) [-346.514] (-345.246) -- 0:00:59
119500 -- (-347.042) (-346.474) (-345.972) [-345.054] * (-345.823) [-347.186] (-345.224) (-345.113) -- 0:00:58
120000 -- (-351.744) (-346.800) (-345.463) [-345.023] * (-345.107) (-348.744) [-346.781] (-345.795) -- 0:00:58
Average standard deviation of split frequencies: 0.029300
120500 -- (-348.506) [-347.921] (-345.379) (-347.367) * (-346.384) (-347.593) [-345.976] (-347.955) -- 0:00:58
121000 -- (-346.964) (-344.836) [-345.702] (-346.401) * (-345.811) [-347.142] (-345.868) (-348.195) -- 0:00:58
121500 -- (-346.614) [-347.849] (-346.773) (-346.361) * (-345.751) [-346.482] (-344.673) (-347.033) -- 0:00:57
122000 -- (-344.697) [-346.405] (-350.270) (-346.990) * (-348.566) [-345.689] (-346.361) (-348.061) -- 0:00:57
122500 -- [-345.523] (-346.159) (-346.992) (-345.975) * [-348.412] (-344.919) (-345.457) (-346.186) -- 0:00:57
123000 -- (-346.782) (-348.055) [-348.262] (-346.404) * [-345.624] (-349.107) (-346.086) (-346.735) -- 0:00:57
123500 -- (-347.690) (-346.541) [-348.815] (-345.338) * (-345.976) [-347.290] (-346.599) (-346.560) -- 0:00:56
124000 -- (-349.163) (-345.668) [-347.050] (-350.124) * (-346.825) (-345.544) [-344.942] (-345.934) -- 0:00:56
124500 -- (-347.512) [-346.619] (-344.922) (-346.397) * (-345.718) (-348.354) [-347.453] (-346.491) -- 0:00:56
125000 -- [-346.542] (-346.426) (-345.816) (-345.747) * [-347.200] (-349.913) (-347.445) (-347.831) -- 0:00:56
Average standard deviation of split frequencies: 0.027328
125500 -- (-346.416) (-345.758) [-346.051] (-345.440) * (-346.554) (-347.153) [-345.855] (-349.446) -- 0:00:55
126000 -- [-346.732] (-349.496) (-347.159) (-344.934) * (-347.392) [-345.912] (-348.433) (-346.528) -- 0:00:55
126500 -- (-346.609) [-344.781] (-349.811) (-346.116) * (-345.739) [-346.901] (-346.645) (-345.154) -- 0:00:55
127000 -- [-345.213] (-348.644) (-347.615) (-345.314) * (-350.921) [-346.156] (-348.596) (-344.971) -- 0:00:54
127500 -- (-345.602) (-348.043) [-349.176] (-345.886) * (-348.315) (-349.562) [-346.849] (-347.078) -- 0:00:54
128000 -- (-345.502) (-347.588) (-345.469) [-346.355] * (-345.883) (-347.998) [-346.715] (-351.102) -- 0:00:54
128500 -- (-347.776) (-348.841) [-345.260] (-344.587) * [-351.193] (-344.803) (-344.820) (-346.865) -- 0:00:54
129000 -- (-346.362) (-347.665) [-345.943] (-346.520) * (-350.375) [-347.688] (-346.872) (-348.404) -- 0:00:54
129500 -- (-345.505) (-347.950) [-345.452] (-350.268) * [-347.885] (-345.968) (-347.555) (-345.445) -- 0:00:53
130000 -- (-347.521) (-346.046) [-347.934] (-347.066) * (-348.344) (-347.927) (-345.027) [-350.335] -- 0:00:53
Average standard deviation of split frequencies: 0.023122
130500 -- (-345.472) (-349.216) (-349.034) [-347.373] * [-345.551] (-347.605) (-348.666) (-345.062) -- 0:00:53
131000 -- (-345.119) [-344.974] (-347.012) (-345.113) * (-346.531) (-349.829) [-347.184] (-350.275) -- 0:00:53
131500 -- (-345.422) [-346.296] (-346.119) (-345.996) * [-346.855] (-346.415) (-345.486) (-348.020) -- 0:00:52
132000 -- [-346.317] (-346.550) (-346.746) (-346.906) * (-350.425) (-346.765) [-345.510] (-347.411) -- 0:00:52
132500 -- [-347.577] (-348.013) (-346.622) (-345.985) * (-347.369) (-347.738) (-350.702) [-345.840] -- 0:00:52
133000 -- (-345.597) (-351.274) (-347.466) [-348.100] * [-347.761] (-350.664) (-344.570) (-345.417) -- 0:00:58
133500 -- [-346.744] (-348.568) (-347.707) (-349.945) * (-348.131) (-349.309) [-346.661] (-345.983) -- 0:00:58
134000 -- (-346.159) (-347.213) [-346.415] (-348.197) * (-349.784) [-349.381] (-350.603) (-346.183) -- 0:00:58
134500 -- (-345.154) (-346.661) [-350.469] (-347.743) * (-350.924) (-346.637) (-348.936) [-346.511] -- 0:00:57
135000 -- (-345.873) (-347.117) [-344.915] (-346.847) * (-345.554) (-348.196) [-346.325] (-347.326) -- 0:00:57
Average standard deviation of split frequencies: 0.024421
135500 -- (-346.505) (-346.588) (-345.961) [-345.380] * (-346.641) (-348.544) (-345.643) [-348.452] -- 0:00:57
136000 -- (-347.572) (-345.950) (-348.750) [-345.023] * (-348.138) [-346.173] (-350.109) (-347.085) -- 0:00:57
136500 -- (-346.244) (-346.440) [-345.180] (-348.366) * (-347.919) (-348.027) (-346.729) [-347.224] -- 0:00:56
137000 -- (-346.846) (-346.409) (-347.117) [-345.250] * (-345.518) [-347.105] (-347.812) (-346.556) -- 0:00:56
137500 -- (-345.165) [-345.000] (-348.686) (-346.156) * [-346.427] (-345.084) (-348.178) (-349.283) -- 0:00:56
138000 -- [-346.551] (-346.958) (-346.206) (-348.352) * [-345.903] (-347.393) (-349.896) (-346.763) -- 0:00:56
138500 -- (-348.123) (-346.006) (-346.382) [-346.887] * (-345.563) [-347.061] (-345.720) (-347.087) -- 0:00:55
139000 -- (-344.848) (-348.741) (-349.726) [-345.516] * (-345.180) (-347.808) [-345.751] (-348.665) -- 0:00:55
139500 -- (-346.748) (-348.007) [-344.867] (-351.390) * (-345.322) (-348.436) (-344.812) [-345.990] -- 0:00:55
140000 -- (-350.766) [-345.777] (-344.762) (-346.319) * (-347.084) [-347.100] (-346.222) (-347.407) -- 0:00:55
Average standard deviation of split frequencies: 0.024677
140500 -- (-348.987) [-346.019] (-345.770) (-345.918) * (-349.484) (-346.195) (-349.485) [-347.746] -- 0:00:55
141000 -- (-347.562) (-346.353) (-344.976) [-346.101] * (-346.133) [-347.123] (-354.607) (-345.564) -- 0:00:54
141500 -- (-349.593) (-348.599) [-344.881] (-349.934) * (-346.116) (-348.503) (-345.359) [-346.035] -- 0:00:54
142000 -- (-348.346) (-344.930) (-345.059) [-346.934] * [-349.708] (-346.632) (-345.521) (-348.836) -- 0:00:54
142500 -- (-346.925) [-346.993] (-346.687) (-346.093) * (-347.863) [-347.306] (-351.896) (-345.609) -- 0:00:54
143000 -- (-348.122) (-346.668) (-348.460) [-345.875] * (-347.660) (-348.190) (-346.347) [-350.093] -- 0:00:53
143500 -- (-347.444) (-348.326) [-345.381] (-348.079) * [-345.632] (-348.379) (-349.397) (-348.573) -- 0:00:53
144000 -- (-347.106) (-348.134) [-346.657] (-345.945) * (-345.469) (-345.624) (-345.593) [-345.166] -- 0:00:53
144500 -- (-345.381) [-347.830] (-347.507) (-345.049) * [-348.861] (-346.143) (-345.450) (-356.133) -- 0:00:53
145000 -- (-345.862) [-346.544] (-345.352) (-345.908) * (-348.058) (-348.304) [-346.079] (-354.857) -- 0:00:53
Average standard deviation of split frequencies: 0.024363
145500 -- (-348.433) [-350.800] (-350.669) (-347.169) * (-349.667) (-347.503) [-346.368] (-348.304) -- 0:00:52
146000 -- (-345.949) (-346.820) (-345.732) [-345.874] * [-345.622] (-345.075) (-346.012) (-350.860) -- 0:00:52
146500 -- (-346.119) (-347.745) (-346.509) [-351.171] * (-346.104) (-345.658) [-345.470] (-349.276) -- 0:00:52
147000 -- (-346.551) (-349.110) [-347.974] (-349.307) * (-345.043) [-345.084] (-346.079) (-349.066) -- 0:00:52
147500 -- (-345.197) (-348.207) [-348.997] (-348.048) * (-349.040) (-345.716) (-346.651) [-346.094] -- 0:00:52
148000 -- (-345.124) (-345.819) [-347.124] (-347.736) * (-344.906) (-346.819) (-349.666) [-344.866] -- 0:00:51
148500 -- (-345.737) (-347.303) [-348.152] (-348.442) * (-346.787) (-345.198) [-347.100] (-346.898) -- 0:00:51
149000 -- (-345.282) (-348.995) (-349.012) [-345.402] * (-345.963) (-346.013) (-349.928) [-347.435] -- 0:00:51
149500 -- (-347.099) (-346.799) [-345.191] (-345.603) * [-345.630] (-349.309) (-352.274) (-349.009) -- 0:00:51
150000 -- (-345.488) (-345.684) [-348.372] (-349.803) * (-351.739) [-345.292] (-349.271) (-345.796) -- 0:00:56
Average standard deviation of split frequencies: 0.024434
150500 -- (-349.516) (-346.361) (-351.704) [-346.329] * (-349.834) (-348.956) [-346.290] (-345.258) -- 0:00:56
151000 -- [-346.080] (-345.353) (-348.131) (-345.925) * [-347.911] (-350.119) (-346.747) (-348.996) -- 0:00:56
151500 -- (-346.490) (-346.896) [-346.680] (-346.074) * (-348.046) (-349.735) [-347.168] (-345.142) -- 0:00:56
152000 -- (-350.237) [-349.659] (-346.747) (-344.956) * (-350.180) [-347.675] (-347.554) (-346.702) -- 0:00:55
152500 -- (-348.305) (-346.802) (-346.126) [-345.718] * (-347.214) (-346.947) [-346.518] (-356.075) -- 0:00:55
153000 -- [-345.984] (-346.832) (-346.313) (-344.660) * (-345.390) (-345.438) [-347.141] (-345.422) -- 0:00:55
153500 -- (-346.378) (-356.915) (-346.006) [-348.607] * [-345.539] (-347.813) (-345.096) (-344.971) -- 0:00:55
154000 -- [-344.893] (-345.678) (-345.205) (-348.950) * [-346.900] (-346.114) (-344.591) (-347.200) -- 0:00:54
154500 -- (-345.284) (-348.855) [-344.685] (-347.005) * (-346.829) (-346.554) (-345.246) [-346.008] -- 0:00:54
155000 -- (-345.775) (-346.602) (-348.123) [-345.484] * (-347.207) [-345.959] (-344.373) (-347.313) -- 0:00:54
Average standard deviation of split frequencies: 0.023213
155500 -- (-350.615) (-344.876) [-348.936] (-345.061) * (-346.763) [-346.742] (-347.050) (-348.051) -- 0:00:54
156000 -- (-351.529) (-346.873) [-347.352] (-345.278) * (-348.284) (-349.281) (-347.791) [-345.377] -- 0:00:54
156500 -- (-345.239) (-346.862) [-347.627] (-350.035) * (-349.754) (-348.055) [-345.698] (-346.708) -- 0:00:53
157000 -- (-346.609) [-347.994] (-350.042) (-346.591) * (-351.804) (-348.432) (-345.554) [-345.482] -- 0:00:53
157500 -- (-348.936) [-345.616] (-347.802) (-349.401) * (-349.949) (-350.013) [-345.443] (-348.138) -- 0:00:53
158000 -- (-347.811) [-345.938] (-348.295) (-345.895) * (-347.954) [-350.140] (-346.922) (-346.941) -- 0:00:53
158500 -- (-348.994) (-345.753) [-346.255] (-349.306) * (-345.149) (-351.890) [-346.332] (-345.800) -- 0:00:53
159000 -- [-346.711] (-345.223) (-347.566) (-349.981) * (-346.296) [-347.538] (-347.503) (-346.644) -- 0:00:52
159500 -- (-347.639) (-344.544) (-348.586) [-346.325] * (-349.312) (-348.612) [-345.513] (-344.576) -- 0:00:52
160000 -- [-346.020] (-346.405) (-348.846) (-347.979) * [-347.641] (-347.583) (-347.527) (-345.624) -- 0:00:52
Average standard deviation of split frequencies: 0.022272
160500 -- [-345.373] (-350.414) (-347.336) (-345.904) * [-344.989] (-346.331) (-351.746) (-346.163) -- 0:00:52
161000 -- [-347.810] (-347.770) (-345.846) (-347.834) * (-345.731) [-347.886] (-353.677) (-344.787) -- 0:00:52
161500 -- (-346.180) (-349.626) [-345.702] (-346.665) * (-347.587) [-347.801] (-345.915) (-347.797) -- 0:00:51
162000 -- (-345.949) (-346.565) (-344.481) [-346.599] * [-346.901] (-349.209) (-345.780) (-345.478) -- 0:00:51
162500 -- (-345.618) (-346.429) [-350.963] (-347.487) * (-346.715) [-350.288] (-348.463) (-346.045) -- 0:00:51
163000 -- (-344.756) (-344.854) [-347.753] (-344.742) * (-346.726) (-348.181) [-345.263] (-345.473) -- 0:00:51
163500 -- (-346.896) (-351.496) [-345.680] (-347.948) * [-347.505] (-346.099) (-347.252) (-344.564) -- 0:00:51
164000 -- (-346.726) (-347.615) (-349.206) [-346.912] * [-346.402] (-345.491) (-347.265) (-347.839) -- 0:00:50
164500 -- (-344.904) (-347.433) (-349.981) [-347.020] * (-347.803) [-344.856] (-344.853) (-347.242) -- 0:00:50
165000 -- (-345.460) (-347.023) [-352.552] (-348.359) * (-345.108) (-345.059) (-349.400) [-346.597] -- 0:00:50
Average standard deviation of split frequencies: 0.022718
165500 -- [-346.425] (-345.410) (-345.032) (-345.405) * (-347.570) (-346.798) [-347.153] (-349.748) -- 0:00:50
166000 -- (-346.730) (-346.039) [-346.564] (-348.109) * (-347.431) (-355.238) [-345.623] (-345.707) -- 0:00:50
166500 -- [-346.912] (-350.462) (-346.136) (-348.029) * (-345.648) (-348.793) (-345.026) [-348.691] -- 0:00:50
167000 -- (-355.781) (-349.930) (-350.005) [-346.796] * (-345.308) (-346.925) [-346.466] (-345.265) -- 0:00:54
167500 -- (-345.326) (-347.684) (-346.891) [-344.819] * (-345.808) [-345.759] (-344.735) (-346.873) -- 0:00:54
168000 -- (-346.087) [-347.813] (-347.860) (-346.061) * (-346.771) [-345.806] (-348.463) (-347.166) -- 0:00:54
168500 -- (-345.757) (-349.123) (-347.747) [-344.876] * (-348.650) [-345.916] (-348.429) (-346.360) -- 0:00:54
169000 -- (-347.145) [-346.214] (-348.706) (-347.374) * (-348.036) (-349.364) [-346.831] (-347.585) -- 0:00:54
169500 -- (-346.916) (-344.719) (-348.627) [-347.592] * (-347.076) (-349.681) (-345.636) [-346.038] -- 0:00:53
170000 -- (-346.921) [-344.647] (-346.832) (-346.551) * (-350.082) (-345.077) (-347.210) [-345.266] -- 0:00:53
Average standard deviation of split frequencies: 0.021720
170500 -- [-345.952] (-346.279) (-345.031) (-345.534) * (-348.525) (-346.251) [-345.885] (-345.544) -- 0:00:53
171000 -- (-346.413) (-346.075) [-347.375] (-346.967) * (-348.131) (-346.025) (-348.773) [-346.667] -- 0:00:53
171500 -- (-346.920) (-345.748) (-349.073) [-344.827] * (-346.704) [-345.794] (-346.402) (-345.555) -- 0:00:53
172000 -- (-352.816) [-345.140] (-349.995) (-348.642) * (-346.180) [-344.925] (-345.956) (-345.646) -- 0:00:52
172500 -- [-346.113] (-345.783) (-347.802) (-355.109) * (-346.997) (-346.478) (-346.082) [-346.434] -- 0:00:52
173000 -- (-345.715) [-347.140] (-345.854) (-349.503) * (-350.269) [-345.714] (-349.598) (-352.116) -- 0:00:52
173500 -- (-346.966) (-345.086) (-345.973) [-350.746] * [-346.491] (-347.339) (-347.761) (-345.501) -- 0:00:52
174000 -- (-347.488) (-346.045) (-348.341) [-346.255] * (-349.181) [-344.875] (-347.078) (-346.790) -- 0:00:52
174500 -- (-347.722) (-348.388) (-346.907) [-349.521] * (-347.782) [-345.655] (-345.648) (-349.221) -- 0:00:52
175000 -- (-347.322) [-348.675] (-349.314) (-345.538) * (-345.747) (-346.368) [-345.469] (-346.228) -- 0:00:51
Average standard deviation of split frequencies: 0.021045
175500 -- (-346.360) (-346.158) [-346.423] (-345.588) * (-348.238) [-344.703] (-346.897) (-344.811) -- 0:00:51
176000 -- [-345.052] (-347.100) (-351.860) (-346.682) * (-348.109) (-346.463) (-347.032) [-347.464] -- 0:00:51
176500 -- (-345.675) (-344.997) [-346.870] (-345.586) * (-346.421) (-348.014) [-346.041] (-346.384) -- 0:00:51
177000 -- (-345.027) (-346.065) (-346.208) [-346.661] * [-347.996] (-346.909) (-347.303) (-347.223) -- 0:00:51
177500 -- [-346.848] (-348.104) (-347.677) (-346.769) * [-347.660] (-349.663) (-345.175) (-349.903) -- 0:00:50
178000 -- (-347.355) (-345.784) [-346.025] (-346.672) * (-344.843) (-346.504) (-348.402) [-347.483] -- 0:00:50
178500 -- (-347.839) (-348.740) (-347.564) [-347.645] * (-346.516) (-350.038) [-346.625] (-350.211) -- 0:00:50
179000 -- (-346.304) [-346.106] (-354.555) (-346.769) * [-347.313] (-347.189) (-346.865) (-346.241) -- 0:00:50
179500 -- [-345.007] (-346.365) (-348.419) (-347.183) * (-347.016) (-345.009) (-350.410) [-348.232] -- 0:00:50
180000 -- [-348.237] (-344.596) (-346.412) (-348.787) * [-347.290] (-346.017) (-344.921) (-347.465) -- 0:00:50
Average standard deviation of split frequencies: 0.019507
180500 -- [-345.952] (-349.314) (-346.609) (-346.857) * [-349.664] (-346.932) (-347.857) (-349.036) -- 0:00:49
181000 -- [-346.320] (-346.640) (-347.359) (-345.588) * (-347.682) (-346.235) (-347.386) [-348.911] -- 0:00:49
181500 -- (-350.123) [-349.818] (-346.767) (-350.473) * (-346.474) (-348.233) [-346.100] (-346.196) -- 0:00:49
182000 -- [-345.946] (-347.509) (-346.635) (-346.371) * (-344.994) (-347.623) [-345.010] (-345.404) -- 0:00:49
182500 -- [-345.881] (-345.907) (-346.746) (-346.921) * (-346.276) [-346.880] (-345.750) (-346.183) -- 0:00:49
183000 -- (-345.718) (-351.195) [-345.072] (-345.749) * [-346.382] (-346.136) (-345.493) (-346.638) -- 0:00:49
183500 -- (-345.885) [-348.158] (-346.806) (-345.663) * (-345.947) (-346.953) (-344.811) [-345.087] -- 0:00:48
184000 -- [-346.142] (-347.519) (-345.028) (-347.457) * (-345.355) (-345.320) [-345.711] (-346.863) -- 0:00:53
184500 -- (-345.469) (-346.421) [-346.264] (-347.906) * (-351.793) (-346.999) [-346.197] (-345.861) -- 0:00:53
185000 -- [-344.997] (-346.512) (-346.964) (-345.725) * (-344.649) (-345.095) [-348.175] (-347.194) -- 0:00:52
Average standard deviation of split frequencies: 0.017017
185500 -- (-346.181) [-346.760] (-347.015) (-348.199) * (-346.231) (-349.231) [-345.703] (-348.877) -- 0:00:52
186000 -- (-345.265) (-351.325) (-348.068) [-347.066] * (-344.734) (-346.866) [-346.181] (-347.695) -- 0:00:52
186500 -- [-345.217] (-346.238) (-346.249) (-346.327) * (-350.903) [-347.358] (-346.311) (-347.987) -- 0:00:52
187000 -- (-349.549) [-347.796] (-345.449) (-347.003) * (-353.050) [-345.967] (-345.459) (-347.981) -- 0:00:52
187500 -- (-352.352) (-348.981) [-344.866] (-346.342) * [-351.350] (-345.733) (-349.723) (-346.642) -- 0:00:52
188000 -- (-349.507) [-346.397] (-346.399) (-345.328) * [-346.503] (-347.934) (-350.727) (-346.168) -- 0:00:51
188500 -- [-347.121] (-347.451) (-347.953) (-347.158) * (-350.420) (-348.069) [-347.712] (-344.889) -- 0:00:51
189000 -- (-346.841) (-349.223) [-347.626] (-347.592) * (-346.774) (-346.654) (-347.745) [-345.277] -- 0:00:51
189500 -- (-345.953) [-346.191] (-348.629) (-349.639) * (-346.616) (-344.570) (-349.173) [-347.488] -- 0:00:51
190000 -- (-345.599) (-347.113) (-348.460) [-346.798] * [-346.405] (-346.072) (-352.663) (-350.181) -- 0:00:51
Average standard deviation of split frequencies: 0.015576
190500 -- (-348.424) (-345.793) (-349.391) [-346.989] * [-345.885] (-346.096) (-348.057) (-347.585) -- 0:00:50
191000 -- (-352.200) (-346.931) [-347.088] (-345.173) * (-350.681) (-345.559) [-345.681] (-349.283) -- 0:00:50
191500 -- (-350.796) (-347.041) [-348.232] (-348.372) * (-347.004) (-347.010) [-346.827] (-345.508) -- 0:00:50
192000 -- (-345.759) (-346.300) (-346.366) [-346.024] * (-349.270) (-350.122) [-345.659] (-345.236) -- 0:00:50
192500 -- (-346.239) (-346.607) [-345.620] (-346.001) * [-347.024] (-347.649) (-345.242) (-345.239) -- 0:00:50
193000 -- [-344.762] (-345.771) (-346.944) (-344.858) * (-349.216) (-345.903) (-345.636) [-348.194] -- 0:00:50
193500 -- (-347.690) (-347.595) [-344.951] (-350.770) * (-350.969) (-346.433) (-345.860) [-347.434] -- 0:00:50
194000 -- (-346.447) [-345.680] (-348.553) (-349.083) * (-348.405) (-347.460) [-344.762] (-345.563) -- 0:00:49
194500 -- (-347.117) [-347.234] (-352.005) (-348.501) * (-349.229) [-345.045] (-346.673) (-345.445) -- 0:00:49
195000 -- (-345.270) (-346.934) (-351.064) [-346.773] * (-345.985) (-344.793) [-348.396] (-345.444) -- 0:00:49
Average standard deviation of split frequencies: 0.015754
195500 -- [-345.933] (-351.507) (-347.138) (-347.901) * (-345.915) (-345.714) (-348.022) [-346.747] -- 0:00:49
196000 -- (-346.622) (-348.396) [-345.384] (-347.336) * (-346.950) (-344.609) (-347.699) [-345.527] -- 0:00:49
196500 -- (-347.943) (-346.500) [-345.103] (-346.201) * (-347.784) (-345.357) (-347.502) [-344.910] -- 0:00:49
197000 -- (-345.511) (-346.004) (-346.588) [-344.734] * (-345.389) [-347.721] (-346.960) (-346.341) -- 0:00:48
197500 -- [-346.136] (-346.577) (-345.455) (-347.750) * (-347.417) (-347.266) [-348.819] (-348.716) -- 0:00:48
198000 -- (-347.303) [-349.376] (-346.393) (-347.728) * [-347.682] (-347.174) (-345.610) (-347.901) -- 0:00:48
198500 -- (-347.771) (-347.583) (-348.568) [-345.386] * (-349.987) (-346.494) [-344.637] (-349.205) -- 0:00:48
199000 -- (-346.755) (-345.823) (-346.928) [-346.209] * (-345.549) [-345.248] (-346.351) (-345.816) -- 0:00:48
199500 -- [-345.887] (-347.244) (-350.967) (-346.341) * (-345.570) [-345.011] (-349.549) (-345.628) -- 0:00:48
200000 -- (-345.852) (-346.217) [-346.372] (-348.166) * (-346.457) (-345.029) (-347.567) [-346.687] -- 0:00:48
Average standard deviation of split frequencies: 0.014213
200500 -- [-347.841] (-345.784) (-346.833) (-348.443) * (-344.790) (-349.755) (-353.961) [-344.820] -- 0:00:51
201000 -- [-345.348] (-345.990) (-346.969) (-347.052) * (-348.280) [-346.594] (-349.332) (-345.199) -- 0:00:51
201500 -- (-348.486) (-346.395) (-346.027) [-346.319] * (-346.645) (-349.303) (-344.804) [-348.060] -- 0:00:51
202000 -- [-345.818] (-351.210) (-346.492) (-346.635) * (-347.682) (-346.039) [-344.892] (-348.213) -- 0:00:51
202500 -- (-347.113) (-348.019) (-345.472) [-347.885] * [-344.463] (-345.906) (-349.582) (-346.289) -- 0:00:51
203000 -- [-346.711] (-350.763) (-347.935) (-346.952) * (-346.975) (-348.450) (-349.418) [-346.515] -- 0:00:51
203500 -- (-347.959) (-349.572) (-346.117) [-351.142] * (-346.059) (-346.471) (-352.597) [-345.949] -- 0:00:50
204000 -- (-345.085) [-344.783] (-345.082) (-346.226) * (-346.726) (-345.884) (-347.232) [-345.581] -- 0:00:50
204500 -- (-348.451) (-346.338) [-347.294] (-347.978) * (-347.984) (-345.758) [-345.626] (-344.525) -- 0:00:50
205000 -- (-348.217) [-348.868] (-345.806) (-346.534) * [-346.559] (-345.157) (-345.031) (-345.755) -- 0:00:50
Average standard deviation of split frequencies: 0.013839
205500 -- (-350.974) (-347.802) [-347.237] (-351.657) * [-345.383] (-347.776) (-347.419) (-346.803) -- 0:00:50
206000 -- [-345.620] (-349.279) (-350.439) (-346.519) * (-348.785) (-347.221) [-347.302] (-345.169) -- 0:00:50
206500 -- (-346.210) [-346.137] (-347.687) (-346.058) * [-346.747] (-348.852) (-346.795) (-346.495) -- 0:00:49
207000 -- [-344.986] (-351.758) (-347.309) (-344.910) * (-346.193) [-348.187] (-345.618) (-344.552) -- 0:00:49
207500 -- (-344.991) [-346.993] (-348.148) (-346.536) * (-346.892) (-346.719) (-346.481) [-345.891] -- 0:00:49
208000 -- (-349.014) (-348.944) (-348.826) [-345.757] * (-346.155) (-345.911) (-344.950) [-347.113] -- 0:00:49
208500 -- (-345.868) [-349.803] (-344.733) (-345.778) * [-345.676] (-346.907) (-347.871) (-347.782) -- 0:00:49
209000 -- [-345.215] (-349.707) (-345.218) (-346.515) * (-347.707) [-346.178] (-347.730) (-347.543) -- 0:00:49
209500 -- (-348.162) [-347.443] (-345.057) (-347.619) * [-345.005] (-351.178) (-345.862) (-351.169) -- 0:00:49
210000 -- (-351.017) (-349.107) (-345.128) [-346.917] * (-348.339) (-349.496) (-346.296) [-347.561] -- 0:00:48
Average standard deviation of split frequencies: 0.014604
210500 -- (-344.707) (-345.074) [-348.135] (-348.781) * (-349.403) [-348.589] (-345.901) (-346.150) -- 0:00:48
211000 -- (-345.253) (-347.883) [-346.385] (-345.905) * [-347.751] (-349.924) (-347.375) (-346.958) -- 0:00:48
211500 -- (-345.119) (-348.317) [-348.147] (-345.213) * (-352.278) [-346.484] (-345.639) (-345.234) -- 0:00:48
212000 -- (-349.776) [-344.994] (-345.301) (-348.089) * (-346.668) (-348.786) [-346.290] (-348.327) -- 0:00:48
212500 -- (-351.526) (-347.359) [-347.093] (-346.651) * (-345.406) (-346.371) [-345.188] (-345.605) -- 0:00:48
213000 -- (-347.502) (-347.829) [-346.907] (-346.660) * (-345.955) (-347.802) [-347.114] (-352.383) -- 0:00:48
213500 -- (-346.737) (-351.059) (-346.222) [-345.524] * (-346.505) [-350.063] (-346.051) (-347.431) -- 0:00:47
214000 -- (-347.794) [-349.778] (-346.493) (-347.798) * (-345.531) (-349.625) (-347.968) [-344.806] -- 0:00:47
214500 -- (-347.543) (-346.994) [-345.004] (-345.514) * (-350.030) (-345.351) [-344.993] (-347.460) -- 0:00:47
215000 -- (-345.305) (-344.913) (-352.067) [-345.354] * (-348.039) (-346.666) (-347.480) [-348.090] -- 0:00:47
Average standard deviation of split frequencies: 0.014932
215500 -- (-344.936) (-345.710) (-349.966) [-346.635] * (-346.258) [-346.077] (-345.732) (-347.764) -- 0:00:47
216000 -- [-346.626] (-347.347) (-346.660) (-348.274) * [-346.518] (-345.546) (-345.387) (-346.303) -- 0:00:47
216500 -- (-346.532) [-345.578] (-346.018) (-348.635) * (-347.249) (-344.779) (-345.233) [-346.492] -- 0:00:47
217000 -- (-344.571) (-347.386) [-345.384] (-347.418) * (-349.001) (-344.616) [-345.450] (-347.339) -- 0:00:46
217500 -- (-346.972) (-347.841) (-346.004) [-346.258] * (-347.345) [-344.582] (-346.231) (-354.926) -- 0:00:50
218000 -- (-346.255) [-347.664] (-348.961) (-345.660) * (-346.763) (-345.136) (-345.295) [-349.361] -- 0:00:50
218500 -- [-345.626] (-344.622) (-346.327) (-347.456) * [-345.668] (-347.091) (-345.326) (-349.309) -- 0:00:50
219000 -- [-346.667] (-347.812) (-347.685) (-347.490) * (-350.528) [-347.295] (-344.830) (-346.066) -- 0:00:49
219500 -- (-350.680) (-345.933) [-346.082] (-348.327) * (-351.167) (-347.749) [-345.385] (-347.826) -- 0:00:49
220000 -- (-347.026) (-345.652) (-349.875) [-348.346] * (-345.286) (-345.211) [-345.975] (-345.378) -- 0:00:49
Average standard deviation of split frequencies: 0.013830
220500 -- (-345.664) [-347.880] (-349.814) (-348.213) * (-347.697) (-347.590) [-348.397] (-346.353) -- 0:00:49
221000 -- (-345.718) [-348.739] (-346.488) (-345.966) * (-345.201) [-346.729] (-345.086) (-344.619) -- 0:00:49
221500 -- [-345.741] (-347.634) (-345.184) (-345.940) * (-345.327) [-345.917] (-346.852) (-346.861) -- 0:00:49
222000 -- (-344.921) [-348.665] (-346.097) (-347.229) * [-344.999] (-347.075) (-347.776) (-346.923) -- 0:00:49
222500 -- [-344.942] (-347.851) (-345.467) (-350.897) * [-346.920] (-348.110) (-346.991) (-347.446) -- 0:00:48
223000 -- (-347.950) (-345.631) [-347.115] (-347.228) * [-347.192] (-348.789) (-348.503) (-347.970) -- 0:00:48
223500 -- (-345.265) (-346.532) (-349.097) [-346.981] * [-345.562] (-344.668) (-347.939) (-348.097) -- 0:00:48
224000 -- (-349.966) (-348.731) [-349.835] (-347.360) * (-346.281) [-345.323] (-345.490) (-347.848) -- 0:00:48
224500 -- [-347.435] (-347.411) (-347.943) (-346.329) * (-348.798) (-350.447) (-345.269) [-345.549] -- 0:00:48
225000 -- (-349.892) [-346.196] (-350.531) (-347.263) * (-346.484) [-346.494] (-348.675) (-345.548) -- 0:00:48
Average standard deviation of split frequencies: 0.013454
225500 -- [-345.357] (-345.146) (-348.628) (-347.870) * (-348.222) (-347.089) (-345.242) [-346.702] -- 0:00:48
226000 -- (-346.330) (-346.091) [-346.134] (-347.462) * (-347.107) (-346.388) [-346.045] (-345.806) -- 0:00:47
226500 -- (-345.535) [-346.881] (-344.780) (-346.052) * (-347.115) (-346.891) (-348.820) [-348.326] -- 0:00:47
227000 -- (-349.502) [-345.034] (-348.170) (-345.988) * (-346.288) [-346.802] (-346.276) (-347.792) -- 0:00:47
227500 -- [-347.121] (-345.996) (-344.956) (-346.429) * [-346.299] (-348.374) (-347.152) (-346.544) -- 0:00:47
228000 -- (-347.978) [-348.992] (-346.869) (-346.278) * [-346.385] (-347.065) (-346.826) (-345.878) -- 0:00:47
228500 -- (-345.876) [-346.514] (-346.024) (-347.489) * [-344.742] (-347.942) (-347.973) (-345.468) -- 0:00:47
229000 -- (-345.622) (-347.638) (-346.970) [-344.856] * [-345.730] (-347.869) (-349.953) (-345.337) -- 0:00:47
229500 -- (-347.618) (-345.671) [-347.513] (-345.512) * (-345.876) [-345.925] (-349.680) (-345.848) -- 0:00:47
230000 -- (-345.700) (-346.644) [-346.748] (-348.549) * (-348.786) (-348.838) (-346.662) [-344.974] -- 0:00:46
Average standard deviation of split frequencies: 0.013553
230500 -- (-347.629) [-348.543] (-350.076) (-353.853) * (-344.937) (-345.430) [-345.981] (-345.396) -- 0:00:46
231000 -- [-345.655] (-347.588) (-347.298) (-345.775) * (-345.771) [-345.189] (-346.438) (-354.874) -- 0:00:46
231500 -- (-348.140) (-352.472) (-346.248) [-347.050] * (-345.008) [-349.094] (-347.406) (-348.096) -- 0:00:46
232000 -- [-345.042] (-349.946) (-345.737) (-345.474) * (-345.750) [-348.557] (-345.154) (-346.730) -- 0:00:46
232500 -- (-348.625) [-345.847] (-345.156) (-345.922) * (-344.905) [-345.791] (-345.194) (-345.762) -- 0:00:46
233000 -- (-348.198) (-346.138) (-346.094) [-346.445] * (-347.009) (-346.210) (-345.365) [-347.548] -- 0:00:46
233500 -- (-347.210) (-346.502) (-346.938) [-349.946] * (-344.922) (-344.540) (-350.548) [-346.942] -- 0:00:45
234000 -- (-345.657) [-346.978] (-346.103) (-348.977) * (-346.989) (-347.768) [-344.604] (-346.175) -- 0:00:45
234500 -- [-346.148] (-345.579) (-345.620) (-345.165) * [-347.832] (-346.008) (-346.661) (-345.045) -- 0:00:48
235000 -- (-349.339) [-345.191] (-345.116) (-346.300) * (-347.776) (-346.668) (-350.860) [-347.280] -- 0:00:48
Average standard deviation of split frequencies: 0.013427
235500 -- (-346.476) [-344.532] (-347.949) (-349.796) * (-349.481) (-348.966) (-346.280) [-349.436] -- 0:00:48
236000 -- [-347.415] (-345.987) (-350.018) (-347.053) * (-347.229) (-347.257) (-344.896) [-348.250] -- 0:00:48
236500 -- (-345.836) [-344.505] (-347.486) (-351.794) * (-348.039) [-346.650] (-347.276) (-345.024) -- 0:00:48
237000 -- (-347.069) (-346.695) [-349.109] (-347.721) * (-346.529) [-347.113] (-345.667) (-348.405) -- 0:00:48
237500 -- (-345.557) (-344.740) [-347.600] (-346.840) * (-346.113) (-346.059) [-345.782] (-349.186) -- 0:00:48
238000 -- (-345.106) [-345.436] (-351.486) (-351.155) * (-345.858) (-346.394) (-344.995) [-344.962] -- 0:00:48
238500 -- (-350.141) [-346.869] (-349.157) (-345.213) * [-345.858] (-346.230) (-347.246) (-346.679) -- 0:00:47
239000 -- (-346.763) [-350.112] (-345.813) (-349.956) * (-346.497) (-350.559) (-348.175) [-345.387] -- 0:00:47
239500 -- (-345.977) (-350.820) [-347.290] (-352.207) * [-347.303] (-350.583) (-346.867) (-348.174) -- 0:00:47
240000 -- [-344.763] (-347.880) (-345.706) (-348.900) * (-345.883) (-344.552) [-346.493] (-345.563) -- 0:00:47
Average standard deviation of split frequencies: 0.015235
240500 -- (-344.585) (-344.543) (-345.573) [-348.427] * (-347.971) [-346.236] (-347.454) (-346.423) -- 0:00:47
241000 -- (-349.095) (-347.205) (-349.476) [-346.982] * [-346.292] (-346.023) (-348.604) (-346.483) -- 0:00:47
241500 -- [-347.898] (-347.086) (-345.267) (-345.049) * (-348.652) (-346.578) [-345.258] (-347.587) -- 0:00:47
242000 -- [-344.912] (-348.190) (-345.512) (-348.854) * [-348.109] (-348.928) (-344.995) (-346.945) -- 0:00:46
242500 -- (-345.903) (-350.822) [-345.062] (-348.371) * (-348.640) (-346.782) [-346.910] (-347.815) -- 0:00:46
243000 -- [-347.652] (-346.227) (-346.720) (-353.957) * (-348.967) (-345.034) (-348.709) [-347.374] -- 0:00:46
243500 -- (-348.837) (-345.311) [-346.238] (-348.126) * (-350.274) [-346.873] (-347.626) (-346.771) -- 0:00:46
244000 -- (-345.845) (-345.449) (-349.521) [-347.522] * [-344.777] (-345.213) (-346.933) (-347.681) -- 0:00:46
244500 -- (-346.440) [-345.221] (-348.090) (-345.575) * (-345.344) [-348.230] (-346.916) (-347.165) -- 0:00:46
245000 -- (-347.921) (-348.742) (-348.724) [-345.672] * [-345.296] (-348.396) (-346.474) (-345.325) -- 0:00:46
Average standard deviation of split frequencies: 0.013840
245500 -- (-345.713) (-346.661) [-345.933] (-348.512) * (-344.528) [-346.899] (-347.190) (-346.080) -- 0:00:46
246000 -- (-347.092) [-346.550] (-346.610) (-349.234) * [-345.037] (-348.688) (-346.266) (-351.821) -- 0:00:45
246500 -- (-344.633) (-348.090) (-345.846) [-346.472] * (-345.008) [-346.316] (-348.464) (-346.135) -- 0:00:45
247000 -- (-345.831) (-347.033) [-345.680] (-346.848) * (-347.013) (-346.850) [-345.634] (-345.484) -- 0:00:45
247500 -- (-353.350) [-346.928] (-345.965) (-346.805) * (-350.286) [-348.619] (-345.670) (-344.852) -- 0:00:45
248000 -- (-348.926) (-345.406) [-345.196] (-348.341) * [-344.860] (-346.729) (-348.836) (-345.896) -- 0:00:45
248500 -- [-349.451] (-347.329) (-346.317) (-348.367) * [-348.984] (-347.893) (-345.888) (-345.652) -- 0:00:45
249000 -- [-350.900] (-350.846) (-347.426) (-346.601) * (-346.429) (-347.334) (-345.738) [-345.166] -- 0:00:45
249500 -- (-348.748) (-347.613) (-345.171) [-347.265] * (-345.545) (-352.651) [-347.375] (-351.747) -- 0:00:45
250000 -- [-347.565] (-345.430) (-346.707) (-347.184) * (-345.802) (-348.316) [-346.546] (-347.777) -- 0:00:45
Average standard deviation of split frequencies: 0.012642
250500 -- (-351.331) (-347.339) (-344.445) [-344.869] * (-345.115) (-345.931) (-345.851) [-348.442] -- 0:00:44
251000 -- (-346.591) (-345.465) [-348.729] (-345.950) * (-349.137) (-346.950) (-346.704) [-351.075] -- 0:00:44
251500 -- (-347.045) [-347.886] (-350.009) (-346.918) * (-346.693) (-345.329) (-346.707) [-348.510] -- 0:00:47
252000 -- (-346.777) [-347.259] (-347.889) (-344.879) * (-348.246) [-347.805] (-346.929) (-346.108) -- 0:00:47
252500 -- (-345.852) (-347.364) (-345.782) [-344.820] * (-347.443) [-346.797] (-348.127) (-346.961) -- 0:00:47
253000 -- (-348.171) (-348.746) [-347.508] (-347.107) * (-347.815) (-347.666) (-345.926) [-344.588] -- 0:00:47
253500 -- [-345.484] (-348.065) (-348.278) (-347.215) * (-348.278) (-352.272) [-348.247] (-345.277) -- 0:00:47
254000 -- (-350.777) (-348.646) [-352.112] (-345.482) * (-346.271) (-349.018) (-346.166) [-345.469] -- 0:00:46
254500 -- (-347.119) [-345.816] (-347.500) (-347.525) * (-345.400) (-347.110) (-348.271) [-345.281] -- 0:00:46
255000 -- (-345.951) (-346.306) (-348.522) [-345.727] * (-345.347) (-345.309) (-353.775) [-346.135] -- 0:00:46
Average standard deviation of split frequencies: 0.011867
255500 -- (-347.563) [-346.111] (-348.290) (-346.209) * (-346.481) (-347.258) (-347.313) [-345.505] -- 0:00:46
256000 -- (-345.907) [-348.786] (-345.827) (-348.279) * (-345.494) [-345.581] (-347.154) (-346.823) -- 0:00:46
256500 -- (-344.883) (-345.000) (-347.354) [-347.670] * (-345.739) (-347.668) (-345.840) [-346.185] -- 0:00:46
257000 -- (-346.628) (-347.042) [-347.183] (-345.096) * [-346.059] (-346.629) (-345.254) (-351.822) -- 0:00:46
257500 -- [-346.892] (-347.036) (-345.764) (-347.743) * (-345.994) [-346.794] (-348.102) (-346.112) -- 0:00:46
258000 -- (-347.755) (-349.644) [-346.765] (-345.972) * (-349.093) [-350.037] (-349.151) (-346.888) -- 0:00:46
258500 -- (-346.769) (-345.314) (-347.492) [-346.327] * (-347.843) (-348.662) [-351.025] (-349.511) -- 0:00:45
259000 -- [-347.618] (-348.430) (-349.014) (-349.092) * (-345.626) (-346.773) [-347.994] (-353.051) -- 0:00:45
259500 -- [-347.407] (-347.898) (-348.719) (-345.027) * (-345.235) [-345.243] (-346.128) (-347.799) -- 0:00:45
260000 -- (-346.076) (-347.034) [-344.907] (-345.548) * (-350.650) [-349.051] (-345.376) (-347.215) -- 0:00:45
Average standard deviation of split frequencies: 0.012446
260500 -- (-353.232) (-348.358) [-349.551] (-346.827) * (-346.581) (-345.476) [-345.226] (-346.047) -- 0:00:45
261000 -- [-345.500] (-347.657) (-345.022) (-348.846) * (-347.913) (-348.503) [-345.845] (-347.017) -- 0:00:45
261500 -- (-346.428) [-348.248] (-346.191) (-348.149) * (-347.530) (-346.456) [-345.696] (-344.948) -- 0:00:45
262000 -- [-347.736] (-347.664) (-347.267) (-346.054) * (-345.452) (-346.105) [-347.038] (-347.278) -- 0:00:45
262500 -- [-345.777] (-349.058) (-346.611) (-345.451) * (-345.125) [-345.318] (-348.833) (-348.634) -- 0:00:44
263000 -- (-347.238) (-346.825) [-346.218] (-347.589) * (-346.247) (-348.099) [-348.566] (-348.949) -- 0:00:44
263500 -- [-345.979] (-346.349) (-346.429) (-346.578) * (-346.939) (-350.802) (-346.944) [-350.065] -- 0:00:44
264000 -- (-348.948) (-347.326) (-349.788) [-345.116] * [-344.537] (-346.291) (-348.795) (-348.600) -- 0:00:44
264500 -- (-346.508) (-346.444) (-348.953) [-345.087] * (-344.969) (-346.435) [-347.926] (-349.226) -- 0:00:44
265000 -- (-346.647) [-346.230] (-350.339) (-346.776) * (-345.495) (-346.542) [-344.802] (-346.235) -- 0:00:44
Average standard deviation of split frequencies: 0.012701
265500 -- (-348.421) (-350.225) [-347.886] (-345.279) * (-345.746) (-345.482) (-346.439) [-345.602] -- 0:00:44
266000 -- [-349.305] (-348.348) (-347.295) (-345.916) * (-347.931) [-347.324] (-349.110) (-346.710) -- 0:00:44
266500 -- (-347.994) [-348.655] (-350.010) (-347.757) * [-345.484] (-347.000) (-347.150) (-347.670) -- 0:00:44
267000 -- (-347.052) (-347.283) [-346.607] (-345.553) * (-345.140) (-349.393) (-345.601) [-348.685] -- 0:00:43
267500 -- (-346.453) [-346.409] (-347.027) (-347.707) * (-347.009) (-352.435) [-344.576] (-346.700) -- 0:00:43
268000 -- (-346.812) (-347.229) (-345.136) [-345.901] * (-346.980) (-351.199) [-349.527] (-348.014) -- 0:00:43
268500 -- (-345.009) (-347.401) [-345.334] (-346.071) * (-347.843) (-346.200) (-348.580) [-346.993] -- 0:00:46
269000 -- (-346.032) (-348.718) [-346.054] (-347.869) * [-348.338] (-344.747) (-345.803) (-349.335) -- 0:00:46
269500 -- (-346.730) (-345.987) (-349.997) [-348.371] * (-346.339) [-346.078] (-347.951) (-346.488) -- 0:00:46
270000 -- [-347.072] (-350.869) (-349.688) (-345.703) * (-345.164) [-345.490] (-344.577) (-349.406) -- 0:00:45
Average standard deviation of split frequencies: 0.012806
270500 -- (-351.348) (-345.728) (-345.816) [-344.690] * (-348.286) (-345.879) [-346.938] (-347.177) -- 0:00:45
271000 -- (-348.418) (-347.066) (-346.986) [-346.340] * [-346.221] (-348.261) (-344.683) (-346.566) -- 0:00:45
271500 -- (-351.174) (-358.432) [-346.468] (-344.746) * [-349.420] (-349.460) (-345.277) (-345.804) -- 0:00:45
272000 -- [-347.620] (-352.711) (-347.393) (-347.723) * [-348.715] (-345.881) (-344.942) (-345.032) -- 0:00:45
272500 -- (-347.652) (-347.251) [-347.074] (-347.291) * (-346.799) [-346.057] (-344.282) (-346.176) -- 0:00:45
273000 -- [-346.604] (-346.492) (-345.113) (-346.450) * (-346.586) (-348.039) [-344.804] (-348.157) -- 0:00:45
273500 -- [-346.087] (-349.955) (-347.121) (-346.393) * (-345.488) (-346.870) [-345.858] (-345.093) -- 0:00:45
274000 -- (-346.736) (-347.242) (-346.211) [-346.877] * (-346.037) (-345.001) [-344.996] (-345.223) -- 0:00:45
274500 -- [-345.845] (-353.200) (-347.347) (-345.478) * (-345.655) (-346.021) (-345.650) [-346.774] -- 0:00:44
275000 -- [-346.651] (-344.612) (-346.344) (-347.725) * (-344.684) [-345.830] (-346.648) (-345.686) -- 0:00:44
Average standard deviation of split frequencies: 0.012860
275500 -- (-345.926) (-346.915) [-345.024] (-345.998) * [-344.694] (-344.912) (-350.225) (-346.837) -- 0:00:44
276000 -- (-348.502) [-346.763] (-344.431) (-347.441) * (-347.459) [-352.030] (-349.276) (-346.391) -- 0:00:44
276500 -- (-348.551) (-346.075) [-345.085] (-349.133) * (-347.729) (-351.133) (-346.196) [-347.193] -- 0:00:44
277000 -- (-348.647) (-348.691) [-349.134] (-345.136) * (-345.984) [-345.202] (-345.607) (-346.385) -- 0:00:44
277500 -- [-347.932] (-348.792) (-349.050) (-347.155) * (-344.739) (-345.881) [-351.366] (-345.221) -- 0:00:44
278000 -- (-348.102) [-347.955] (-350.588) (-347.662) * (-344.866) (-348.248) (-349.676) [-348.147] -- 0:00:44
278500 -- [-347.599] (-350.134) (-345.891) (-344.604) * (-347.707) (-346.581) (-351.318) [-346.639] -- 0:00:44
279000 -- (-346.161) (-346.624) (-347.350) [-345.014] * [-346.333] (-347.145) (-345.733) (-347.522) -- 0:00:43
279500 -- (-346.868) [-346.366] (-344.379) (-345.001) * (-345.368) (-344.528) [-346.280] (-346.544) -- 0:00:43
280000 -- (-347.316) [-344.695] (-349.971) (-350.826) * (-347.850) (-353.099) [-347.424] (-346.396) -- 0:00:43
Average standard deviation of split frequencies: 0.013239
280500 -- (-345.932) [-346.646] (-347.463) (-356.649) * [-345.195] (-345.225) (-347.952) (-345.953) -- 0:00:43
281000 -- [-348.433] (-352.306) (-347.037) (-348.697) * [-346.007] (-348.487) (-348.152) (-347.925) -- 0:00:43
281500 -- (-344.724) (-348.509) [-345.823] (-347.439) * (-347.914) (-345.824) (-350.839) [-344.548] -- 0:00:43
282000 -- (-345.705) (-346.709) [-348.659] (-347.192) * (-346.786) (-347.509) (-347.460) [-346.986] -- 0:00:43
282500 -- (-345.156) (-347.985) (-347.571) [-346.820] * (-348.671) (-348.353) (-349.953) [-349.285] -- 0:00:43
283000 -- [-345.905] (-344.331) (-345.726) (-349.650) * (-347.071) (-345.968) [-347.571] (-349.232) -- 0:00:43
283500 -- (-347.218) (-345.572) (-351.068) [-344.689] * (-345.785) (-345.932) [-348.214] (-352.796) -- 0:00:42
284000 -- (-345.365) [-346.199] (-345.754) (-344.753) * [-344.728] (-347.184) (-351.003) (-346.318) -- 0:00:42
284500 -- (-346.153) (-345.129) (-344.750) [-350.129] * (-353.078) [-347.136] (-349.568) (-346.507) -- 0:00:42
285000 -- [-348.162] (-346.304) (-347.359) (-347.775) * (-347.434) [-347.640] (-345.977) (-345.615) -- 0:00:42
Average standard deviation of split frequencies: 0.014651
285500 -- (-349.401) (-346.950) [-345.786] (-347.733) * (-345.530) (-353.008) (-348.717) [-347.555] -- 0:00:45
286000 -- (-348.914) (-348.226) [-346.615] (-345.833) * (-347.247) [-348.213] (-347.318) (-346.611) -- 0:00:44
286500 -- [-348.155] (-348.144) (-346.251) (-345.671) * (-345.209) [-346.307] (-346.586) (-355.293) -- 0:00:44
287000 -- (-346.360) (-345.372) [-344.949] (-345.427) * [-345.934] (-346.700) (-346.076) (-346.770) -- 0:00:44
287500 -- [-346.679] (-347.240) (-346.342) (-347.740) * (-344.671) [-345.218] (-347.574) (-350.411) -- 0:00:44
288000 -- (-345.778) (-344.873) (-347.263) [-349.007] * (-346.428) [-344.793] (-344.889) (-348.358) -- 0:00:44
288500 -- (-349.686) (-346.375) [-349.968] (-351.056) * [-346.937] (-349.870) (-347.945) (-345.434) -- 0:00:44
289000 -- (-345.926) (-346.463) (-349.180) [-345.437] * [-347.921] (-349.896) (-345.497) (-346.819) -- 0:00:44
289500 -- (-346.024) (-347.119) (-345.401) [-345.246] * [-346.236] (-344.882) (-345.610) (-345.722) -- 0:00:44
290000 -- (-345.438) (-345.610) [-346.244] (-347.281) * [-348.277] (-346.722) (-347.638) (-347.078) -- 0:00:44
Average standard deviation of split frequencies: 0.013966
290500 -- (-346.701) [-346.229] (-349.801) (-346.913) * [-348.072] (-353.463) (-348.624) (-346.900) -- 0:00:43
291000 -- (-349.367) (-346.950) (-348.105) [-345.304] * (-348.837) (-345.500) [-346.375] (-349.845) -- 0:00:43
291500 -- [-351.358] (-345.768) (-348.986) (-347.948) * (-348.456) [-349.177] (-347.036) (-346.970) -- 0:00:43
292000 -- (-347.007) (-349.565) (-347.730) [-346.189] * (-345.100) [-345.161] (-349.148) (-345.879) -- 0:00:43
292500 -- (-353.896) (-346.710) [-344.528] (-347.548) * (-344.991) (-347.707) (-352.222) [-347.181] -- 0:00:43
293000 -- (-354.194) [-345.349] (-345.046) (-348.138) * (-345.915) (-345.241) [-350.251] (-347.067) -- 0:00:43
293500 -- (-352.492) (-350.963) [-346.778] (-345.680) * (-345.301) (-347.269) [-346.940] (-346.503) -- 0:00:43
294000 -- [-351.938] (-347.241) (-348.254) (-345.503) * (-345.419) (-345.176) [-346.930] (-346.021) -- 0:00:43
294500 -- (-344.956) [-346.105] (-346.812) (-345.737) * [-347.702] (-345.931) (-348.937) (-348.232) -- 0:00:43
295000 -- (-345.291) (-345.101) [-347.133] (-347.786) * (-350.466) (-346.528) [-348.640] (-348.986) -- 0:00:43
Average standard deviation of split frequencies: 0.014687
295500 -- (-346.729) (-350.384) (-348.711) [-346.509] * [-346.770] (-345.562) (-346.813) (-347.633) -- 0:00:42
296000 -- (-344.398) [-346.009] (-346.310) (-346.987) * (-345.838) (-345.741) [-348.345] (-345.765) -- 0:00:42
296500 -- (-347.344) (-347.912) [-346.549] (-352.334) * [-346.725] (-351.262) (-346.857) (-349.155) -- 0:00:42
297000 -- (-348.195) (-347.860) (-345.451) [-346.836] * (-346.659) (-347.176) [-347.259] (-346.960) -- 0:00:42
297500 -- [-345.896] (-345.158) (-344.793) (-345.452) * [-349.105] (-350.474) (-350.627) (-347.348) -- 0:00:42
298000 -- (-345.741) [-347.563] (-348.707) (-347.450) * (-347.965) (-349.428) (-347.540) [-349.338] -- 0:00:42
298500 -- [-346.543] (-346.990) (-353.475) (-346.513) * (-347.873) (-347.748) [-348.309] (-345.006) -- 0:00:42
299000 -- (-346.055) [-345.416] (-347.916) (-347.047) * [-346.631] (-346.316) (-345.377) (-346.890) -- 0:00:42
299500 -- (-346.897) (-348.140) (-347.618) [-346.474] * (-345.830) (-348.377) [-349.622] (-346.684) -- 0:00:42
300000 -- (-347.785) (-345.780) (-347.032) [-345.993] * (-346.553) (-346.407) (-344.804) [-346.352] -- 0:00:42
Average standard deviation of split frequencies: 0.014372
300500 -- (-347.411) (-345.200) (-344.959) [-347.995] * (-347.097) (-345.395) [-346.265] (-346.385) -- 0:00:41
301000 -- [-349.355] (-351.798) (-346.685) (-348.025) * (-346.910) (-346.835) (-346.536) [-345.927] -- 0:00:41
301500 -- (-346.106) [-346.704] (-348.465) (-348.114) * (-347.078) (-345.475) [-346.998] (-346.454) -- 0:00:41
302000 -- (-347.265) (-345.415) [-347.033] (-347.782) * (-349.184) [-347.792] (-350.755) (-346.681) -- 0:00:43
302500 -- [-346.254] (-348.388) (-346.006) (-347.388) * [-348.855] (-346.547) (-346.704) (-345.777) -- 0:00:43
303000 -- (-345.600) (-349.087) [-346.528] (-345.881) * (-348.770) (-351.560) (-349.496) [-346.163] -- 0:00:43
303500 -- (-345.038) (-347.203) [-350.099] (-348.138) * [-346.068] (-347.545) (-346.965) (-345.020) -- 0:00:43
304000 -- (-345.531) (-345.790) (-347.623) [-345.192] * [-349.877] (-348.992) (-345.491) (-349.988) -- 0:00:43
304500 -- (-345.021) (-347.156) [-345.855] (-345.673) * (-346.259) (-347.399) [-346.519] (-349.022) -- 0:00:43
305000 -- [-347.666] (-346.143) (-347.802) (-349.233) * [-345.793] (-346.638) (-345.240) (-353.901) -- 0:00:43
Average standard deviation of split frequencies: 0.014806
305500 -- [-349.216] (-346.308) (-351.664) (-346.167) * [-348.103] (-345.080) (-345.834) (-349.661) -- 0:00:43
306000 -- (-346.484) (-346.749) (-347.391) [-347.693] * (-349.717) (-345.049) (-346.006) [-348.658] -- 0:00:43
306500 -- (-346.408) [-347.646] (-345.835) (-346.118) * [-345.398] (-347.277) (-347.046) (-347.306) -- 0:00:42
307000 -- [-346.216] (-345.535) (-347.019) (-347.851) * (-345.038) (-349.409) (-347.217) [-345.846] -- 0:00:42
307500 -- (-345.541) [-348.343] (-346.480) (-348.093) * (-346.495) [-347.252] (-344.819) (-345.857) -- 0:00:42
308000 -- (-344.707) (-346.309) [-346.814] (-353.240) * (-353.304) [-346.392] (-347.575) (-347.316) -- 0:00:42
308500 -- [-346.746] (-346.283) (-345.929) (-350.245) * (-347.810) (-345.682) (-348.060) [-347.416] -- 0:00:42
309000 -- (-345.465) [-345.185] (-347.414) (-346.362) * (-346.716) [-346.637] (-347.495) (-346.001) -- 0:00:42
309500 -- (-347.840) (-345.794) [-345.123] (-345.825) * (-348.958) (-345.936) (-347.251) [-345.230] -- 0:00:42
310000 -- (-344.926) (-346.946) [-345.553] (-346.019) * [-346.035] (-347.989) (-350.578) (-346.221) -- 0:00:42
Average standard deviation of split frequencies: 0.015258
310500 -- (-346.419) (-346.805) (-345.679) [-348.712] * [-346.854] (-346.350) (-345.368) (-346.899) -- 0:00:42
311000 -- (-345.504) (-345.742) (-347.156) [-349.928] * (-344.981) (-345.218) [-345.077] (-346.831) -- 0:00:42
311500 -- (-347.701) (-344.664) (-347.790) [-349.293] * (-345.597) (-347.424) (-346.754) [-344.965] -- 0:00:41
312000 -- (-352.402) [-346.252] (-346.549) (-347.078) * (-349.306) [-345.910] (-347.933) (-351.390) -- 0:00:41
312500 -- (-346.696) (-347.660) (-346.151) [-348.763] * [-349.620] (-345.784) (-346.280) (-349.753) -- 0:00:41
313000 -- (-346.531) (-347.321) (-351.420) [-348.313] * [-349.002] (-346.440) (-348.707) (-347.506) -- 0:00:41
313500 -- (-344.381) [-351.441] (-352.814) (-346.502) * (-347.523) (-345.047) (-346.507) [-345.037] -- 0:00:41
314000 -- (-346.699) (-344.937) [-345.699] (-348.632) * (-345.486) [-346.115] (-347.626) (-346.236) -- 0:00:41
314500 -- (-349.990) (-353.836) [-346.420] (-345.324) * (-345.318) [-345.599] (-346.069) (-346.253) -- 0:00:41
315000 -- (-347.664) (-347.873) [-345.376] (-347.305) * [-345.811] (-346.209) (-350.656) (-348.108) -- 0:00:41
Average standard deviation of split frequencies: 0.015830
315500 -- (-345.206) (-350.076) [-346.763] (-349.336) * (-347.880) (-345.265) (-348.203) [-347.217] -- 0:00:41
316000 -- (-345.574) [-345.969] (-344.972) (-349.389) * (-348.875) [-346.404] (-350.214) (-347.909) -- 0:00:41
316500 -- [-347.221] (-345.681) (-345.568) (-348.083) * (-345.884) (-347.347) [-345.621] (-345.587) -- 0:00:41
317000 -- (-346.994) (-347.616) (-348.422) [-345.823] * (-345.123) (-348.298) (-347.812) [-345.801] -- 0:00:40
317500 -- (-344.841) [-347.660] (-345.092) (-344.400) * (-344.443) (-344.960) [-345.060] (-344.647) -- 0:00:40
318000 -- (-348.746) (-347.531) [-344.634] (-346.296) * (-346.206) [-347.589] (-346.041) (-344.330) -- 0:00:40
318500 -- (-346.189) (-348.396) (-347.069) [-344.624] * (-348.086) (-347.646) [-346.465] (-344.844) -- 0:00:40
319000 -- [-345.523] (-345.898) (-349.907) (-346.696) * (-345.821) (-345.796) [-344.983] (-346.045) -- 0:00:42
319500 -- (-349.550) (-344.739) [-345.830] (-344.937) * (-348.713) [-346.658] (-344.739) (-346.019) -- 0:00:42
320000 -- [-346.542] (-345.094) (-346.843) (-345.058) * (-346.825) (-347.617) (-346.484) [-350.845] -- 0:00:42
Average standard deviation of split frequencies: 0.015652
320500 -- [-346.285] (-345.445) (-348.728) (-348.299) * (-349.891) [-345.079] (-346.306) (-346.183) -- 0:00:42
321000 -- (-347.851) (-346.922) (-346.715) [-345.617] * (-346.959) [-345.100] (-344.428) (-345.015) -- 0:00:42
321500 -- (-349.005) [-346.234] (-346.980) (-345.456) * (-348.561) (-348.014) (-347.865) [-345.503] -- 0:00:42
322000 -- (-345.780) (-345.292) (-347.249) [-347.151] * (-348.156) (-346.505) (-345.575) [-345.392] -- 0:00:42
322500 -- (-346.708) (-346.622) [-346.589] (-347.053) * (-345.239) (-345.610) (-347.289) [-345.720] -- 0:00:42
323000 -- (-348.523) (-346.498) [-344.826] (-348.063) * (-347.302) [-347.611] (-344.803) (-346.529) -- 0:00:41
323500 -- (-346.265) (-345.788) [-344.742] (-345.257) * (-348.650) (-345.705) [-345.855] (-345.975) -- 0:00:41
324000 -- (-345.321) (-346.460) (-347.051) [-346.042] * (-345.978) [-346.147] (-346.109) (-347.798) -- 0:00:41
324500 -- (-345.708) (-346.589) (-347.466) [-349.562] * (-344.946) [-345.724] (-349.027) (-347.622) -- 0:00:41
325000 -- (-345.865) (-346.411) (-346.369) [-346.515] * (-348.139) [-345.455] (-347.170) (-344.905) -- 0:00:41
Average standard deviation of split frequencies: 0.014380
325500 -- (-346.809) (-346.364) (-347.029) [-344.947] * (-349.212) (-345.697) [-346.048] (-345.231) -- 0:00:41
326000 -- (-348.831) (-347.123) (-349.738) [-345.142] * (-345.307) [-346.676] (-346.132) (-346.170) -- 0:00:41
326500 -- (-346.129) (-345.967) (-348.870) [-346.049] * (-346.737) [-345.633] (-346.622) (-346.072) -- 0:00:41
327000 -- (-347.987) [-346.850] (-344.893) (-346.877) * (-346.616) [-344.787] (-348.979) (-350.600) -- 0:00:41
327500 -- (-347.246) (-349.970) (-351.927) [-347.953] * (-350.232) [-347.349] (-346.258) (-347.560) -- 0:00:41
328000 -- [-350.432] (-348.101) (-346.723) (-347.990) * (-350.037) (-348.013) (-347.545) [-346.422] -- 0:00:40
328500 -- (-346.439) [-344.726] (-351.533) (-345.990) * (-347.287) (-349.706) (-347.663) [-346.430] -- 0:00:40
329000 -- [-347.851] (-344.718) (-346.760) (-347.801) * (-346.684) [-346.103] (-349.135) (-346.271) -- 0:00:40
329500 -- (-351.523) [-346.449] (-347.193) (-346.502) * (-345.342) (-346.205) (-348.634) [-346.875] -- 0:00:40
330000 -- [-348.665] (-345.090) (-345.776) (-346.112) * (-349.803) [-346.140] (-348.498) (-349.292) -- 0:00:40
Average standard deviation of split frequencies: 0.014177
330500 -- [-349.361] (-347.540) (-345.126) (-348.700) * [-347.185] (-344.657) (-347.633) (-349.005) -- 0:00:40
331000 -- (-346.090) (-350.604) [-344.974] (-346.525) * (-347.123) (-344.450) (-346.866) [-348.300] -- 0:00:40
331500 -- (-350.193) [-347.271] (-346.284) (-345.428) * (-344.724) [-347.249] (-348.361) (-346.964) -- 0:00:40
332000 -- [-346.649] (-348.005) (-346.086) (-347.160) * (-350.139) [-347.223] (-346.755) (-347.041) -- 0:00:40
332500 -- (-349.003) (-349.611) (-348.885) [-345.162] * (-348.121) [-351.299] (-351.279) (-347.066) -- 0:00:40
333000 -- [-344.829] (-346.684) (-353.969) (-348.603) * (-349.861) (-347.208) (-348.925) [-349.052] -- 0:00:40
333500 -- (-345.781) (-352.566) (-345.455) [-346.953] * [-346.279] (-350.870) (-346.295) (-345.699) -- 0:00:39
334000 -- [-347.449] (-348.253) (-345.872) (-348.387) * (-346.980) (-349.792) [-344.977] (-353.506) -- 0:00:39
334500 -- (-346.863) (-345.397) (-344.754) [-344.827] * (-345.552) (-345.444) [-346.659] (-351.938) -- 0:00:39
335000 -- [-345.276] (-347.072) (-344.755) (-348.103) * (-346.018) (-345.184) [-346.613] (-350.619) -- 0:00:39
Average standard deviation of split frequencies: 0.014186
335500 -- (-348.933) (-346.370) (-345.958) [-345.603] * (-345.138) (-345.511) [-347.398] (-348.061) -- 0:00:39
336000 -- (-346.445) [-347.937] (-345.553) (-345.030) * (-348.921) [-344.725] (-345.886) (-347.615) -- 0:00:41
336500 -- (-345.834) (-348.136) (-345.943) [-346.295] * (-350.529) (-347.024) (-346.492) [-346.104] -- 0:00:41
337000 -- (-347.428) (-349.500) (-345.836) [-345.881] * (-347.336) [-351.293] (-349.202) (-347.748) -- 0:00:41
337500 -- (-346.468) (-346.569) (-347.563) [-349.646] * (-345.782) [-347.359] (-350.866) (-346.094) -- 0:00:41
338000 -- (-346.042) (-350.008) [-347.575] (-349.633) * (-346.397) (-347.075) (-348.563) [-348.224] -- 0:00:41
338500 -- [-345.126] (-346.358) (-349.365) (-351.875) * (-346.937) (-347.483) [-345.148] (-349.471) -- 0:00:41
339000 -- (-344.538) (-345.246) [-345.337] (-348.146) * (-349.351) [-346.466] (-345.176) (-347.045) -- 0:00:40
339500 -- (-345.929) [-347.064] (-346.822) (-345.790) * (-349.976) (-345.253) [-344.434] (-345.908) -- 0:00:40
340000 -- (-346.068) [-347.137] (-346.469) (-348.337) * (-353.386) [-349.372] (-344.488) (-351.003) -- 0:00:40
Average standard deviation of split frequencies: 0.013907
340500 -- (-346.123) (-345.394) (-346.547) [-345.794] * (-353.566) (-353.345) [-345.779] (-346.380) -- 0:00:40
341000 -- (-349.325) (-347.183) (-348.720) [-345.735] * (-347.730) [-346.751] (-349.048) (-348.116) -- 0:00:40
341500 -- [-353.419] (-345.401) (-350.884) (-347.592) * (-346.014) (-351.444) [-347.067] (-349.243) -- 0:00:40
342000 -- (-345.814) [-347.461] (-346.014) (-347.814) * (-344.889) (-349.965) [-344.979] (-345.576) -- 0:00:40
342500 -- (-345.266) (-347.140) (-346.141) [-350.187] * [-345.021] (-346.060) (-347.215) (-346.154) -- 0:00:40
343000 -- (-345.056) (-347.134) (-346.938) [-345.707] * [-346.229] (-346.460) (-345.322) (-345.819) -- 0:00:40
343500 -- (-346.606) (-346.293) (-348.238) [-345.446] * (-344.979) (-348.695) [-346.623] (-349.968) -- 0:00:40
344000 -- (-347.976) (-345.715) (-348.291) [-345.675] * (-346.694) (-346.699) [-347.192] (-347.980) -- 0:00:40
344500 -- (-347.340) [-347.098] (-347.312) (-346.302) * (-347.747) [-348.110] (-345.709) (-350.372) -- 0:00:39
345000 -- (-348.505) (-349.081) [-348.753] (-345.155) * (-345.797) [-346.639] (-346.368) (-350.563) -- 0:00:39
Average standard deviation of split frequencies: 0.013148
345500 -- [-346.662] (-345.703) (-346.988) (-345.913) * [-346.243] (-348.386) (-348.421) (-346.809) -- 0:00:39
346000 -- (-346.433) [-348.704] (-347.241) (-345.810) * (-350.617) [-345.586] (-350.738) (-346.658) -- 0:00:39
346500 -- (-346.352) (-348.935) (-345.920) [-349.002] * (-349.718) (-348.170) [-346.651] (-346.606) -- 0:00:39
347000 -- (-346.572) (-348.234) (-345.656) [-346.146] * (-348.965) (-347.707) (-347.028) [-347.843] -- 0:00:39
347500 -- [-344.635] (-348.166) (-346.259) (-348.165) * (-348.061) (-346.709) (-347.460) [-350.409] -- 0:00:39
348000 -- (-345.352) [-345.143] (-346.407) (-348.170) * (-349.133) (-347.449) [-345.226] (-344.535) -- 0:00:39
348500 -- [-346.568] (-346.544) (-346.210) (-347.852) * (-345.180) [-349.728] (-345.116) (-346.060) -- 0:00:39
349000 -- [-347.262] (-345.837) (-347.130) (-349.561) * [-346.711] (-349.251) (-345.141) (-346.227) -- 0:00:39
349500 -- [-346.193] (-348.389) (-347.698) (-349.047) * (-350.732) (-346.536) (-347.032) [-345.758] -- 0:00:39
350000 -- (-346.877) (-347.674) (-350.194) [-346.598] * (-346.477) [-345.759] (-346.557) (-347.101) -- 0:00:39
Average standard deviation of split frequencies: 0.014190
350500 -- (-346.916) (-345.945) [-346.755] (-347.128) * [-347.642] (-345.276) (-347.200) (-348.442) -- 0:00:38
351000 -- (-348.276) (-345.409) [-347.884] (-346.164) * (-347.290) (-345.225) [-348.040] (-347.798) -- 0:00:38
351500 -- (-347.038) [-347.045] (-345.703) (-345.110) * (-351.068) (-346.118) [-345.680] (-346.710) -- 0:00:38
352000 -- (-346.085) (-348.607) [-344.420] (-345.118) * [-345.313] (-346.887) (-349.530) (-351.049) -- 0:00:38
352500 -- (-345.183) [-344.516] (-347.168) (-352.526) * (-348.496) [-346.339] (-350.412) (-349.134) -- 0:00:40
353000 -- (-346.077) (-346.027) (-346.995) [-346.204] * (-345.292) (-346.916) [-348.293] (-345.724) -- 0:00:40
353500 -- [-349.918] (-346.589) (-345.913) (-346.275) * (-346.385) (-346.654) [-346.362] (-345.550) -- 0:00:40
354000 -- (-347.168) [-346.687] (-348.270) (-352.971) * (-346.000) (-345.807) (-348.219) [-346.064] -- 0:00:40
354500 -- [-345.576] (-346.834) (-349.009) (-346.450) * (-348.456) (-345.640) [-344.963] (-345.387) -- 0:00:40
355000 -- [-345.512] (-345.792) (-347.809) (-348.673) * (-346.306) (-349.872) (-345.986) [-346.184] -- 0:00:39
Average standard deviation of split frequencies: 0.014345
355500 -- (-344.945) (-348.730) [-346.109] (-349.300) * (-347.867) (-345.709) (-345.400) [-350.143] -- 0:00:39
356000 -- (-344.864) (-348.097) [-344.348] (-348.869) * (-349.759) (-349.259) (-348.932) [-346.327] -- 0:00:39
356500 -- (-346.454) (-349.627) (-344.829) [-344.842] * [-346.098] (-347.838) (-351.539) (-349.438) -- 0:00:39
357000 -- (-345.071) [-347.456] (-344.741) (-352.236) * (-349.746) [-347.121] (-350.237) (-348.878) -- 0:00:39
357500 -- [-351.265] (-349.873) (-347.639) (-349.799) * (-346.706) [-346.574] (-348.440) (-345.221) -- 0:00:39
358000 -- (-346.452) (-349.382) [-346.218] (-346.964) * (-350.078) [-348.737] (-346.749) (-348.615) -- 0:00:39
358500 -- (-345.594) [-348.134] (-345.999) (-347.175) * (-348.241) (-348.548) [-349.112] (-345.843) -- 0:00:39
359000 -- (-347.717) (-345.959) (-345.090) [-346.676] * (-350.154) (-346.109) [-345.327] (-351.736) -- 0:00:39
359500 -- (-346.536) (-350.221) [-347.536] (-349.606) * [-351.022] (-346.780) (-344.644) (-347.603) -- 0:00:39
360000 -- [-346.195] (-349.624) (-353.070) (-345.624) * (-355.656) (-347.391) [-350.786] (-345.649) -- 0:00:39
Average standard deviation of split frequencies: 0.014595
360500 -- [-345.933] (-346.266) (-347.042) (-347.422) * (-347.634) (-346.550) [-350.695] (-345.164) -- 0:00:39
361000 -- [-345.611] (-345.504) (-347.643) (-347.053) * (-346.454) [-345.178] (-348.197) (-346.525) -- 0:00:38
361500 -- [-347.156] (-346.443) (-349.676) (-346.017) * [-347.766] (-344.620) (-346.075) (-344.855) -- 0:00:38
362000 -- [-346.073] (-348.383) (-346.657) (-345.117) * (-346.309) [-345.807] (-347.801) (-345.160) -- 0:00:38
362500 -- (-345.423) (-348.094) (-349.761) [-345.781] * (-352.394) (-345.169) [-345.244] (-350.756) -- 0:00:38
363000 -- (-346.450) (-347.267) (-348.892) [-347.859] * (-346.146) (-348.056) [-346.584] (-347.301) -- 0:00:38
363500 -- [-349.501] (-347.576) (-350.960) (-346.317) * (-347.731) (-344.978) [-350.032] (-346.309) -- 0:00:38
364000 -- (-345.422) (-348.451) (-346.698) [-350.312] * [-345.138] (-346.433) (-351.819) (-349.696) -- 0:00:38
364500 -- (-346.777) (-345.150) [-347.618] (-346.273) * (-347.863) [-347.215] (-346.963) (-349.894) -- 0:00:38
365000 -- (-349.442) (-346.051) [-344.773] (-345.435) * (-346.149) (-347.006) [-346.139] (-350.683) -- 0:00:38
Average standard deviation of split frequencies: 0.015388
365500 -- (-346.782) [-346.046] (-347.677) (-346.997) * [-346.183] (-345.354) (-346.513) (-347.573) -- 0:00:38
366000 -- [-345.917] (-347.766) (-348.189) (-348.308) * (-346.407) [-346.529] (-345.270) (-348.354) -- 0:00:38
366500 -- (-344.582) [-346.700] (-347.885) (-348.145) * [-345.735] (-345.667) (-346.391) (-347.827) -- 0:00:38
367000 -- (-347.040) [-348.682] (-345.236) (-345.690) * [-345.342] (-348.204) (-348.964) (-346.775) -- 0:00:37
367500 -- (-346.069) [-345.144] (-352.832) (-348.163) * (-346.251) (-347.180) [-347.558] (-346.809) -- 0:00:37
368000 -- (-347.705) (-348.473) [-345.312] (-347.002) * (-346.266) (-347.153) [-346.287] (-346.411) -- 0:00:37
368500 -- (-347.587) (-347.139) (-346.475) [-349.353] * (-345.322) [-347.423] (-345.178) (-347.717) -- 0:00:37
369000 -- [-346.291] (-346.961) (-345.146) (-347.102) * [-345.800] (-347.433) (-348.298) (-348.197) -- 0:00:37
369500 -- (-345.976) [-350.141] (-344.844) (-348.788) * [-344.829] (-350.090) (-345.286) (-347.747) -- 0:00:39
370000 -- (-347.351) (-347.210) (-345.966) [-345.895] * (-345.672) [-347.448] (-345.750) (-345.354) -- 0:00:39
Average standard deviation of split frequencies: 0.013990
370500 -- [-347.005] (-345.736) (-348.671) (-345.317) * (-345.489) (-344.517) [-345.179] (-349.080) -- 0:00:39
371000 -- (-346.655) [-347.782] (-344.603) (-345.309) * (-353.249) (-352.166) [-346.802] (-345.522) -- 0:00:38
371500 -- (-346.130) [-350.509] (-345.010) (-345.701) * (-346.317) (-346.582) (-346.911) [-345.424] -- 0:00:38
372000 -- (-345.618) (-348.473) (-345.873) [-344.596] * (-348.159) (-345.743) [-346.610] (-345.355) -- 0:00:38
372500 -- (-345.359) (-347.528) (-346.057) [-346.345] * (-345.957) (-347.071) (-345.355) [-344.810] -- 0:00:38
373000 -- (-347.801) [-347.242] (-345.922) (-348.594) * [-345.894] (-346.898) (-345.630) (-346.479) -- 0:00:38
373500 -- (-347.322) [-348.165] (-346.953) (-349.114) * (-351.084) [-346.663] (-346.021) (-347.202) -- 0:00:38
374000 -- (-344.698) (-346.139) (-348.039) [-348.106] * (-352.548) (-346.502) [-347.430] (-346.952) -- 0:00:38
374500 -- (-348.155) (-346.441) [-346.558] (-345.111) * [-346.463] (-348.797) (-347.335) (-348.088) -- 0:00:38
375000 -- (-345.544) (-348.218) (-346.877) [-346.234] * (-345.991) (-344.966) [-346.160] (-346.755) -- 0:00:38
Average standard deviation of split frequencies: 0.013025
375500 -- (-345.324) [-346.463] (-344.889) (-346.644) * [-345.314] (-347.029) (-348.996) (-346.220) -- 0:00:38
376000 -- (-345.282) (-347.357) [-347.797] (-346.928) * (-350.152) (-350.630) [-347.757] (-349.166) -- 0:00:38
376500 -- (-346.729) (-346.936) [-346.789] (-348.294) * (-345.951) [-347.302] (-346.858) (-347.969) -- 0:00:38
377000 -- (-351.294) [-347.326] (-349.147) (-357.057) * [-346.501] (-346.141) (-347.091) (-350.057) -- 0:00:38
377500 -- (-348.271) (-352.232) [-344.551] (-351.293) * (-349.706) (-346.267) (-353.083) [-345.945] -- 0:00:37
378000 -- [-347.229] (-348.526) (-347.451) (-348.011) * (-345.114) [-347.185] (-348.516) (-351.841) -- 0:00:37
378500 -- (-345.425) (-346.005) [-346.330] (-350.285) * (-345.621) [-345.763] (-347.222) (-348.160) -- 0:00:37
379000 -- [-347.590] (-345.501) (-346.238) (-346.549) * (-346.198) (-345.339) [-347.351] (-346.296) -- 0:00:37
379500 -- (-345.716) (-349.162) [-347.248] (-349.406) * [-345.654] (-344.990) (-345.139) (-347.524) -- 0:00:37
380000 -- (-345.928) (-350.233) (-347.515) [-345.941] * [-347.329] (-345.097) (-347.437) (-349.033) -- 0:00:37
Average standard deviation of split frequencies: 0.013347
380500 -- [-344.697] (-346.729) (-347.385) (-345.845) * (-345.597) [-348.533] (-346.791) (-349.674) -- 0:00:37
381000 -- (-348.862) (-347.759) (-346.180) [-346.750] * (-345.594) [-346.555] (-345.611) (-349.026) -- 0:00:37
381500 -- (-350.599) (-346.678) [-345.626] (-346.775) * [-344.539] (-345.200) (-347.404) (-350.299) -- 0:00:37
382000 -- (-348.645) [-345.813] (-346.065) (-349.402) * [-348.131] (-345.275) (-347.367) (-351.579) -- 0:00:37
382500 -- (-345.564) (-344.990) (-347.741) [-347.385] * (-346.961) [-347.375] (-345.407) (-347.622) -- 0:00:37
383000 -- [-345.580] (-346.653) (-346.663) (-345.164) * (-347.555) (-347.674) [-344.486] (-345.513) -- 0:00:37
383500 -- [-346.554] (-348.841) (-345.359) (-348.525) * (-349.558) (-345.020) (-347.613) [-346.035] -- 0:00:36
384000 -- (-345.667) (-345.249) (-346.821) [-347.142] * (-348.239) (-346.780) [-347.933] (-346.966) -- 0:00:36
384500 -- (-346.640) [-347.219] (-347.277) (-345.996) * (-348.227) (-347.864) [-349.327] (-347.161) -- 0:00:36
385000 -- [-347.640] (-352.810) (-346.057) (-345.679) * (-347.794) (-346.319) (-346.872) [-345.227] -- 0:00:36
Average standard deviation of split frequencies: 0.013366
385500 -- [-351.293] (-346.148) (-346.975) (-345.069) * [-352.497] (-347.444) (-345.869) (-344.998) -- 0:00:36
386000 -- [-347.833] (-348.665) (-345.793) (-347.002) * (-345.600) (-348.425) [-345.086] (-345.884) -- 0:00:36
386500 -- (-345.812) (-351.267) (-346.878) [-344.867] * (-345.443) [-346.386] (-350.737) (-356.252) -- 0:00:38
387000 -- (-346.181) (-349.369) (-349.518) [-344.966] * (-352.702) (-345.020) [-348.373] (-347.395) -- 0:00:38
387500 -- (-351.970) (-347.749) [-346.524] (-346.174) * (-347.440) [-346.994] (-348.699) (-348.102) -- 0:00:37
388000 -- (-347.486) (-346.132) (-347.272) [-344.776] * [-348.707] (-345.728) (-346.662) (-346.010) -- 0:00:37
388500 -- (-347.514) (-345.951) (-345.572) [-346.427] * [-349.149] (-344.876) (-348.551) (-346.375) -- 0:00:37
389000 -- (-347.960) (-346.126) [-346.759] (-347.522) * (-347.560) [-347.391] (-348.631) (-348.238) -- 0:00:37
389500 -- (-346.812) (-344.525) [-344.944] (-345.143) * [-347.199] (-348.618) (-352.579) (-352.921) -- 0:00:37
390000 -- (-347.578) [-347.921] (-347.680) (-344.776) * (-348.193) [-347.101] (-348.916) (-347.065) -- 0:00:37
Average standard deviation of split frequencies: 0.013474
390500 -- (-347.898) [-346.914] (-345.990) (-344.580) * (-348.862) (-348.097) [-348.483] (-348.083) -- 0:00:37
391000 -- (-347.634) (-350.912) (-345.389) [-345.432] * (-345.194) [-344.696] (-346.283) (-346.754) -- 0:00:37
391500 -- [-346.018] (-345.689) (-346.224) (-348.497) * (-348.264) [-344.374] (-349.475) (-345.966) -- 0:00:37
392000 -- (-345.937) (-347.512) [-346.539] (-345.511) * [-347.638] (-344.787) (-346.047) (-346.099) -- 0:00:37
392500 -- (-348.238) (-347.771) [-349.280] (-345.370) * (-347.629) (-348.419) [-346.603] (-345.175) -- 0:00:37
393000 -- (-349.675) (-349.065) (-349.217) [-345.848] * [-347.048] (-350.017) (-344.605) (-350.540) -- 0:00:37
393500 -- (-348.798) (-346.084) [-348.345] (-347.680) * (-346.449) (-349.258) [-348.287] (-344.507) -- 0:00:36
394000 -- (-344.944) (-346.541) (-345.245) [-346.710] * (-346.478) [-346.430] (-348.689) (-345.599) -- 0:00:36
394500 -- (-348.052) (-347.705) [-345.419] (-347.999) * (-346.108) (-347.124) (-347.815) [-346.014] -- 0:00:36
395000 -- (-344.585) (-346.349) (-349.019) [-347.251] * (-345.465) [-347.245] (-345.264) (-346.913) -- 0:00:36
Average standard deviation of split frequencies: 0.012744
395500 -- (-348.250) (-345.776) [-345.289] (-346.556) * [-345.791] (-348.395) (-345.403) (-348.534) -- 0:00:36
396000 -- (-354.236) [-347.941] (-346.906) (-345.343) * [-345.766] (-344.950) (-348.811) (-346.267) -- 0:00:36
396500 -- [-350.047] (-347.870) (-346.953) (-346.275) * (-345.259) (-345.668) (-347.079) [-345.153] -- 0:00:36
397000 -- [-346.692] (-345.208) (-349.502) (-350.354) * (-351.119) (-348.729) [-347.058] (-346.900) -- 0:00:36
397500 -- (-345.092) (-349.306) [-348.391] (-346.590) * (-348.979) [-345.547] (-347.339) (-346.697) -- 0:00:36
398000 -- [-349.721] (-348.611) (-345.286) (-345.182) * (-347.735) (-348.862) [-346.111] (-351.881) -- 0:00:36
398500 -- (-346.454) (-347.532) [-348.421] (-344.887) * [-346.766] (-350.112) (-346.472) (-350.203) -- 0:00:36
399000 -- (-350.960) [-347.089] (-345.685) (-347.978) * [-346.396] (-347.392) (-346.382) (-348.319) -- 0:00:36
399500 -- (-346.776) (-347.100) (-347.159) [-345.106] * [-347.526] (-346.050) (-345.853) (-345.699) -- 0:00:36
400000 -- [-346.597] (-345.741) (-347.258) (-345.671) * [-348.912] (-347.131) (-345.533) (-345.915) -- 0:00:36
Average standard deviation of split frequencies: 0.012942
400500 -- (-345.047) (-349.002) (-345.613) [-348.261] * (-347.732) (-347.647) [-347.356] (-344.768) -- 0:00:35
401000 -- (-347.113) (-346.439) (-345.471) [-345.284] * (-346.490) (-347.238) [-347.364] (-345.246) -- 0:00:35
401500 -- (-345.265) (-349.301) [-345.323] (-348.111) * (-344.962) (-345.825) [-345.127] (-346.171) -- 0:00:35
402000 -- [-344.875] (-351.466) (-346.814) (-345.504) * (-346.365) (-345.898) [-347.876] (-345.030) -- 0:00:35
402500 -- [-345.431] (-349.480) (-348.963) (-347.046) * (-345.238) (-347.223) (-345.586) [-351.576] -- 0:00:35
403000 -- (-345.457) [-345.059] (-347.222) (-347.975) * (-346.486) (-347.330) (-344.384) [-346.934] -- 0:00:37
403500 -- (-345.453) [-350.762] (-347.331) (-348.832) * (-346.369) (-348.338) [-346.427] (-347.753) -- 0:00:36
404000 -- [-346.809] (-349.575) (-351.750) (-345.319) * (-347.254) (-344.394) [-345.269] (-346.066) -- 0:00:36
404500 -- (-347.661) (-354.584) (-348.052) [-348.324] * (-349.897) [-346.803] (-352.094) (-347.275) -- 0:00:36
405000 -- (-345.113) (-346.162) (-349.365) [-348.615] * [-349.329] (-347.861) (-346.780) (-344.729) -- 0:00:36
Average standard deviation of split frequencies: 0.012840
405500 -- (-346.284) [-344.288] (-349.835) (-348.161) * (-345.860) [-345.619] (-346.774) (-349.426) -- 0:00:36
406000 -- (-345.730) (-346.879) (-352.263) [-345.121] * [-345.600] (-347.744) (-346.655) (-347.347) -- 0:00:36
406500 -- (-347.134) (-345.782) (-346.091) [-344.899] * (-346.762) (-348.223) (-346.208) [-347.406] -- 0:00:36
407000 -- [-346.424] (-345.689) (-347.906) (-345.931) * [-346.657] (-345.466) (-344.970) (-346.424) -- 0:00:36
407500 -- (-345.579) (-346.962) [-346.686] (-345.319) * (-347.166) (-348.009) (-346.006) [-350.834] -- 0:00:36
408000 -- (-345.748) (-346.859) (-349.536) [-347.571] * (-345.603) (-346.864) [-346.542] (-347.790) -- 0:00:36
408500 -- (-348.290) (-345.575) [-345.756] (-344.838) * (-346.771) (-344.671) (-347.602) [-346.168] -- 0:00:36
409000 -- (-345.749) [-348.123] (-346.369) (-347.029) * [-346.568] (-345.778) (-347.552) (-347.863) -- 0:00:36
409500 -- (-347.779) (-347.608) (-344.801) [-344.879] * (-348.455) (-347.753) [-351.729] (-347.279) -- 0:00:36
410000 -- (-350.039) [-348.381] (-345.687) (-347.338) * (-346.702) (-347.102) [-347.032] (-347.691) -- 0:00:35
Average standard deviation of split frequencies: 0.014016
410500 -- (-349.104) (-346.649) (-349.360) [-345.231] * (-347.488) (-346.166) (-346.492) [-347.797] -- 0:00:35
411000 -- (-348.573) (-345.713) [-347.817] (-349.548) * (-345.407) (-347.430) (-346.117) [-347.423] -- 0:00:35
411500 -- (-345.614) [-349.437] (-344.679) (-345.028) * (-347.390) [-349.241] (-347.510) (-344.878) -- 0:00:35
412000 -- [-345.767] (-349.433) (-344.397) (-346.638) * (-348.430) (-345.578) (-346.013) [-345.236] -- 0:00:35
412500 -- (-345.368) (-347.269) (-347.218) [-346.754] * (-346.137) (-345.447) [-347.644] (-348.051) -- 0:00:35
413000 -- (-348.149) [-352.436] (-345.969) (-348.235) * (-347.217) (-346.409) (-348.105) [-346.553] -- 0:00:35
413500 -- (-347.608) (-349.933) [-349.130] (-346.350) * (-346.133) [-346.220] (-345.250) (-345.271) -- 0:00:35
414000 -- (-346.411) [-347.385] (-347.249) (-348.251) * [-355.782] (-345.093) (-345.282) (-350.268) -- 0:00:35
414500 -- (-346.831) (-347.559) [-346.420] (-347.669) * (-346.474) [-345.519] (-346.906) (-348.335) -- 0:00:35
415000 -- (-345.008) [-345.259] (-348.047) (-346.893) * [-345.813] (-346.821) (-347.286) (-345.567) -- 0:00:35
Average standard deviation of split frequencies: 0.014354
415500 -- (-346.153) (-347.035) (-346.431) [-345.962] * [-349.413] (-352.058) (-347.809) (-346.555) -- 0:00:35
416000 -- (-346.063) (-347.461) [-348.033] (-346.496) * (-348.012) (-352.051) (-352.852) [-345.696] -- 0:00:35
416500 -- (-352.886) (-346.577) [-349.374] (-346.690) * (-345.414) (-347.890) [-346.567] (-346.992) -- 0:00:35
417000 -- [-348.624] (-351.706) (-347.225) (-346.585) * (-349.362) (-347.832) [-345.363] (-348.527) -- 0:00:34
417500 -- (-346.381) (-346.096) [-346.344] (-344.831) * (-347.064) (-352.290) (-345.788) [-347.160] -- 0:00:34
418000 -- (-347.348) (-347.940) (-346.001) [-347.668] * [-346.158] (-345.394) (-350.772) (-351.147) -- 0:00:34
418500 -- (-350.791) [-347.422] (-345.840) (-346.807) * [-348.425] (-347.387) (-346.984) (-353.256) -- 0:00:36
419000 -- [-346.482] (-347.408) (-345.644) (-346.756) * (-345.876) (-346.425) (-348.015) [-346.426] -- 0:00:36
419500 -- (-351.972) (-351.096) [-345.232] (-347.297) * (-347.696) (-346.379) [-346.968] (-347.315) -- 0:00:35
420000 -- (-350.311) [-348.867] (-348.437) (-347.424) * [-348.992] (-346.004) (-346.113) (-345.495) -- 0:00:35
Average standard deviation of split frequencies: 0.013696
420500 -- (-345.725) [-346.136] (-346.127) (-345.520) * [-346.636] (-344.532) (-346.698) (-347.257) -- 0:00:35
421000 -- (-345.172) (-346.020) [-346.953] (-347.917) * [-347.073] (-346.374) (-345.146) (-344.971) -- 0:00:35
421500 -- (-347.931) (-346.489) [-348.674] (-347.833) * (-346.200) (-349.153) [-347.458] (-344.472) -- 0:00:35
422000 -- (-348.072) [-346.767] (-350.032) (-350.344) * [-344.967] (-345.905) (-347.414) (-345.780) -- 0:00:35
422500 -- (-345.890) [-344.955] (-345.446) (-347.976) * (-347.320) (-346.802) (-346.288) [-347.505] -- 0:00:35
423000 -- (-345.815) (-344.991) (-347.184) [-349.465] * (-349.278) (-347.579) (-345.300) [-345.795] -- 0:00:35
423500 -- (-350.772) [-345.599] (-345.374) (-345.242) * [-347.419] (-347.029) (-348.936) (-345.348) -- 0:00:35
424000 -- (-346.408) (-346.785) [-347.672] (-345.579) * (-347.529) (-344.931) [-346.497] (-345.462) -- 0:00:35
424500 -- (-348.354) (-347.446) [-349.347] (-347.483) * (-344.967) [-345.783] (-347.281) (-345.335) -- 0:00:35
425000 -- (-345.968) [-347.114] (-348.492) (-345.256) * [-346.140] (-344.732) (-348.415) (-348.108) -- 0:00:35
Average standard deviation of split frequencies: 0.012972
425500 -- (-345.997) (-352.111) [-347.136] (-348.652) * (-345.965) (-345.549) (-346.991) [-347.190] -- 0:00:35
426000 -- [-345.653] (-346.303) (-346.913) (-350.344) * (-346.607) (-346.989) (-348.036) [-349.113] -- 0:00:35
426500 -- (-345.879) (-347.916) [-348.934] (-345.895) * [-346.191] (-347.773) (-348.648) (-347.753) -- 0:00:34
427000 -- (-346.460) (-349.853) (-349.611) [-344.944] * (-346.978) (-348.001) (-345.714) [-347.471] -- 0:00:34
427500 -- (-346.430) [-347.199] (-347.865) (-348.318) * [-345.614] (-347.969) (-348.437) (-346.280) -- 0:00:34
428000 -- (-347.936) (-346.149) (-349.116) [-345.979] * (-345.067) (-347.908) [-348.168] (-345.013) -- 0:00:34
428500 -- (-344.752) (-345.943) (-345.150) [-345.429] * (-346.624) (-349.325) (-346.334) [-346.949] -- 0:00:34
429000 -- [-346.061] (-346.383) (-345.343) (-354.819) * [-346.616] (-348.208) (-347.306) (-347.486) -- 0:00:34
429500 -- [-347.900] (-349.465) (-345.268) (-347.691) * (-346.493) (-344.976) [-346.433] (-346.718) -- 0:00:34
430000 -- (-348.611) [-348.580] (-346.563) (-348.457) * (-346.119) (-346.757) (-347.106) [-346.025] -- 0:00:34
Average standard deviation of split frequencies: 0.013196
430500 -- (-345.621) [-345.151] (-347.373) (-345.035) * (-348.582) (-346.668) (-348.910) [-346.594] -- 0:00:34
431000 -- (-347.488) [-345.079] (-348.003) (-350.986) * (-346.632) (-348.370) (-349.634) [-347.935] -- 0:00:34
431500 -- (-345.127) [-344.964] (-345.378) (-348.933) * (-346.177) (-347.959) [-344.672] (-356.524) -- 0:00:35
432000 -- [-346.949] (-346.949) (-345.409) (-345.490) * (-347.900) (-346.240) [-344.664] (-350.191) -- 0:00:35
432500 -- (-346.420) (-346.223) (-345.017) [-347.206] * [-348.769] (-347.775) (-345.780) (-346.356) -- 0:00:35
433000 -- [-347.418] (-348.020) (-344.520) (-346.633) * (-348.321) (-350.859) (-345.054) [-348.188] -- 0:00:35
433500 -- (-347.494) (-346.898) [-348.023] (-346.447) * (-346.084) (-349.354) (-346.401) [-345.387] -- 0:00:35
434000 -- [-346.743] (-347.956) (-347.346) (-350.375) * [-346.323] (-348.195) (-346.687) (-346.372) -- 0:00:35
434500 -- (-349.362) (-348.377) (-348.731) [-347.853] * (-348.509) (-353.717) [-352.893] (-346.398) -- 0:00:35
435000 -- [-345.022] (-347.196) (-350.079) (-347.931) * (-346.297) (-352.543) [-348.538] (-346.117) -- 0:00:35
Average standard deviation of split frequencies: 0.013215
435500 -- (-345.970) (-348.973) [-349.004] (-346.011) * (-347.237) (-349.666) [-346.096] (-346.948) -- 0:00:34
436000 -- (-345.951) (-346.658) [-345.652] (-345.180) * (-346.208) (-345.331) (-345.554) [-347.895] -- 0:00:34
436500 -- (-347.884) (-346.633) (-347.070) [-349.121] * [-346.728] (-344.527) (-349.721) (-345.526) -- 0:00:34
437000 -- (-346.376) (-346.229) (-344.951) [-350.317] * (-347.003) [-344.509] (-346.215) (-346.514) -- 0:00:34
437500 -- (-347.020) [-346.293] (-347.492) (-348.689) * [-345.768] (-345.777) (-344.819) (-347.598) -- 0:00:34
438000 -- (-346.843) (-350.253) [-345.457] (-347.756) * [-347.728] (-350.312) (-346.833) (-344.882) -- 0:00:34
438500 -- [-347.330] (-347.190) (-346.884) (-346.403) * (-346.572) (-346.415) (-346.501) [-349.241] -- 0:00:34
439000 -- (-345.621) (-346.751) (-346.872) [-346.682] * (-345.668) (-347.361) [-348.763] (-348.829) -- 0:00:34
439500 -- (-345.528) (-345.800) [-345.797] (-352.212) * (-345.333) (-345.837) (-347.081) [-346.477] -- 0:00:34
440000 -- (-346.449) (-346.094) (-347.903) [-348.363] * (-344.813) [-345.605] (-348.306) (-346.822) -- 0:00:34
Average standard deviation of split frequencies: 0.013194
440500 -- (-350.700) [-346.956] (-347.145) (-347.054) * (-344.636) (-351.718) (-350.127) [-344.584] -- 0:00:34
441000 -- (-346.919) (-348.989) [-348.726] (-346.076) * [-345.885] (-348.739) (-345.586) (-345.789) -- 0:00:34
441500 -- (-347.495) [-344.754] (-344.969) (-346.327) * (-348.866) [-347.513] (-346.220) (-345.259) -- 0:00:34
442000 -- (-348.222) (-346.609) (-346.624) [-349.757] * (-345.652) (-345.389) [-346.298] (-346.300) -- 0:00:34
442500 -- [-346.522] (-346.121) (-345.671) (-349.071) * [-345.855] (-348.720) (-347.412) (-347.564) -- 0:00:34
443000 -- (-346.222) (-347.907) (-344.318) [-349.244] * (-345.394) (-348.929) (-345.540) [-348.720] -- 0:00:33
443500 -- (-345.359) [-344.627] (-345.907) (-346.334) * (-346.381) (-348.172) (-348.873) [-347.178] -- 0:00:33
444000 -- [-349.153] (-347.568) (-345.685) (-348.241) * (-348.380) (-348.544) (-351.151) [-345.634] -- 0:00:33
444500 -- [-350.087] (-351.557) (-348.053) (-345.074) * (-345.143) (-345.819) (-345.360) [-345.211] -- 0:00:34
445000 -- [-349.172] (-349.916) (-345.611) (-345.761) * (-345.989) (-345.903) [-351.340] (-345.574) -- 0:00:34
Average standard deviation of split frequencies: 0.013564
445500 -- (-346.008) (-350.295) (-345.271) [-345.675] * (-348.545) [-347.105] (-351.459) (-347.071) -- 0:00:34
446000 -- [-345.770] (-349.986) (-346.851) (-346.229) * (-350.757) [-345.414] (-347.350) (-346.304) -- 0:00:34
446500 -- (-347.938) (-346.081) [-346.685] (-349.032) * (-348.471) (-345.469) (-345.437) [-347.441] -- 0:00:34
447000 -- (-345.480) [-351.315] (-346.063) (-347.633) * (-348.004) [-347.407] (-346.711) (-345.409) -- 0:00:34
447500 -- (-345.594) (-349.014) [-345.486] (-345.041) * (-346.859) [-345.702] (-345.953) (-346.246) -- 0:00:34
448000 -- (-344.887) [-347.135] (-346.743) (-346.450) * (-352.107) (-347.002) [-349.320] (-347.452) -- 0:00:34
448500 -- [-345.178] (-346.879) (-347.021) (-347.451) * (-349.219) (-346.648) [-347.356] (-348.203) -- 0:00:34
449000 -- (-344.997) (-346.922) [-347.504] (-348.060) * (-346.874) (-346.872) [-345.829] (-346.659) -- 0:00:34
449500 -- [-345.585] (-347.717) (-349.085) (-348.161) * [-346.576] (-346.729) (-348.022) (-346.814) -- 0:00:34
450000 -- (-346.978) (-348.351) (-345.907) [-345.969] * (-345.218) (-349.028) [-346.332] (-346.380) -- 0:00:34
Average standard deviation of split frequencies: 0.013947
450500 -- (-347.895) (-353.588) [-345.922] (-347.147) * [-345.209] (-346.900) (-345.851) (-349.908) -- 0:00:34
451000 -- (-348.744) [-345.770] (-345.262) (-349.955) * [-347.989] (-352.192) (-347.098) (-346.895) -- 0:00:34
451500 -- (-345.596) (-345.730) (-344.799) [-346.141] * [-346.394] (-350.074) (-346.729) (-346.817) -- 0:00:34
452000 -- [-345.754] (-346.849) (-346.325) (-349.125) * (-345.463) (-348.941) [-346.934] (-347.483) -- 0:00:33
452500 -- (-347.760) (-348.046) [-347.756] (-349.119) * (-345.199) [-346.089] (-348.578) (-345.118) -- 0:00:33
453000 -- (-347.216) [-350.064] (-346.750) (-345.459) * [-344.837] (-347.137) (-349.062) (-344.698) -- 0:00:33
453500 -- [-347.275] (-348.227) (-346.095) (-347.587) * (-346.511) [-346.098] (-346.527) (-346.760) -- 0:00:33
454000 -- (-345.548) (-349.956) (-345.984) [-345.862] * [-345.115] (-346.261) (-347.217) (-344.805) -- 0:00:33
454500 -- (-348.644) (-345.034) (-350.117) [-346.861] * (-348.683) (-345.582) [-346.048] (-347.687) -- 0:00:33
455000 -- (-345.449) (-345.371) (-347.992) [-349.634] * (-346.103) (-346.676) [-345.189] (-345.049) -- 0:00:33
Average standard deviation of split frequencies: 0.013784
455500 -- (-349.289) [-345.161] (-345.641) (-349.448) * (-348.057) [-348.061] (-345.103) (-346.078) -- 0:00:33
456000 -- [-346.340] (-346.605) (-344.321) (-349.010) * (-345.920) [-345.837] (-346.950) (-345.840) -- 0:00:33
456500 -- (-348.209) (-344.799) (-345.209) [-348.057] * (-345.749) [-344.921] (-348.498) (-345.702) -- 0:00:33
457000 -- (-345.343) (-346.778) (-346.592) [-345.889] * (-345.883) (-344.803) [-345.715] (-346.013) -- 0:00:34
457500 -- (-349.389) (-349.885) [-346.285] (-347.722) * (-346.659) (-347.131) (-348.767) [-347.566] -- 0:00:34
458000 -- [-346.770] (-346.061) (-345.093) (-348.058) * (-345.897) (-350.160) [-346.907] (-347.574) -- 0:00:34
458500 -- (-346.148) (-346.857) (-351.666) [-346.254] * (-345.518) [-346.889] (-347.147) (-346.126) -- 0:00:34
459000 -- (-349.525) (-346.398) (-347.207) [-344.729] * (-346.098) [-346.806] (-350.563) (-345.414) -- 0:00:34
459500 -- (-344.880) (-349.424) (-345.247) [-345.483] * (-345.661) (-348.806) [-345.336] (-347.455) -- 0:00:34
460000 -- (-346.034) [-345.744] (-347.267) (-350.169) * [-345.724] (-352.527) (-344.778) (-349.209) -- 0:00:34
Average standard deviation of split frequencies: 0.013530
460500 -- [-346.796] (-347.485) (-347.897) (-346.679) * (-348.745) [-351.790] (-347.076) (-346.488) -- 0:00:33
461000 -- [-349.053] (-348.056) (-346.542) (-347.470) * [-347.582] (-347.607) (-346.454) (-345.631) -- 0:00:33
461500 -- (-346.073) (-346.323) [-346.766] (-346.666) * (-350.537) (-350.341) [-347.882] (-344.903) -- 0:00:33
462000 -- (-346.527) (-346.904) (-346.086) [-346.677] * (-347.378) (-352.641) [-345.565] (-347.886) -- 0:00:33
462500 -- [-347.408] (-349.469) (-347.628) (-349.175) * (-346.105) [-346.928] (-344.916) (-344.479) -- 0:00:33
463000 -- [-346.749] (-349.684) (-348.390) (-348.592) * [-345.670] (-347.680) (-352.769) (-346.306) -- 0:00:33
463500 -- (-349.908) (-347.021) (-347.760) [-346.579] * (-346.489) (-347.302) (-349.487) [-345.107] -- 0:00:33
464000 -- [-347.590] (-349.459) (-347.516) (-345.152) * (-349.580) (-351.518) (-344.850) [-346.545] -- 0:00:33
464500 -- (-344.559) (-349.439) [-351.449] (-346.757) * (-351.430) (-350.720) [-348.287] (-346.224) -- 0:00:33
465000 -- [-347.188] (-348.804) (-345.485) (-348.076) * (-351.010) (-349.643) (-347.311) [-349.057] -- 0:00:33
Average standard deviation of split frequencies: 0.013657
465500 -- (-345.658) [-345.325] (-351.530) (-345.535) * (-346.079) (-345.972) (-347.057) [-346.241] -- 0:00:33
466000 -- [-344.730] (-345.868) (-345.754) (-348.210) * (-347.712) (-346.221) [-346.776] (-346.045) -- 0:00:33
466500 -- [-345.265] (-349.528) (-352.270) (-347.149) * (-347.125) (-347.381) (-345.696) [-346.411] -- 0:00:33
467000 -- [-345.383] (-347.770) (-350.389) (-347.347) * (-346.273) (-347.415) (-345.358) [-345.807] -- 0:00:33
467500 -- [-346.770] (-348.052) (-349.545) (-351.572) * [-348.282] (-345.612) (-346.758) (-347.679) -- 0:00:33
468000 -- (-347.085) (-345.291) [-347.129] (-353.383) * (-346.767) (-348.658) (-347.111) [-346.252] -- 0:00:32
468500 -- (-347.608) [-346.810] (-344.956) (-348.250) * [-344.899] (-346.236) (-346.079) (-350.058) -- 0:00:32
469000 -- (-345.115) (-345.044) [-346.573] (-345.091) * (-346.097) (-346.679) (-347.809) [-347.740] -- 0:00:32
469500 -- (-348.682) (-345.091) [-346.424] (-347.958) * [-345.018] (-349.443) (-348.222) (-345.466) -- 0:00:32
470000 -- [-349.922] (-346.764) (-350.596) (-345.098) * (-348.118) [-344.636] (-345.673) (-345.374) -- 0:00:32
Average standard deviation of split frequencies: 0.013132
470500 -- (-346.615) [-345.278] (-346.246) (-346.419) * (-356.170) [-344.758] (-346.721) (-351.005) -- 0:00:33
471000 -- (-345.335) (-345.319) [-347.434] (-345.361) * (-354.460) (-346.050) [-345.323] (-346.746) -- 0:00:33
471500 -- (-349.007) (-345.747) (-350.791) [-345.401] * (-350.665) (-345.245) [-345.582] (-350.132) -- 0:00:33
472000 -- (-350.031) (-345.572) [-354.047] (-345.296) * [-350.053] (-344.900) (-347.533) (-346.259) -- 0:00:33
472500 -- [-346.073] (-358.220) (-349.119) (-344.803) * (-345.775) (-345.101) [-344.655] (-346.808) -- 0:00:33
473000 -- [-346.035] (-351.775) (-348.437) (-348.284) * (-345.332) [-348.525] (-349.405) (-349.956) -- 0:00:33
473500 -- [-346.414] (-346.004) (-349.600) (-349.703) * (-345.048) [-345.998] (-344.853) (-345.066) -- 0:00:33
474000 -- (-345.605) (-347.014) [-346.005] (-346.901) * [-346.845] (-345.845) (-345.687) (-349.422) -- 0:00:33
474500 -- (-345.094) (-346.346) [-349.743] (-348.159) * (-345.160) (-346.828) [-345.876] (-349.003) -- 0:00:33
475000 -- (-348.116) [-350.782] (-345.720) (-348.620) * (-350.509) [-347.501] (-349.290) (-346.873) -- 0:00:33
Average standard deviation of split frequencies: 0.013150
475500 -- (-347.581) (-348.573) [-346.220] (-346.057) * (-345.997) [-349.845] (-346.890) (-346.560) -- 0:00:33
476000 -- (-349.160) [-348.002] (-346.133) (-346.336) * (-348.721) (-351.036) (-344.557) [-346.282] -- 0:00:33
476500 -- (-346.215) (-348.376) [-349.755] (-347.463) * (-348.495) (-348.210) (-345.115) [-345.719] -- 0:00:32
477000 -- (-346.415) (-345.180) [-346.034] (-349.407) * (-345.392) (-350.285) [-347.588] (-349.412) -- 0:00:32
477500 -- (-347.278) (-345.046) [-346.760] (-346.077) * [-346.244] (-345.732) (-347.425) (-345.168) -- 0:00:32
478000 -- (-347.857) (-348.618) (-345.192) [-345.773] * (-345.273) (-345.549) [-346.662] (-349.033) -- 0:00:32
478500 -- (-347.043) (-346.636) [-346.063] (-348.156) * [-346.380] (-346.521) (-346.977) (-349.369) -- 0:00:32
479000 -- (-345.479) (-345.292) [-347.289] (-345.527) * (-345.415) [-347.424] (-350.022) (-348.591) -- 0:00:32
479500 -- (-348.462) (-346.751) [-348.699] (-345.782) * [-347.537] (-347.538) (-347.240) (-350.110) -- 0:00:32
480000 -- [-347.099] (-347.146) (-346.134) (-344.803) * (-347.808) (-346.253) (-345.521) [-347.891] -- 0:00:32
Average standard deviation of split frequencies: 0.012586
480500 -- (-346.160) (-348.745) (-350.000) [-344.769] * (-345.911) [-348.339] (-349.590) (-348.179) -- 0:00:32
481000 -- (-345.872) (-349.551) [-344.877] (-344.527) * (-344.990) (-352.353) (-352.737) [-346.311] -- 0:00:32
481500 -- [-345.990] (-350.122) (-344.849) (-346.214) * (-345.174) [-346.390] (-347.224) (-349.196) -- 0:00:32
482000 -- (-345.819) [-345.515] (-350.109) (-346.064) * (-348.187) [-345.980] (-345.263) (-346.664) -- 0:00:32
482500 -- [-346.271] (-347.283) (-350.315) (-350.416) * (-345.501) (-347.613) [-347.204] (-351.957) -- 0:00:32
483000 -- (-349.455) (-351.770) (-347.264) [-346.989] * (-346.362) [-347.342] (-346.533) (-344.666) -- 0:00:32
483500 -- [-344.846] (-352.733) (-347.026) (-345.694) * (-348.514) [-347.057] (-344.708) (-345.337) -- 0:00:33
484000 -- (-347.761) [-348.464] (-351.254) (-345.781) * (-347.796) (-349.675) [-345.129] (-348.409) -- 0:00:33
484500 -- [-348.287] (-348.487) (-348.217) (-348.320) * (-350.676) (-349.331) [-344.574] (-347.635) -- 0:00:32
485000 -- (-353.236) [-347.784] (-345.108) (-346.002) * (-346.858) [-345.709] (-345.726) (-347.368) -- 0:00:32
Average standard deviation of split frequencies: 0.012771
485500 -- (-345.206) (-346.827) (-345.282) [-345.958] * (-347.892) [-348.196] (-345.868) (-346.360) -- 0:00:32
486000 -- (-348.281) (-345.617) (-346.504) [-348.569] * [-345.549] (-348.293) (-346.127) (-346.932) -- 0:00:32
486500 -- [-347.464] (-346.337) (-345.660) (-345.239) * (-345.731) (-347.110) (-344.869) [-346.436] -- 0:00:32
487000 -- [-345.263] (-346.219) (-349.019) (-346.830) * (-346.504) (-348.201) [-345.673] (-345.747) -- 0:00:32
487500 -- (-348.974) (-345.850) (-349.504) [-344.764] * [-347.231] (-350.605) (-348.507) (-345.132) -- 0:00:32
488000 -- [-346.309] (-347.361) (-352.176) (-344.992) * (-345.621) (-345.827) [-347.672] (-344.815) -- 0:00:32
488500 -- (-346.299) (-347.124) [-345.243] (-346.214) * (-347.725) [-344.933] (-346.080) (-345.454) -- 0:00:32
489000 -- [-347.427] (-348.693) (-345.156) (-345.296) * (-347.423) [-345.980] (-346.111) (-346.107) -- 0:00:32
489500 -- (-345.118) [-347.410] (-346.455) (-349.558) * (-347.379) [-345.081] (-346.417) (-347.460) -- 0:00:32
490000 -- (-347.008) (-345.097) [-345.424] (-350.169) * (-350.990) (-345.689) (-347.886) [-344.736] -- 0:00:32
Average standard deviation of split frequencies: 0.013931
490500 -- (-348.835) [-345.625] (-350.956) (-348.094) * [-346.631] (-349.973) (-347.652) (-346.244) -- 0:00:32
491000 -- (-346.093) (-346.816) [-348.490] (-345.454) * [-346.096] (-346.048) (-349.802) (-345.668) -- 0:00:32
491500 -- (-347.690) (-346.681) (-354.691) [-346.748] * (-346.745) (-345.876) [-347.463] (-346.221) -- 0:00:32
492000 -- (-346.656) (-348.060) (-349.620) [-347.847] * (-348.631) [-346.192] (-348.914) (-344.561) -- 0:00:32
492500 -- (-347.706) (-347.973) [-347.511] (-348.314) * (-345.934) (-346.012) [-350.281] (-346.983) -- 0:00:31
493000 -- (-352.496) [-349.015] (-347.596) (-345.769) * (-345.490) (-344.944) [-346.052] (-347.634) -- 0:00:31
493500 -- [-351.174] (-348.248) (-346.591) (-347.452) * (-346.893) (-348.189) [-352.088] (-345.915) -- 0:00:31
494000 -- (-347.353) (-346.147) [-345.132] (-349.174) * (-348.801) (-346.674) (-347.551) [-346.791] -- 0:00:31
494500 -- (-344.584) (-345.674) [-345.333] (-346.189) * (-345.411) (-347.799) [-346.872] (-346.417) -- 0:00:31
495000 -- (-346.361) (-348.214) [-345.773] (-347.623) * (-350.837) (-347.297) (-347.629) [-345.397] -- 0:00:31
Average standard deviation of split frequencies: 0.013418
495500 -- (-345.195) (-350.564) (-346.403) [-346.630] * (-346.922) (-345.445) (-347.621) [-345.231] -- 0:00:31
496000 -- (-345.722) (-346.582) (-348.590) [-347.256] * [-346.822] (-345.624) (-349.252) (-347.227) -- 0:00:31
496500 -- (-348.009) [-348.417] (-349.439) (-346.997) * [-345.031] (-347.256) (-347.760) (-346.527) -- 0:00:31
497000 -- (-347.138) (-350.416) (-350.370) [-346.955] * (-346.805) (-345.606) [-348.339] (-344.788) -- 0:00:31
497500 -- (-347.906) (-348.257) [-346.248] (-348.106) * [-345.576] (-348.471) (-345.701) (-346.478) -- 0:00:32
498000 -- (-347.360) [-346.787] (-345.525) (-347.038) * (-349.637) (-346.326) [-350.322] (-347.241) -- 0:00:32
498500 -- (-345.945) (-345.176) [-345.353] (-347.124) * (-345.230) [-346.368] (-348.162) (-348.023) -- 0:00:32
499000 -- (-346.336) [-345.581] (-347.345) (-349.440) * (-347.950) [-346.083] (-350.004) (-345.404) -- 0:00:32
499500 -- (-350.648) (-349.153) (-346.231) [-346.991] * (-348.120) [-346.701] (-348.870) (-347.011) -- 0:00:32
500000 -- [-345.021] (-349.522) (-344.938) (-346.637) * [-347.666] (-346.704) (-346.536) (-346.445) -- 0:00:32
Average standard deviation of split frequencies: 0.013182
500500 -- (-345.002) (-348.773) [-346.244] (-348.365) * (-348.447) (-350.878) (-345.642) [-345.583] -- 0:00:31
501000 -- (-346.312) (-347.568) [-345.635] (-345.734) * (-348.403) (-350.417) (-346.301) [-345.250] -- 0:00:31
501500 -- (-346.908) (-348.706) (-348.865) [-344.932] * (-350.793) [-345.375] (-347.845) (-347.787) -- 0:00:31
502000 -- (-347.141) [-346.119] (-347.108) (-347.955) * (-346.852) [-344.802] (-345.932) (-347.826) -- 0:00:31
502500 -- (-346.095) (-347.718) [-349.489] (-345.519) * (-345.553) [-346.369] (-347.317) (-347.160) -- 0:00:31
503000 -- (-346.431) [-345.564] (-345.665) (-347.717) * [-348.163] (-351.054) (-350.894) (-350.003) -- 0:00:31
503500 -- (-352.374) [-345.706] (-347.666) (-346.832) * [-344.811] (-345.436) (-348.152) (-344.560) -- 0:00:31
504000 -- (-346.463) (-348.607) (-346.700) [-346.023] * [-349.260] (-346.917) (-345.621) (-346.794) -- 0:00:31
504500 -- (-350.097) [-347.444] (-349.826) (-345.602) * (-348.600) [-345.684] (-345.917) (-348.733) -- 0:00:31
505000 -- (-346.216) [-345.836] (-347.715) (-345.506) * [-345.820] (-351.052) (-346.684) (-345.892) -- 0:00:31
Average standard deviation of split frequencies: 0.012330
505500 -- (-345.819) [-347.877] (-347.299) (-346.165) * (-345.427) (-346.069) [-346.629] (-346.745) -- 0:00:31
506000 -- (-346.222) (-346.556) [-348.440] (-348.982) * [-346.476] (-345.289) (-346.983) (-347.456) -- 0:00:31
506500 -- (-345.068) (-345.055) (-347.749) [-350.812] * [-347.569] (-345.247) (-345.766) (-346.518) -- 0:00:31
507000 -- (-346.231) (-354.087) (-345.504) [-346.992] * [-347.513] (-345.564) (-346.313) (-345.742) -- 0:00:31
507500 -- (-347.779) (-346.952) [-347.885] (-345.396) * (-349.152) (-344.641) [-346.895] (-350.808) -- 0:00:31
508000 -- (-347.458) (-347.033) (-355.258) [-346.711] * (-345.439) (-345.489) (-349.643) [-347.109] -- 0:00:30
508500 -- (-345.974) [-345.432] (-349.086) (-347.120) * (-347.633) (-346.774) [-346.617] (-346.902) -- 0:00:30
509000 -- [-347.519] (-345.977) (-346.621) (-346.155) * [-348.282] (-345.242) (-345.814) (-349.784) -- 0:00:30
509500 -- [-348.055] (-347.657) (-344.721) (-345.941) * [-348.951] (-348.388) (-346.007) (-353.785) -- 0:00:30
510000 -- (-346.766) (-345.530) [-346.938] (-350.089) * (-344.626) (-346.137) (-348.843) [-351.955] -- 0:00:30
Average standard deviation of split frequencies: 0.013501
510500 -- (-348.055) (-346.505) [-346.543] (-346.620) * (-347.021) [-344.827] (-345.282) (-347.893) -- 0:00:30
511000 -- (-351.652) (-346.901) [-345.733] (-346.117) * (-347.479) [-345.879] (-347.070) (-347.003) -- 0:00:30
511500 -- (-349.260) (-348.322) [-350.154] (-346.921) * (-348.339) [-346.890] (-347.497) (-345.657) -- 0:00:30
512000 -- (-344.738) (-345.092) (-345.796) [-349.709] * (-346.731) (-346.645) (-348.625) [-346.255] -- 0:00:30
512500 -- [-346.079] (-348.985) (-345.618) (-346.414) * (-347.587) [-347.430] (-346.366) (-348.140) -- 0:00:30
513000 -- (-349.745) (-351.769) (-346.665) [-347.344] * (-347.696) [-348.533] (-344.586) (-346.368) -- 0:00:30
513500 -- (-347.325) (-348.107) [-347.754] (-345.512) * (-345.432) (-351.685) (-346.677) [-346.064] -- 0:00:30
514000 -- (-346.790) (-348.593) (-349.428) [-345.265] * [-345.303] (-346.418) (-345.139) (-346.068) -- 0:00:30
514500 -- (-347.853) (-347.022) [-349.018] (-345.675) * [-347.186] (-347.543) (-345.395) (-347.769) -- 0:00:31
515000 -- [-346.355] (-346.897) (-347.450) (-346.957) * (-349.825) [-346.624] (-347.209) (-346.236) -- 0:00:31
Average standard deviation of split frequencies: 0.013589
515500 -- (-345.346) [-345.857] (-344.815) (-348.304) * (-345.040) (-345.223) (-350.202) [-348.614] -- 0:00:31
516000 -- (-346.090) [-348.582] (-348.984) (-347.467) * [-345.095] (-345.182) (-348.330) (-347.822) -- 0:00:30
516500 -- (-345.351) (-344.933) [-346.281] (-346.219) * (-346.658) (-347.548) (-347.458) [-345.496] -- 0:00:30
517000 -- (-345.192) (-345.213) (-345.293) [-346.933] * (-345.407) (-345.113) [-347.112] (-346.839) -- 0:00:30
517500 -- (-349.106) [-346.938] (-346.640) (-346.137) * (-347.949) [-348.994] (-349.506) (-345.454) -- 0:00:30
518000 -- [-348.164] (-346.315) (-350.310) (-344.913) * (-348.764) (-345.925) (-346.705) [-345.255] -- 0:00:30
518500 -- (-348.336) [-346.664] (-354.097) (-352.881) * (-347.004) (-346.062) (-347.929) [-347.575] -- 0:00:30
519000 -- [-346.795] (-346.253) (-346.028) (-350.170) * (-344.993) [-346.559] (-347.001) (-348.105) -- 0:00:30
519500 -- (-346.784) [-345.962] (-344.791) (-345.484) * (-345.612) (-345.790) (-346.839) [-351.171] -- 0:00:30
520000 -- [-347.332] (-346.905) (-347.204) (-347.942) * (-346.452) (-347.899) [-347.201] (-346.651) -- 0:00:30
Average standard deviation of split frequencies: 0.013694
520500 -- (-347.909) (-348.256) (-344.945) [-345.216] * (-346.908) (-348.506) (-345.069) [-349.254] -- 0:00:30
521000 -- (-346.119) (-346.102) [-348.901] (-348.486) * (-348.834) [-346.537] (-345.018) (-349.663) -- 0:00:30
521500 -- (-349.663) [-345.613] (-351.138) (-346.210) * (-349.669) (-346.135) [-346.061] (-345.308) -- 0:00:30
522000 -- [-347.146] (-350.341) (-350.737) (-348.311) * (-351.446) [-346.864] (-347.784) (-344.431) -- 0:00:30
522500 -- (-345.253) (-344.904) (-350.506) [-347.445] * (-349.734) [-347.227] (-347.716) (-352.421) -- 0:00:30
523000 -- (-345.908) [-346.650] (-347.343) (-349.410) * (-349.289) (-345.738) [-350.067] (-345.427) -- 0:00:30
523500 -- [-346.773] (-345.020) (-346.637) (-347.931) * (-345.248) (-347.183) [-346.457] (-347.443) -- 0:00:30
524000 -- (-347.160) [-346.826] (-346.512) (-346.905) * (-350.281) (-351.871) (-344.941) [-346.386] -- 0:00:29
524500 -- [-347.701] (-349.594) (-352.039) (-346.022) * (-346.654) (-351.150) (-346.201) [-345.690] -- 0:00:29
525000 -- [-347.639] (-347.151) (-347.369) (-346.212) * (-348.139) [-347.981] (-348.110) (-350.421) -- 0:00:29
Average standard deviation of split frequencies: 0.013891
525500 -- [-344.980] (-348.140) (-345.351) (-347.232) * [-346.547] (-347.469) (-346.597) (-351.749) -- 0:00:29
526000 -- (-346.803) (-345.086) [-348.970] (-346.751) * [-347.417] (-347.977) (-346.773) (-346.486) -- 0:00:29
526500 -- (-347.130) [-345.858] (-346.385) (-345.302) * (-346.982) (-350.611) (-347.612) [-345.721] -- 0:00:29
527000 -- (-345.680) [-345.749] (-346.653) (-347.999) * [-345.532] (-346.403) (-346.102) (-348.988) -- 0:00:29
527500 -- [-347.698] (-345.002) (-346.770) (-347.789) * [-345.112] (-345.713) (-345.131) (-346.726) -- 0:00:29
528000 -- (-345.639) (-346.550) [-345.517] (-347.607) * (-345.383) (-347.795) [-345.959] (-349.100) -- 0:00:29
528500 -- (-345.923) (-345.477) (-344.727) [-348.943] * (-344.650) (-348.152) (-347.175) [-344.884] -- 0:00:29
529000 -- (-353.711) (-346.924) (-347.641) [-347.256] * [-347.512] (-346.268) (-346.260) (-346.749) -- 0:00:29
529500 -- (-345.194) (-348.067) (-347.613) [-347.224] * (-345.974) (-351.341) [-346.947] (-347.225) -- 0:00:29
530000 -- (-346.581) (-344.931) (-348.635) [-348.555] * (-347.761) [-350.495] (-347.874) (-348.285) -- 0:00:29
Average standard deviation of split frequencies: 0.014491
530500 -- [-347.411] (-345.705) (-348.440) (-346.792) * (-349.332) [-350.052] (-349.371) (-351.864) -- 0:00:29
531000 -- (-350.790) (-346.267) (-346.614) [-345.974] * [-347.779] (-347.339) (-347.779) (-346.959) -- 0:00:29
531500 -- (-345.455) (-345.612) (-348.563) [-349.833] * (-346.330) (-350.705) (-348.667) [-347.129] -- 0:00:29
532000 -- (-348.648) [-347.317] (-348.554) (-348.400) * (-344.648) (-348.239) [-345.818] (-345.397) -- 0:00:29
532500 -- [-345.838] (-345.739) (-347.353) (-346.419) * (-344.641) (-345.099) (-345.673) [-344.619] -- 0:00:29
533000 -- [-346.953] (-346.668) (-345.486) (-345.948) * [-345.750] (-347.782) (-346.745) (-347.656) -- 0:00:29
533500 -- (-347.414) [-346.381] (-347.011) (-347.932) * (-348.854) (-349.946) (-349.144) [-346.867] -- 0:00:29
534000 -- (-348.205) (-346.280) (-347.229) [-349.424] * (-346.941) [-351.474] (-346.853) (-346.069) -- 0:00:29
534500 -- (-348.325) [-349.119] (-347.500) (-346.740) * (-345.666) (-346.731) (-349.569) [-345.482] -- 0:00:29
535000 -- (-349.537) (-346.493) (-345.779) [-345.599] * [-345.577] (-346.122) (-348.226) (-348.223) -- 0:00:29
Average standard deviation of split frequencies: 0.014951
535500 -- (-347.130) (-348.948) (-346.673) [-345.461] * (-345.249) [-346.406] (-345.515) (-345.392) -- 0:00:29
536000 -- (-345.571) (-347.439) [-348.019] (-347.160) * (-349.618) (-348.530) (-345.175) [-345.102] -- 0:00:29
536500 -- (-346.525) (-345.582) [-346.514] (-346.197) * (-347.019) (-351.102) (-347.280) [-347.125] -- 0:00:29
537000 -- (-349.054) [-344.973] (-348.193) (-344.737) * [-348.129] (-349.165) (-348.005) (-347.204) -- 0:00:29
537500 -- (-347.309) [-345.294] (-346.455) (-345.366) * [-346.080] (-349.419) (-350.654) (-349.162) -- 0:00:29
538000 -- [-346.349] (-345.782) (-347.942) (-345.979) * (-348.792) (-345.821) (-346.605) [-346.809] -- 0:00:29
538500 -- [-346.875] (-346.830) (-348.087) (-345.224) * (-345.314) [-345.275] (-351.124) (-347.392) -- 0:00:29
539000 -- [-344.516] (-345.079) (-347.936) (-345.507) * [-345.063] (-350.024) (-351.576) (-347.867) -- 0:00:29
539500 -- [-347.112] (-346.371) (-348.226) (-344.514) * (-348.866) [-349.206] (-344.739) (-345.283) -- 0:00:29
540000 -- (-346.053) (-346.097) [-346.638] (-345.900) * (-348.400) [-344.948] (-344.804) (-347.797) -- 0:00:28
Average standard deviation of split frequencies: 0.014822
540500 -- (-346.688) (-346.859) [-346.546] (-347.710) * (-350.700) (-347.377) (-347.208) [-346.463] -- 0:00:28
541000 -- (-349.131) [-345.511] (-349.325) (-351.090) * (-347.182) (-346.728) [-345.292] (-346.594) -- 0:00:28
541500 -- (-345.157) [-346.953] (-348.151) (-346.962) * [-345.501] (-352.428) (-346.710) (-346.347) -- 0:00:28
542000 -- (-345.523) (-345.545) [-346.771] (-344.701) * (-344.409) (-350.330) [-347.065] (-344.636) -- 0:00:28
542500 -- (-346.351) (-352.495) [-345.311] (-344.664) * (-346.625) (-347.705) (-346.343) [-344.668] -- 0:00:28
543000 -- (-350.991) (-357.293) [-347.447] (-345.394) * (-347.170) (-347.299) (-349.656) [-349.303] -- 0:00:28
543500 -- (-348.771) (-346.188) (-345.023) [-346.586] * (-346.384) [-347.411] (-349.198) (-348.406) -- 0:00:28
544000 -- (-347.505) (-346.850) (-349.418) [-344.529] * [-347.003] (-349.948) (-347.642) (-346.854) -- 0:00:28
544500 -- (-346.380) [-345.595] (-348.966) (-346.337) * (-346.550) (-347.010) [-345.721] (-347.746) -- 0:00:28
545000 -- (-345.891) (-346.316) (-345.874) [-346.945] * (-346.675) (-345.427) [-346.390] (-347.365) -- 0:00:28
Average standard deviation of split frequencies: 0.014300
545500 -- (-348.569) (-346.633) [-347.049] (-346.977) * (-351.902) (-345.030) [-346.523] (-345.479) -- 0:00:28
546000 -- (-347.170) (-347.440) [-346.631] (-348.344) * (-345.483) [-346.859] (-346.085) (-347.632) -- 0:00:28
546500 -- [-347.862] (-346.078) (-346.156) (-345.182) * (-344.626) [-347.212] (-346.522) (-344.927) -- 0:00:28
547000 -- [-346.980] (-346.371) (-345.124) (-344.594) * [-344.781] (-347.130) (-348.134) (-347.829) -- 0:00:28
547500 -- (-349.209) [-346.557] (-346.070) (-352.000) * (-349.038) (-347.266) [-344.651] (-345.015) -- 0:00:28
548000 -- (-347.748) [-345.326] (-350.957) (-346.991) * (-349.753) (-347.416) (-347.801) [-346.466] -- 0:00:28
548500 -- (-346.291) [-347.210] (-346.669) (-346.756) * (-345.594) (-345.126) (-344.675) [-349.089] -- 0:00:27
549000 -- (-345.203) [-349.363] (-345.291) (-348.427) * (-345.639) (-349.253) (-345.732) [-348.693] -- 0:00:28
549500 -- (-346.063) (-347.029) [-346.786] (-345.957) * (-346.626) [-346.440] (-345.520) (-350.221) -- 0:00:28
550000 -- (-346.718) (-347.962) (-348.035) [-345.289] * (-348.571) [-348.960] (-346.303) (-346.099) -- 0:00:28
Average standard deviation of split frequencies: 0.013857
550500 -- [-345.111] (-347.229) (-346.791) (-355.440) * (-345.942) [-346.925] (-345.367) (-345.624) -- 0:00:28
551000 -- (-349.036) [-346.598] (-345.922) (-345.833) * (-347.367) (-345.543) [-345.799] (-346.524) -- 0:00:28
551500 -- (-346.914) (-349.822) (-346.972) [-346.006] * [-348.609] (-346.080) (-345.878) (-345.705) -- 0:00:28
552000 -- [-345.203] (-353.938) (-346.759) (-345.987) * (-348.791) (-345.024) [-346.995] (-345.492) -- 0:00:28
552500 -- (-346.694) (-352.298) (-346.974) [-344.922] * (-349.906) (-349.373) [-345.274] (-346.658) -- 0:00:28
553000 -- (-345.260) [-345.769] (-344.706) (-349.543) * (-352.243) (-345.992) [-349.642] (-346.432) -- 0:00:28
553500 -- (-347.581) [-346.897] (-348.900) (-352.605) * (-350.502) (-345.128) (-345.758) [-345.810] -- 0:00:28
554000 -- (-347.220) [-347.722] (-346.495) (-345.558) * (-348.220) [-345.302] (-346.177) (-347.203) -- 0:00:28
554500 -- [-345.694] (-346.927) (-347.452) (-345.896) * (-346.645) [-346.744] (-346.796) (-352.778) -- 0:00:28
555000 -- (-346.808) (-346.574) (-350.432) [-348.103] * (-346.331) (-348.245) (-347.724) [-347.243] -- 0:00:28
Average standard deviation of split frequencies: 0.013142
555500 -- [-346.939] (-345.430) (-350.005) (-348.162) * (-348.656) [-347.806] (-348.945) (-349.861) -- 0:00:28
556000 -- [-347.154] (-348.555) (-348.276) (-349.811) * (-348.060) (-347.701) (-345.709) [-348.632] -- 0:00:27
556500 -- (-345.489) (-352.081) (-351.054) [-348.237] * [-348.258] (-347.578) (-345.833) (-345.766) -- 0:00:27
557000 -- (-346.828) [-347.989] (-348.216) (-348.899) * (-346.080) (-346.218) [-346.572] (-353.863) -- 0:00:27
557500 -- [-345.490] (-346.242) (-344.938) (-345.705) * [-345.221] (-345.593) (-347.623) (-350.285) -- 0:00:27
558000 -- [-345.895] (-347.516) (-350.418) (-346.699) * [-346.804] (-346.638) (-348.799) (-347.600) -- 0:00:27
558500 -- (-347.075) (-347.154) (-346.716) [-348.664] * (-346.450) [-345.840] (-351.566) (-347.314) -- 0:00:27
559000 -- [-347.746] (-345.677) (-347.262) (-347.985) * [-347.766] (-347.372) (-348.482) (-346.436) -- 0:00:27
559500 -- [-350.946] (-344.726) (-348.387) (-347.393) * [-348.986] (-347.529) (-344.807) (-345.344) -- 0:00:27
560000 -- (-354.293) [-344.753] (-346.529) (-344.896) * (-352.655) (-345.095) (-345.027) [-346.453] -- 0:00:27
Average standard deviation of split frequencies: 0.013116
560500 -- (-348.120) (-347.084) [-345.996] (-347.444) * (-348.300) (-350.598) [-347.620] (-346.964) -- 0:00:27
561000 -- (-352.728) (-347.072) [-346.943] (-349.970) * (-346.734) [-348.797] (-346.747) (-346.231) -- 0:00:27
561500 -- [-346.524] (-346.584) (-344.905) (-351.642) * (-353.495) (-348.245) (-345.880) [-344.757] -- 0:00:27
562000 -- (-347.747) [-345.322] (-349.309) (-352.874) * (-345.408) (-348.808) (-345.543) [-345.856] -- 0:00:27
562500 -- (-344.441) (-345.379) [-347.287] (-347.548) * (-346.028) (-349.278) (-345.381) [-345.209] -- 0:00:27
563000 -- (-346.100) [-345.172] (-346.955) (-347.814) * (-348.920) (-346.872) [-346.536] (-345.592) -- 0:00:27
563500 -- (-348.490) [-347.946] (-347.543) (-349.255) * (-347.412) (-347.526) [-347.178] (-347.762) -- 0:00:27
564000 -- (-345.598) [-346.228] (-345.919) (-345.567) * (-345.096) [-352.523] (-346.963) (-347.287) -- 0:00:27
564500 -- (-346.456) (-348.019) (-345.829) [-352.664] * (-345.635) (-348.545) (-345.211) [-347.899] -- 0:00:27
565000 -- (-348.124) (-347.641) [-346.154] (-351.305) * (-347.896) (-349.155) [-345.309] (-347.212) -- 0:00:26
Average standard deviation of split frequencies: 0.011920
565500 -- [-347.418] (-346.597) (-347.797) (-346.562) * (-348.878) [-348.107] (-344.873) (-347.566) -- 0:00:26
566000 -- [-346.231] (-346.136) (-347.963) (-345.104) * (-346.335) (-346.419) [-344.734] (-346.056) -- 0:00:27
566500 -- [-347.772] (-347.003) (-348.067) (-345.571) * (-347.527) (-349.882) (-346.943) [-347.343] -- 0:00:27
567000 -- (-346.451) [-346.313] (-347.615) (-346.044) * (-346.171) [-345.043] (-347.119) (-348.917) -- 0:00:27
567500 -- [-345.295] (-346.785) (-347.155) (-345.683) * (-347.868) [-345.321] (-345.755) (-351.044) -- 0:00:27
568000 -- [-346.116] (-344.880) (-351.433) (-348.462) * (-345.217) (-347.108) [-345.052] (-346.292) -- 0:00:27
568500 -- [-344.640] (-345.970) (-350.771) (-346.516) * (-349.649) (-346.193) [-345.786] (-347.504) -- 0:00:27
569000 -- (-346.262) (-347.312) (-347.612) [-348.239] * (-346.111) (-346.113) (-346.654) [-346.342] -- 0:00:27
569500 -- (-345.881) [-348.877] (-349.528) (-345.726) * [-346.018] (-349.275) (-347.769) (-346.427) -- 0:00:27
570000 -- (-346.351) (-345.832) (-345.465) [-347.053] * [-344.979] (-345.231) (-347.837) (-350.687) -- 0:00:27
Average standard deviation of split frequencies: 0.011289
570500 -- (-345.780) (-344.633) (-345.771) [-347.313] * (-345.236) (-346.763) (-345.284) [-346.046] -- 0:00:27
571000 -- (-346.785) [-344.534] (-344.449) (-345.076) * [-345.818] (-346.221) (-345.324) (-345.605) -- 0:00:27
571500 -- (-345.003) (-344.503) (-345.297) [-347.773] * (-344.681) (-346.687) (-347.963) [-345.263] -- 0:00:26
572000 -- [-344.906] (-350.133) (-347.663) (-346.390) * (-345.633) (-346.413) (-345.116) [-345.806] -- 0:00:26
572500 -- (-346.636) (-345.950) (-346.231) [-346.808] * (-345.076) [-348.925] (-345.288) (-350.913) -- 0:00:26
573000 -- (-348.725) [-348.065] (-346.873) (-347.453) * (-345.024) (-346.711) [-346.129] (-349.201) -- 0:00:26
573500 -- (-355.335) (-346.103) [-346.297] (-347.346) * (-346.866) [-349.260] (-348.578) (-346.358) -- 0:00:26
574000 -- [-346.850] (-345.616) (-348.986) (-347.029) * (-346.840) (-347.956) (-348.093) [-344.944] -- 0:00:26
574500 -- (-347.578) (-345.729) (-345.403) [-348.011] * (-345.378) (-346.181) [-345.817] (-346.078) -- 0:00:26
575000 -- (-348.048) (-347.030) [-349.116] (-348.809) * [-346.752] (-346.998) (-348.487) (-345.863) -- 0:00:26
Average standard deviation of split frequencies: 0.010967
575500 -- (-348.393) (-345.992) (-346.998) [-345.252] * (-348.822) (-347.593) [-345.935] (-345.738) -- 0:00:26
576000 -- (-348.657) (-346.031) [-351.114] (-344.608) * (-347.990) (-346.722) (-344.839) [-345.113] -- 0:00:26
576500 -- (-345.916) [-348.494] (-346.255) (-346.425) * (-347.936) [-347.149] (-348.178) (-344.764) -- 0:00:26
577000 -- (-348.053) (-347.244) [-346.028] (-348.467) * [-348.712] (-345.995) (-346.208) (-344.702) -- 0:00:26
577500 -- (-346.639) (-346.196) [-346.031] (-350.647) * (-348.005) [-346.497] (-348.389) (-345.394) -- 0:00:26
578000 -- (-347.087) (-345.234) (-347.343) [-345.556] * [-347.930] (-350.422) (-346.930) (-346.967) -- 0:00:26
578500 -- (-345.220) [-346.972] (-347.556) (-345.376) * [-345.947] (-346.445) (-345.984) (-347.912) -- 0:00:26
579000 -- [-348.757] (-345.699) (-347.503) (-346.272) * [-348.808] (-346.284) (-347.318) (-346.321) -- 0:00:26
579500 -- (-344.886) (-345.589) (-346.105) [-345.780] * (-347.252) [-351.202] (-346.185) (-347.240) -- 0:00:26
580000 -- (-350.177) (-345.840) (-346.696) [-346.058] * (-348.509) (-347.316) [-345.778] (-344.692) -- 0:00:26
Average standard deviation of split frequencies: 0.011420
580500 -- (-347.729) [-346.314] (-344.939) (-345.920) * [-345.760] (-345.211) (-346.315) (-344.690) -- 0:00:26
581000 -- (-349.484) (-347.121) [-346.062] (-349.303) * (-350.989) (-346.434) (-348.266) [-344.857] -- 0:00:25
581500 -- (-348.188) [-345.448] (-351.140) (-346.825) * (-349.473) (-344.650) (-345.823) [-345.504] -- 0:00:25
582000 -- [-346.644] (-347.263) (-345.653) (-347.214) * (-347.470) (-345.704) (-348.340) [-348.799] -- 0:00:25
582500 -- (-346.676) (-344.890) (-347.157) [-345.784] * (-346.914) (-348.911) [-346.898] (-347.076) -- 0:00:25
583000 -- [-346.534] (-346.669) (-347.133) (-344.828) * (-344.687) (-347.906) (-347.634) [-347.183] -- 0:00:25
583500 -- [-344.991] (-348.263) (-347.759) (-345.696) * (-344.393) (-345.535) [-348.305] (-344.863) -- 0:00:26
584000 -- (-347.241) (-350.675) [-346.074] (-345.849) * (-346.030) (-351.204) [-345.528] (-348.935) -- 0:00:26
584500 -- (-346.124) (-345.553) (-345.915) [-344.618] * (-348.788) (-349.046) (-345.473) [-344.859] -- 0:00:26
585000 -- (-347.418) [-345.417] (-348.201) (-344.437) * [-344.635] (-346.826) (-345.913) (-346.791) -- 0:00:26
Average standard deviation of split frequencies: 0.010887
585500 -- [-346.208] (-344.606) (-346.482) (-347.641) * (-346.624) (-346.552) (-346.433) [-346.587] -- 0:00:26
586000 -- (-345.411) (-346.260) (-345.803) [-346.348] * (-346.658) [-344.865] (-347.205) (-344.662) -- 0:00:26
586500 -- (-345.927) [-346.488] (-349.351) (-347.018) * (-345.291) (-348.220) [-349.798] (-356.519) -- 0:00:26
587000 -- (-345.403) (-350.181) (-347.140) [-344.935] * (-344.602) (-348.833) [-345.385] (-347.020) -- 0:00:26
587500 -- [-344.838] (-345.834) (-346.249) (-344.828) * (-344.990) (-348.449) (-345.211) [-346.902] -- 0:00:25
588000 -- [-344.772] (-348.023) (-347.649) (-345.461) * [-349.060] (-354.287) (-346.460) (-345.243) -- 0:00:25
588500 -- (-345.517) (-347.076) [-346.184] (-345.518) * [-346.351] (-349.424) (-345.614) (-351.131) -- 0:00:25
589000 -- (-346.886) (-345.219) (-346.664) [-345.027] * (-345.654) (-348.634) [-346.171] (-346.491) -- 0:00:25
589500 -- (-344.962) [-347.076] (-345.905) (-351.725) * (-345.611) (-350.568) [-346.000] (-345.663) -- 0:00:25
590000 -- [-348.542] (-347.570) (-345.959) (-349.801) * (-347.695) [-345.773] (-348.756) (-346.927) -- 0:00:25
Average standard deviation of split frequencies: 0.010375
590500 -- (-348.613) (-348.691) [-346.979] (-345.663) * (-345.991) (-347.637) [-346.402] (-345.478) -- 0:00:25
591000 -- (-348.320) (-351.969) [-346.394] (-348.286) * (-344.571) (-348.487) [-346.788] (-345.738) -- 0:00:25
591500 -- (-348.221) (-346.466) [-346.398] (-346.313) * (-344.822) [-348.451] (-347.456) (-345.941) -- 0:00:25
592000 -- (-345.952) [-346.591] (-346.062) (-347.346) * [-345.400] (-345.662) (-345.526) (-346.535) -- 0:00:25
592500 -- [-346.717] (-344.627) (-346.904) (-347.004) * (-347.274) (-346.040) [-346.787] (-346.939) -- 0:00:25
593000 -- [-344.924] (-345.818) (-345.772) (-345.723) * (-351.518) [-345.353] (-347.587) (-346.347) -- 0:00:25
593500 -- [-345.859] (-346.568) (-347.039) (-346.759) * [-347.267] (-345.653) (-347.308) (-345.353) -- 0:00:25
594000 -- (-344.582) (-347.411) [-347.435] (-348.236) * (-346.103) [-347.030] (-348.024) (-345.083) -- 0:00:25
594500 -- (-345.921) (-350.993) (-345.904) [-346.216] * (-345.689) (-350.603) [-346.416] (-345.754) -- 0:00:25
595000 -- [-345.453] (-347.264) (-348.582) (-349.075) * (-346.284) (-346.767) [-345.235] (-354.762) -- 0:00:25
Average standard deviation of split frequencies: 0.010493
595500 -- [-346.500] (-347.685) (-347.097) (-347.326) * (-352.653) [-349.578] (-346.421) (-349.622) -- 0:00:25
596000 -- (-345.620) (-347.130) [-344.791] (-349.497) * (-345.388) (-346.476) (-345.166) [-347.752] -- 0:00:25
596500 -- [-349.780] (-345.833) (-345.405) (-348.723) * (-345.116) (-347.706) [-346.591] (-348.715) -- 0:00:25
597000 -- (-345.154) (-347.349) [-345.833] (-347.395) * (-345.571) (-348.539) [-347.735] (-347.775) -- 0:00:24
597500 -- [-344.715] (-348.007) (-347.082) (-347.834) * [-345.600] (-349.409) (-349.097) (-345.637) -- 0:00:24
598000 -- [-344.973] (-345.706) (-346.624) (-345.692) * (-345.637) (-348.165) (-350.075) [-345.576] -- 0:00:24
598500 -- [-347.290] (-349.551) (-345.777) (-345.510) * (-349.108) [-345.258] (-347.803) (-345.019) -- 0:00:24
599000 -- (-344.275) (-348.837) (-345.695) [-345.156] * (-346.338) (-345.067) [-344.865] (-349.845) -- 0:00:24
599500 -- [-348.578] (-350.182) (-345.799) (-344.748) * [-347.261] (-345.737) (-347.048) (-347.146) -- 0:00:24
600000 -- (-345.935) (-349.316) [-347.081] (-346.057) * (-346.326) (-345.971) [-347.969] (-346.607) -- 0:00:24
Average standard deviation of split frequencies: 0.009836
600500 -- (-345.408) (-346.581) (-345.196) [-344.564] * [-345.937] (-344.611) (-345.687) (-345.201) -- 0:00:25
601000 -- (-345.956) (-347.647) (-347.394) [-345.806] * (-346.339) (-347.096) (-345.359) [-349.575] -- 0:00:25
601500 -- (-346.578) (-353.125) (-346.103) [-345.260] * (-346.481) (-345.451) (-352.438) [-348.230] -- 0:00:25
602000 -- (-349.153) (-348.555) (-345.680) [-346.783] * [-347.763] (-345.789) (-347.650) (-351.223) -- 0:00:25
602500 -- [-346.285] (-347.010) (-345.325) (-345.001) * [-346.205] (-345.730) (-347.420) (-346.035) -- 0:00:25
603000 -- (-346.377) (-347.373) (-346.399) [-344.436] * [-347.028] (-345.989) (-347.861) (-347.300) -- 0:00:25
603500 -- [-350.802] (-346.686) (-345.735) (-346.145) * [-346.247] (-344.869) (-346.746) (-345.215) -- 0:00:24
604000 -- (-345.891) (-349.418) [-346.239] (-347.385) * (-349.160) [-347.351] (-345.083) (-349.753) -- 0:00:24
604500 -- (-346.971) (-344.888) (-347.524) [-345.112] * (-345.877) (-348.710) [-344.755] (-348.671) -- 0:00:24
605000 -- [-345.709] (-348.039) (-346.681) (-346.791) * (-348.253) [-344.942] (-347.905) (-345.492) -- 0:00:24
Average standard deviation of split frequencies: 0.010372
605500 -- (-346.452) (-347.926) [-346.157] (-347.917) * (-345.981) (-345.938) (-347.104) [-347.233] -- 0:00:24
606000 -- (-344.734) [-345.643] (-346.984) (-346.161) * (-348.469) (-347.627) [-354.105] (-344.668) -- 0:00:24
606500 -- [-345.106] (-347.607) (-351.321) (-346.988) * [-347.555] (-346.100) (-350.778) (-346.653) -- 0:00:24
607000 -- (-345.453) [-345.116] (-350.153) (-345.210) * (-347.902) [-346.884] (-350.913) (-347.162) -- 0:00:24
607500 -- (-349.678) (-347.637) (-349.338) [-349.196] * [-344.955] (-344.640) (-351.603) (-344.915) -- 0:00:24
608000 -- (-347.973) (-347.966) [-347.779] (-345.726) * [-344.324] (-345.843) (-346.174) (-347.838) -- 0:00:24
608500 -- (-350.560) (-349.243) [-344.941] (-345.056) * (-347.281) (-346.380) (-351.008) [-346.826] -- 0:00:24
609000 -- (-346.194) (-346.317) (-348.339) [-348.700] * (-346.730) [-345.494] (-347.540) (-344.516) -- 0:00:24
609500 -- (-347.841) [-345.841] (-345.934) (-345.471) * (-347.043) (-347.515) [-347.101] (-355.521) -- 0:00:24
610000 -- (-349.960) (-344.966) [-346.178] (-348.083) * [-346.907] (-351.682) (-346.364) (-348.270) -- 0:00:24
Average standard deviation of split frequencies: 0.009984
610500 -- (-349.702) [-348.864] (-345.049) (-349.925) * [-347.309] (-348.100) (-347.591) (-348.606) -- 0:00:24
611000 -- (-346.162) [-348.879] (-348.393) (-348.187) * [-347.003] (-346.370) (-346.916) (-349.416) -- 0:00:24
611500 -- (-349.231) [-349.253] (-351.001) (-344.993) * (-346.990) (-347.576) [-346.504] (-346.289) -- 0:00:24
612000 -- (-345.682) [-347.513] (-361.097) (-346.206) * (-349.982) [-344.819] (-348.040) (-348.672) -- 0:00:24
612500 -- (-349.633) [-347.848] (-349.054) (-346.070) * (-348.300) (-345.260) [-346.349] (-349.838) -- 0:00:24
613000 -- [-345.826] (-347.174) (-345.505) (-347.901) * [-345.813] (-349.082) (-347.349) (-344.960) -- 0:00:23
613500 -- [-345.353] (-348.979) (-346.941) (-347.954) * (-346.400) (-351.957) [-345.606] (-346.409) -- 0:00:23
614000 -- (-351.789) (-349.889) (-345.004) [-349.635] * (-346.618) (-348.112) (-348.428) [-346.495] -- 0:00:23
614500 -- (-350.991) [-346.700] (-346.223) (-346.811) * (-345.863) [-348.150] (-350.647) (-345.074) -- 0:00:23
615000 -- [-346.714] (-347.671) (-346.833) (-345.464) * (-348.410) [-345.996] (-348.736) (-345.310) -- 0:00:23
Average standard deviation of split frequencies: 0.009897
615500 -- (-344.998) [-347.569] (-347.426) (-345.583) * (-346.498) [-347.316] (-347.446) (-346.155) -- 0:00:23
616000 -- (-349.445) (-345.738) (-348.572) [-345.986] * [-344.801] (-355.403) (-344.464) (-345.752) -- 0:00:23
616500 -- (-346.489) (-346.192) [-347.027] (-348.354) * (-347.353) (-348.009) [-347.827] (-345.798) -- 0:00:23
617000 -- [-348.958] (-346.403) (-345.907) (-347.322) * (-348.416) (-347.044) [-347.140] (-345.416) -- 0:00:23
617500 -- (-348.334) (-351.552) [-345.913] (-346.702) * (-346.013) [-344.709] (-346.527) (-350.243) -- 0:00:24
618000 -- (-347.780) (-347.436) (-345.270) [-346.431] * [-344.652] (-346.832) (-344.817) (-348.375) -- 0:00:24
618500 -- [-346.868] (-346.419) (-345.457) (-351.833) * (-347.997) (-346.006) (-348.131) [-348.884] -- 0:00:24
619000 -- (-347.145) (-348.715) [-344.972] (-348.434) * (-345.964) [-347.518] (-347.977) (-347.304) -- 0:00:24
619500 -- [-347.883] (-345.230) (-345.825) (-349.182) * (-350.247) (-349.155) (-348.605) [-346.934] -- 0:00:23
620000 -- (-349.104) (-351.656) (-347.069) [-345.438] * [-345.698] (-346.299) (-347.470) (-351.920) -- 0:00:23
Average standard deviation of split frequencies: 0.009823
620500 -- [-344.842] (-347.979) (-345.837) (-344.889) * (-347.398) (-346.481) (-349.638) [-346.477] -- 0:00:23
621000 -- [-344.863] (-350.929) (-350.418) (-344.759) * (-346.258) (-348.558) (-347.003) [-345.026] -- 0:00:23
621500 -- (-348.549) [-345.681] (-347.569) (-344.731) * [-346.215] (-347.843) (-348.362) (-346.241) -- 0:00:23
622000 -- (-346.591) (-356.063) (-346.612) [-345.789] * [-346.215] (-347.152) (-346.438) (-346.983) -- 0:00:23
622500 -- (-345.595) [-346.397] (-349.727) (-346.183) * [-344.859] (-345.118) (-346.418) (-346.845) -- 0:00:23
623000 -- (-345.218) [-347.833] (-346.952) (-346.899) * (-346.770) [-346.467] (-348.265) (-345.381) -- 0:00:23
623500 -- [-345.101] (-347.354) (-348.079) (-345.420) * (-347.194) (-345.202) [-347.087] (-345.621) -- 0:00:23
624000 -- (-348.141) [-345.530] (-351.508) (-347.721) * (-348.235) [-346.564] (-349.060) (-347.019) -- 0:00:23
624500 -- [-351.394] (-344.759) (-354.101) (-346.554) * (-348.989) (-347.344) (-346.189) [-346.292] -- 0:00:23
625000 -- (-347.040) [-347.595] (-350.868) (-349.500) * [-347.062] (-347.134) (-346.235) (-345.344) -- 0:00:23
Average standard deviation of split frequencies: 0.009790
625500 -- [-345.210] (-346.121) (-347.215) (-348.207) * (-346.003) [-348.508] (-345.451) (-346.397) -- 0:00:23
626000 -- (-349.198) [-346.670] (-346.170) (-346.155) * [-345.266] (-353.057) (-345.814) (-348.483) -- 0:00:23
626500 -- [-348.194] (-345.116) (-354.091) (-350.275) * (-345.082) (-346.838) [-345.048] (-352.706) -- 0:00:23
627000 -- (-348.741) (-344.875) (-346.976) [-344.586] * (-344.819) (-346.159) [-345.569] (-346.273) -- 0:00:23
627500 -- (-349.155) (-345.594) [-346.844] (-348.762) * [-345.094] (-347.175) (-348.621) (-346.684) -- 0:00:23
628000 -- [-344.835] (-345.665) (-354.154) (-345.410) * (-347.127) (-346.489) [-346.204] (-348.420) -- 0:00:23
628500 -- [-346.088] (-349.793) (-345.712) (-345.607) * [-347.887] (-346.482) (-346.481) (-347.071) -- 0:00:23
629000 -- (-345.809) [-344.638] (-348.539) (-346.216) * (-346.358) (-346.195) (-347.379) [-345.063] -- 0:00:23
629500 -- [-347.119] (-347.472) (-345.812) (-344.725) * (-346.269) [-347.462] (-344.794) (-345.345) -- 0:00:22
630000 -- (-345.230) (-346.553) [-346.107] (-344.680) * [-348.585] (-347.389) (-347.387) (-346.525) -- 0:00:22
Average standard deviation of split frequencies: 0.009518
630500 -- (-345.388) (-346.947) (-346.709) [-347.243] * (-345.240) (-346.494) (-351.544) [-344.822] -- 0:00:22
631000 -- (-346.823) [-346.534] (-350.344) (-348.896) * (-347.790) (-348.633) [-350.007] (-346.665) -- 0:00:22
631500 -- (-349.267) [-347.011] (-347.753) (-347.477) * (-347.839) (-346.102) [-345.923] (-347.821) -- 0:00:22
632000 -- (-346.343) (-345.393) [-345.092] (-346.504) * (-346.639) [-346.211] (-347.277) (-346.385) -- 0:00:22
632500 -- (-346.139) (-346.096) (-345.821) [-347.940] * (-348.164) (-345.690) [-352.245] (-345.682) -- 0:00:22
633000 -- [-345.767] (-344.763) (-345.540) (-345.076) * [-348.242] (-346.783) (-347.928) (-346.232) -- 0:00:22
633500 -- (-349.496) [-347.342] (-345.641) (-345.556) * (-351.551) [-347.684] (-347.446) (-346.713) -- 0:00:22
634000 -- (-346.627) (-346.149) (-344.702) [-349.224] * [-347.814] (-346.375) (-345.961) (-347.856) -- 0:00:22
634500 -- [-347.385] (-347.107) (-348.063) (-349.320) * (-348.539) [-345.724] (-345.551) (-349.708) -- 0:00:23
635000 -- (-347.676) (-347.721) (-346.799) [-346.007] * (-347.478) (-346.068) [-346.293] (-346.159) -- 0:00:22
Average standard deviation of split frequencies: 0.009487
635500 -- [-349.451] (-346.954) (-346.863) (-348.715) * (-346.594) (-346.443) [-346.115] (-348.154) -- 0:00:22
636000 -- (-347.154) (-345.688) (-346.576) [-348.309] * (-344.545) (-348.561) (-347.059) [-347.421] -- 0:00:22
636500 -- (-347.465) (-344.632) (-346.291) [-348.307] * (-347.531) (-350.100) (-349.030) [-346.072] -- 0:00:22
637000 -- [-349.073] (-345.462) (-346.305) (-345.429) * (-349.392) (-346.105) (-344.761) [-346.997] -- 0:00:22
637500 -- (-347.714) (-345.966) [-347.950] (-344.885) * (-345.552) (-346.689) (-345.959) [-347.199] -- 0:00:22
638000 -- [-348.865] (-349.164) (-345.274) (-346.795) * (-348.460) [-346.876] (-348.778) (-346.001) -- 0:00:22
638500 -- (-344.723) [-347.018] (-347.665) (-346.911) * [-348.279] (-344.717) (-346.845) (-347.394) -- 0:00:22
639000 -- (-345.460) (-347.972) [-346.925] (-349.368) * (-348.233) (-345.314) [-346.068] (-347.198) -- 0:00:22
639500 -- [-346.456] (-345.353) (-346.522) (-345.690) * (-344.811) [-345.114] (-347.345) (-345.289) -- 0:00:22
640000 -- (-348.667) [-348.799] (-347.126) (-347.212) * (-346.523) (-348.584) [-347.631] (-348.411) -- 0:00:22
Average standard deviation of split frequencies: 0.009762
640500 -- (-346.598) [-348.090] (-355.594) (-347.977) * (-345.643) (-346.187) [-350.941] (-351.593) -- 0:00:22
641000 -- (-350.477) [-348.396] (-351.092) (-352.438) * [-344.939] (-347.353) (-347.065) (-347.716) -- 0:00:22
641500 -- (-347.331) [-347.343] (-345.845) (-348.946) * (-346.665) (-345.232) [-346.249] (-344.964) -- 0:00:22
642000 -- (-346.532) (-357.740) [-347.165] (-346.258) * (-351.557) [-345.498] (-347.368) (-346.734) -- 0:00:22
642500 -- [-345.516] (-350.771) (-347.252) (-347.126) * (-345.957) (-346.276) (-346.925) [-346.642] -- 0:00:22
643000 -- (-345.630) (-346.108) (-347.993) [-348.704] * (-346.572) [-346.216] (-349.418) (-347.013) -- 0:00:22
643500 -- (-346.292) (-347.736) (-345.078) [-346.180] * (-344.808) (-345.856) [-348.460] (-344.949) -- 0:00:22
644000 -- (-347.147) [-346.433] (-344.686) (-351.350) * [-345.309] (-344.758) (-346.638) (-345.611) -- 0:00:22
644500 -- (-346.637) (-350.275) [-344.532] (-346.218) * (-344.866) (-345.959) (-348.613) [-346.809] -- 0:00:22
645000 -- (-345.635) [-345.921] (-349.136) (-348.686) * (-344.858) (-345.829) [-346.376] (-345.834) -- 0:00:22
Average standard deviation of split frequencies: 0.009973
645500 -- (-345.676) [-346.180] (-346.184) (-351.733) * (-347.370) (-346.902) (-345.395) [-344.837] -- 0:00:21
646000 -- [-346.131] (-348.373) (-345.982) (-355.846) * [-345.773] (-345.821) (-346.381) (-344.871) -- 0:00:21
646500 -- [-348.023] (-346.046) (-346.455) (-350.992) * [-346.003] (-345.012) (-346.726) (-348.455) -- 0:00:21
647000 -- (-349.770) [-347.156] (-344.824) (-345.953) * (-345.062) (-349.458) (-347.181) [-345.631] -- 0:00:21
647500 -- (-346.637) (-348.017) (-344.744) [-349.497] * (-348.073) (-348.167) [-351.346] (-345.727) -- 0:00:21
648000 -- (-347.004) (-346.070) [-347.166] (-348.624) * (-348.385) (-345.739) (-347.271) [-348.050] -- 0:00:21
648500 -- (-346.471) [-346.671] (-345.915) (-346.691) * (-348.797) [-345.597] (-346.045) (-348.494) -- 0:00:21
649000 -- (-345.555) (-346.185) (-345.775) [-347.765] * (-351.072) (-346.399) [-346.245] (-347.166) -- 0:00:21
649500 -- (-349.168) [-347.299] (-345.975) (-350.602) * (-349.755) (-345.606) (-345.381) [-344.942] -- 0:00:21
650000 -- (-347.772) (-346.375) (-348.146) [-346.685] * (-347.698) [-347.655] (-345.441) (-345.904) -- 0:00:21
Average standard deviation of split frequencies: 0.010336
650500 -- (-344.701) [-346.902] (-345.574) (-347.584) * (-346.358) [-348.406] (-346.198) (-345.510) -- 0:00:21
651000 -- (-345.929) (-345.889) (-347.371) [-346.877] * (-345.621) (-347.580) (-347.179) [-345.876] -- 0:00:21
651500 -- (-348.053) (-345.604) [-347.748] (-347.137) * (-345.294) (-347.596) [-345.456] (-345.741) -- 0:00:21
652000 -- (-349.889) (-346.337) [-346.463] (-350.575) * (-344.854) (-345.798) [-348.095] (-347.819) -- 0:00:21
652500 -- (-345.802) (-348.613) [-349.235] (-347.682) * (-346.990) (-349.621) [-346.129] (-348.316) -- 0:00:21
653000 -- (-349.910) [-348.214] (-348.433) (-346.316) * (-348.941) [-346.423] (-347.943) (-346.706) -- 0:00:21
653500 -- [-350.417] (-348.363) (-348.034) (-348.100) * (-346.231) (-345.965) (-348.328) [-345.409] -- 0:00:21
654000 -- (-346.975) (-349.991) (-346.621) [-345.599] * (-348.201) [-346.043] (-347.752) (-345.301) -- 0:00:21
654500 -- [-349.708] (-346.846) (-346.878) (-345.594) * (-351.396) (-350.145) (-347.412) [-346.348] -- 0:00:21
655000 -- (-351.348) [-345.656] (-345.677) (-348.123) * (-346.303) [-350.616] (-345.878) (-348.120) -- 0:00:21
Average standard deviation of split frequencies: 0.009965
655500 -- (-346.116) [-346.454] (-348.715) (-347.820) * [-348.861] (-346.045) (-347.347) (-347.533) -- 0:00:21
656000 -- [-344.826] (-347.501) (-345.963) (-349.099) * (-344.689) (-346.688) [-347.319] (-344.683) -- 0:00:21
656500 -- (-347.734) (-350.233) (-346.934) [-347.455] * (-344.910) (-345.293) [-348.275] (-346.191) -- 0:00:21
657000 -- [-346.806] (-346.683) (-347.422) (-346.906) * (-345.995) (-346.040) [-347.396] (-346.156) -- 0:00:21
657500 -- (-346.298) (-354.214) (-346.611) [-344.910] * (-345.263) [-346.447] (-347.555) (-346.803) -- 0:00:21
658000 -- (-350.740) [-347.690] (-345.547) (-344.823) * (-346.582) [-345.380] (-344.993) (-349.325) -- 0:00:21
658500 -- (-348.010) (-346.034) [-345.945] (-346.921) * (-345.372) [-348.078] (-347.266) (-344.508) -- 0:00:21
659000 -- [-345.661] (-346.154) (-347.729) (-347.268) * (-345.275) (-346.536) (-347.531) [-346.104] -- 0:00:21
659500 -- (-345.818) (-347.881) (-349.107) [-345.329] * (-346.355) (-346.171) (-345.949) [-346.064] -- 0:00:21
660000 -- (-345.250) (-350.358) (-346.157) [-347.224] * (-347.777) (-346.857) [-348.376] (-348.589) -- 0:00:21
Average standard deviation of split frequencies: 0.009752
660500 -- (-346.499) (-348.412) (-346.159) [-344.681] * (-346.876) [-347.502] (-352.182) (-347.982) -- 0:00:21
661000 -- (-345.578) [-345.940] (-348.267) (-345.364) * (-348.743) (-344.920) [-345.406] (-346.918) -- 0:00:21
661500 -- (-348.818) (-347.848) [-346.440] (-349.567) * (-345.252) (-349.670) [-345.581] (-345.776) -- 0:00:20
662000 -- [-347.232] (-347.559) (-345.705) (-351.225) * (-347.383) [-348.661] (-344.696) (-346.815) -- 0:00:20
662500 -- (-345.119) (-345.485) [-346.689] (-350.144) * (-352.762) (-345.580) [-346.501] (-345.801) -- 0:00:20
663000 -- [-349.255] (-348.462) (-347.498) (-347.363) * (-345.229) [-346.402] (-345.256) (-350.001) -- 0:00:20
663500 -- (-347.350) (-348.198) [-345.912] (-346.277) * (-346.312) [-345.969] (-345.395) (-348.629) -- 0:00:20
664000 -- [-350.774] (-345.120) (-347.751) (-353.141) * [-349.394] (-352.064) (-347.948) (-345.931) -- 0:00:20
664500 -- (-352.428) [-349.413] (-345.625) (-347.323) * [-346.698] (-348.526) (-345.077) (-347.833) -- 0:00:20
665000 -- [-345.369] (-347.075) (-345.401) (-347.387) * (-346.329) (-347.643) [-345.065] (-347.793) -- 0:00:20
Average standard deviation of split frequencies: 0.009025
665500 -- (-345.720) [-345.233] (-346.489) (-348.850) * (-345.912) (-345.621) [-346.176] (-346.390) -- 0:00:20
666000 -- (-345.841) (-344.556) [-345.579] (-351.494) * (-346.812) (-349.389) [-345.632] (-347.764) -- 0:00:20
666500 -- (-346.156) (-349.080) (-347.818) [-348.706] * (-346.787) (-347.561) [-347.366] (-347.463) -- 0:00:20
667000 -- (-344.358) (-345.692) [-347.076] (-346.974) * (-345.838) [-346.229] (-348.861) (-346.058) -- 0:00:20
667500 -- (-346.686) (-346.206) [-346.893] (-349.456) * (-347.051) (-346.876) [-346.634] (-347.852) -- 0:00:20
668000 -- [-345.522] (-345.906) (-345.497) (-345.655) * (-347.162) (-345.655) [-348.267] (-347.792) -- 0:00:20
668500 -- (-346.953) (-344.924) [-346.111] (-344.847) * [-346.903] (-345.376) (-346.066) (-348.695) -- 0:00:20
669000 -- (-348.239) (-345.507) [-345.694] (-348.513) * (-345.685) (-345.322) [-345.829] (-346.969) -- 0:00:20
669500 -- (-345.039) (-348.950) (-346.110) [-348.159] * [-346.378] (-344.852) (-345.006) (-347.288) -- 0:00:20
670000 -- (-347.859) [-348.590] (-345.153) (-349.407) * (-346.832) (-347.406) (-345.483) [-345.235] -- 0:00:20
Average standard deviation of split frequencies: 0.008918
670500 -- (-346.562) (-345.840) (-347.663) [-345.553] * (-349.463) (-348.620) [-348.260] (-344.813) -- 0:00:20
671000 -- (-346.079) (-351.035) (-348.582) [-348.915] * [-348.484] (-348.391) (-346.562) (-346.219) -- 0:00:20
671500 -- (-346.928) [-349.356] (-348.200) (-348.215) * (-346.445) (-344.754) [-347.511] (-345.909) -- 0:00:20
672000 -- [-345.004] (-345.917) (-346.129) (-345.675) * (-346.482) (-344.962) [-344.387] (-346.860) -- 0:00:20
672500 -- [-345.931] (-345.735) (-347.489) (-345.659) * (-346.150) (-344.735) (-349.335) [-345.020] -- 0:00:20
673000 -- [-344.595] (-347.188) (-347.908) (-346.204) * (-347.069) [-345.077] (-350.291) (-346.617) -- 0:00:20
673500 -- (-344.618) [-348.643] (-351.722) (-345.660) * (-347.707) (-345.161) (-349.552) [-350.190] -- 0:00:20
674000 -- (-346.965) (-345.936) [-350.271] (-349.270) * (-346.217) (-345.317) (-350.144) [-346.015] -- 0:00:20
674500 -- (-346.732) [-346.745] (-346.723) (-345.777) * (-345.586) (-347.461) (-348.966) [-345.827] -- 0:00:20
675000 -- (-345.138) (-345.115) [-344.997] (-346.130) * (-348.568) (-348.372) [-346.003] (-350.454) -- 0:00:20
Average standard deviation of split frequencies: 0.009632
675500 -- (-346.457) [-345.956] (-345.513) (-348.052) * (-346.551) (-349.284) [-347.469] (-347.080) -- 0:00:20
676000 -- [-347.895] (-351.029) (-346.785) (-347.793) * (-348.250) [-346.376] (-344.494) (-351.288) -- 0:00:20
676500 -- (-349.123) (-345.318) (-348.447) [-345.239] * (-346.349) (-347.415) [-348.564] (-347.900) -- 0:00:20
677000 -- (-349.656) (-347.082) [-350.465] (-344.788) * (-345.140) [-344.817] (-346.767) (-346.121) -- 0:00:20
677500 -- (-347.406) (-347.033) (-349.462) [-347.317] * [-348.152] (-345.523) (-345.594) (-346.298) -- 0:00:19
678000 -- (-346.711) [-347.815] (-352.549) (-346.236) * (-344.927) [-346.026] (-347.180) (-347.559) -- 0:00:19
678500 -- (-346.319) (-346.515) (-351.079) [-345.274] * [-345.878] (-345.672) (-345.607) (-346.493) -- 0:00:19
679000 -- (-344.871) (-347.874) (-345.893) [-345.816] * [-347.056] (-348.053) (-348.794) (-345.460) -- 0:00:19
679500 -- [-345.455] (-349.287) (-345.413) (-347.757) * (-345.550) [-345.779] (-347.686) (-347.726) -- 0:00:19
680000 -- (-346.995) [-352.261] (-344.625) (-346.831) * (-345.965) [-344.860] (-352.798) (-348.803) -- 0:00:19
Average standard deviation of split frequencies: 0.009176
680500 -- [-348.334] (-346.515) (-345.837) (-347.019) * (-345.340) (-347.890) (-347.738) [-348.192] -- 0:00:19
681000 -- (-345.078) (-347.348) (-345.675) [-350.296] * [-346.624] (-344.660) (-356.746) (-347.885) -- 0:00:19
681500 -- [-344.721] (-346.133) (-346.202) (-349.970) * (-348.708) (-347.605) (-344.962) [-348.243] -- 0:00:19
682000 -- [-344.682] (-346.566) (-346.316) (-346.895) * (-347.323) (-351.809) [-345.737] (-349.424) -- 0:00:19
682500 -- (-345.154) [-345.569] (-348.894) (-345.905) * (-348.699) [-346.502] (-349.856) (-349.607) -- 0:00:19
683000 -- [-347.335] (-350.723) (-346.553) (-345.287) * (-346.080) [-346.157] (-346.458) (-347.216) -- 0:00:19
683500 -- (-349.456) (-345.162) [-344.820] (-346.420) * (-347.016) (-345.964) [-351.362] (-346.572) -- 0:00:19
684000 -- [-345.413] (-345.456) (-345.625) (-346.506) * (-345.544) (-346.683) (-350.956) [-345.957] -- 0:00:19
684500 -- (-345.140) [-347.035] (-347.857) (-345.800) * (-345.783) [-348.322] (-345.663) (-345.771) -- 0:00:19
685000 -- (-346.105) (-350.104) [-346.726] (-346.850) * (-346.526) [-346.624] (-346.387) (-347.623) -- 0:00:19
Average standard deviation of split frequencies: 0.009406
685500 -- (-347.447) (-346.272) [-348.415] (-349.036) * (-349.562) (-346.929) [-345.716] (-345.521) -- 0:00:19
686000 -- (-345.792) (-347.540) [-347.843] (-352.266) * [-345.111] (-346.953) (-345.284) (-346.597) -- 0:00:19
686500 -- [-348.481] (-345.738) (-349.780) (-348.997) * (-345.557) (-345.303) [-348.360] (-348.024) -- 0:00:19
687000 -- (-346.171) (-345.927) (-346.621) [-347.015] * (-346.783) (-345.445) (-347.176) [-351.270] -- 0:00:19
687500 -- (-350.166) (-344.977) [-344.975] (-350.757) * (-345.170) (-345.433) [-346.274] (-349.988) -- 0:00:19
688000 -- [-346.948] (-345.892) (-347.658) (-346.604) * [-352.572] (-345.772) (-346.257) (-344.889) -- 0:00:19
688500 -- (-352.315) (-348.699) [-345.858] (-346.975) * [-347.421] (-347.757) (-346.068) (-345.474) -- 0:00:19
689000 -- (-345.650) (-347.235) (-348.997) [-347.813] * (-346.201) (-348.428) (-346.879) [-345.873] -- 0:00:19
689500 -- (-350.322) (-349.258) [-349.544] (-348.357) * (-345.866) (-348.174) [-346.463] (-345.194) -- 0:00:19
690000 -- (-346.398) (-347.373) (-349.977) [-348.106] * (-347.166) (-347.582) (-349.217) [-345.456] -- 0:00:19
Average standard deviation of split frequencies: 0.009641
690500 -- (-345.759) (-346.397) [-350.422] (-348.132) * [-347.378] (-346.956) (-352.706) (-344.987) -- 0:00:19
691000 -- [-344.898] (-346.393) (-347.606) (-347.299) * [-347.056] (-346.258) (-351.265) (-346.127) -- 0:00:19
691500 -- (-345.081) (-344.991) (-346.205) [-345.578] * (-345.236) (-347.051) [-349.707] (-344.841) -- 0:00:19
692000 -- (-345.625) [-349.746] (-345.941) (-345.897) * [-345.749] (-349.570) (-348.351) (-347.854) -- 0:00:19
692500 -- (-346.998) (-346.140) (-345.959) [-345.150] * (-349.253) (-346.068) (-349.734) [-349.150] -- 0:00:19
693000 -- (-349.054) (-344.913) (-346.917) [-344.898] * (-347.402) (-351.238) [-348.512] (-346.713) -- 0:00:19
693500 -- (-348.831) (-347.259) (-345.869) [-348.789] * (-344.432) (-346.529) [-348.725] (-345.984) -- 0:00:19
694000 -- (-350.102) (-346.717) (-346.300) [-348.952] * [-347.819] (-345.238) (-347.116) (-348.476) -- 0:00:18
694500 -- (-346.608) (-348.636) (-346.259) [-347.157] * [-349.784] (-351.637) (-352.959) (-346.679) -- 0:00:18
695000 -- (-345.419) [-348.364] (-344.427) (-348.735) * (-348.505) (-351.484) [-347.688] (-348.742) -- 0:00:18
Average standard deviation of split frequencies: 0.009525
695500 -- (-346.825) (-350.441) [-346.612] (-347.348) * (-347.522) [-348.654] (-345.824) (-348.564) -- 0:00:18
696000 -- (-347.441) (-346.007) (-344.648) [-349.080] * (-344.492) (-349.100) [-346.491] (-346.127) -- 0:00:18
696500 -- (-346.315) (-346.528) [-345.131] (-346.290) * [-344.483] (-345.329) (-345.641) (-349.141) -- 0:00:18
697000 -- (-346.670) (-348.276) [-345.611] (-346.514) * (-344.685) (-346.909) [-346.294] (-347.318) -- 0:00:18
697500 -- (-345.140) [-345.573] (-347.374) (-350.831) * [-344.675] (-348.773) (-345.735) (-345.548) -- 0:00:18
698000 -- (-347.482) (-345.523) (-352.952) [-349.787] * [-344.595] (-346.292) (-345.356) (-347.269) -- 0:00:18
698500 -- [-346.678] (-345.424) (-348.394) (-349.999) * (-346.188) (-349.769) (-345.901) [-346.091] -- 0:00:18
699000 -- (-350.956) [-345.161] (-349.386) (-347.287) * (-345.498) (-345.363) [-345.039] (-348.138) -- 0:00:18
699500 -- (-347.635) [-346.030] (-349.300) (-354.240) * [-347.928] (-347.668) (-352.431) (-348.790) -- 0:00:18
700000 -- (-346.886) (-348.500) [-349.774] (-350.990) * (-347.220) (-345.421) (-352.077) [-347.059] -- 0:00:18
Average standard deviation of split frequencies: 0.009756
700500 -- (-346.955) (-347.288) [-355.629] (-349.368) * (-346.539) [-346.758] (-347.891) (-347.211) -- 0:00:18
701000 -- (-345.418) (-346.215) (-352.366) [-344.812] * (-349.370) (-345.084) (-347.784) [-345.262] -- 0:00:18
701500 -- [-347.841] (-344.868) (-348.512) (-347.777) * [-347.759] (-345.131) (-350.785) (-346.467) -- 0:00:18
702000 -- (-344.659) (-348.051) (-346.171) [-344.877] * (-349.083) (-346.042) [-344.798] (-345.488) -- 0:00:18
702500 -- (-347.130) (-346.222) (-345.767) [-345.903] * (-349.518) [-349.120] (-346.670) (-345.857) -- 0:00:18
703000 -- (-345.355) (-345.783) [-345.196] (-345.542) * (-347.414) (-345.773) [-345.429] (-346.954) -- 0:00:18
703500 -- (-345.399) [-346.911] (-346.707) (-351.267) * (-348.201) (-347.814) (-344.798) [-347.719] -- 0:00:18
704000 -- [-346.170] (-346.992) (-346.212) (-351.757) * (-344.591) (-349.164) [-349.087] (-346.393) -- 0:00:18
704500 -- [-346.651] (-347.043) (-348.043) (-350.037) * (-345.359) (-349.860) (-346.051) [-348.095] -- 0:00:18
705000 -- [-347.795] (-347.564) (-345.351) (-349.078) * (-348.026) [-345.712] (-344.784) (-346.057) -- 0:00:18
Average standard deviation of split frequencies: 0.009974
705500 -- (-347.501) (-347.929) [-346.588] (-346.255) * (-349.899) (-345.344) (-345.087) [-346.446] -- 0:00:18
706000 -- (-352.158) [-346.677] (-347.373) (-352.569) * (-346.889) (-346.398) [-346.684] (-346.951) -- 0:00:18
706500 -- (-346.848) (-346.754) [-345.792] (-350.177) * (-345.748) (-345.726) [-347.061] (-346.936) -- 0:00:18
707000 -- (-347.121) (-347.919) (-346.275) [-348.416] * [-345.739] (-345.845) (-348.280) (-346.158) -- 0:00:18
707500 -- [-345.516] (-345.748) (-347.261) (-346.487) * (-346.179) (-345.808) [-352.280] (-346.590) -- 0:00:18
708000 -- [-344.971] (-345.341) (-345.442) (-347.014) * (-345.497) [-346.055] (-347.459) (-346.092) -- 0:00:18
708500 -- [-344.345] (-346.832) (-347.174) (-346.015) * (-347.284) (-346.580) (-347.573) [-344.979] -- 0:00:18
709000 -- (-347.269) (-346.064) (-355.064) [-348.070] * (-345.929) [-345.943] (-346.314) (-345.385) -- 0:00:18
709500 -- (-345.236) (-346.708) (-350.860) [-345.965] * [-346.161] (-347.717) (-348.456) (-344.608) -- 0:00:18
710000 -- (-346.528) (-347.870) [-345.392] (-345.396) * [-346.842] (-346.964) (-346.516) (-345.153) -- 0:00:17
Average standard deviation of split frequencies: 0.009596
710500 -- (-346.503) (-346.312) [-347.014] (-346.079) * (-348.138) [-345.479] (-347.834) (-345.885) -- 0:00:17
711000 -- (-345.600) (-346.628) (-345.961) [-344.418] * (-346.296) (-346.143) (-350.956) [-351.011] -- 0:00:17
711500 -- (-346.977) (-349.063) [-345.796] (-346.108) * (-345.667) (-346.628) (-346.058) [-345.484] -- 0:00:17
712000 -- (-349.465) (-346.758) (-344.568) [-347.273] * [-346.465] (-346.505) (-348.170) (-346.460) -- 0:00:17
712500 -- (-347.628) (-346.600) [-346.396] (-348.612) * (-346.767) (-346.029) (-348.239) [-346.324] -- 0:00:17
713000 -- [-346.625] (-345.422) (-348.345) (-348.759) * (-347.397) (-347.351) [-345.176] (-345.993) -- 0:00:17
713500 -- (-346.727) (-346.100) (-346.621) [-348.187] * (-350.394) [-345.490] (-344.802) (-345.614) -- 0:00:17
714000 -- [-344.811] (-345.822) (-346.033) (-346.938) * (-346.381) (-349.323) (-348.285) [-344.575] -- 0:00:17
714500 -- (-344.811) [-347.613] (-346.417) (-345.933) * (-345.598) (-346.015) (-345.339) [-346.464] -- 0:00:17
715000 -- (-345.284) [-348.191] (-346.850) (-346.721) * [-346.099] (-345.430) (-345.220) (-346.571) -- 0:00:17
Average standard deviation of split frequencies: 0.009832
715500 -- (-346.202) (-348.174) (-346.051) [-346.268] * (-344.690) [-348.315] (-346.801) (-347.310) -- 0:00:17
716000 -- [-347.386] (-347.028) (-347.002) (-346.829) * (-346.207) (-348.060) (-347.681) [-347.727] -- 0:00:17
716500 -- (-346.327) (-346.056) (-346.975) [-346.910] * (-346.736) (-346.111) [-347.565] (-345.793) -- 0:00:17
717000 -- (-345.595) (-347.997) (-345.155) [-345.877] * [-345.571] (-347.250) (-345.291) (-344.451) -- 0:00:17
717500 -- [-347.984] (-345.887) (-348.942) (-347.609) * (-346.662) [-346.808] (-348.367) (-348.251) -- 0:00:17
718000 -- (-347.441) (-349.838) [-347.120] (-346.631) * (-345.892) (-347.670) [-347.514] (-345.400) -- 0:00:17
718500 -- (-347.372) (-347.878) [-345.109] (-345.746) * (-346.187) [-347.070] (-349.316) (-345.521) -- 0:00:17
719000 -- (-347.250) (-351.092) (-348.077) [-344.469] * [-347.677] (-351.100) (-346.394) (-347.235) -- 0:00:17
719500 -- (-345.686) (-347.287) [-345.855] (-346.525) * (-347.680) (-346.200) (-347.675) [-348.251] -- 0:00:17
720000 -- (-346.848) (-347.021) [-345.658] (-346.706) * (-349.460) (-350.972) (-347.667) [-345.721] -- 0:00:17
Average standard deviation of split frequencies: 0.009550
720500 -- (-346.690) (-346.742) (-345.528) [-346.170] * [-346.214] (-349.189) (-346.826) (-348.498) -- 0:00:17
721000 -- (-346.159) (-347.617) (-345.297) [-346.692] * [-350.375] (-347.214) (-346.096) (-350.258) -- 0:00:17
721500 -- (-345.047) (-346.863) [-349.885] (-345.894) * (-346.920) [-347.376] (-347.479) (-346.857) -- 0:00:17
722000 -- (-346.939) [-344.823] (-344.917) (-346.077) * [-346.466] (-347.575) (-345.088) (-349.964) -- 0:00:17
722500 -- (-346.633) (-348.839) (-347.087) [-344.868] * (-345.234) (-347.483) (-347.974) [-346.109] -- 0:00:17
723000 -- (-348.877) (-346.917) [-346.043] (-345.380) * (-348.123) (-348.508) (-345.486) [-346.807] -- 0:00:17
723500 -- (-347.360) [-352.017] (-346.909) (-348.543) * (-345.239) (-350.536) [-345.956] (-346.675) -- 0:00:17
724000 -- (-346.018) [-346.626] (-347.925) (-349.196) * (-345.045) (-345.480) (-345.957) [-345.816] -- 0:00:17
724500 -- (-346.287) (-346.808) [-348.883] (-351.464) * (-349.571) (-345.299) (-347.030) [-347.731] -- 0:00:17
725000 -- (-346.295) (-348.772) [-345.875] (-352.312) * (-345.713) (-347.030) (-348.171) [-344.745] -- 0:00:17
Average standard deviation of split frequencies: 0.010105
725500 -- (-345.171) (-347.978) [-345.273] (-346.850) * (-348.300) (-348.216) (-347.626) [-344.860] -- 0:00:17
726000 -- (-344.687) (-347.274) [-345.727] (-345.024) * (-346.764) [-351.051] (-346.475) (-347.942) -- 0:00:16
726500 -- [-347.585] (-349.293) (-345.573) (-348.390) * [-345.549] (-346.537) (-346.415) (-346.077) -- 0:00:16
727000 -- (-347.166) (-344.794) [-346.701] (-351.583) * (-350.233) [-349.247] (-347.750) (-350.276) -- 0:00:16
727500 -- (-350.804) (-344.747) (-347.338) [-347.097] * [-345.395] (-345.610) (-348.249) (-349.224) -- 0:00:16
728000 -- (-346.685) [-346.492] (-345.698) (-353.614) * (-346.218) (-347.392) [-348.336] (-347.243) -- 0:00:16
728500 -- [-347.597] (-349.300) (-346.233) (-349.762) * (-347.807) [-345.603] (-347.235) (-345.604) -- 0:00:16
729000 -- [-345.306] (-350.407) (-351.433) (-346.608) * [-350.633] (-344.892) (-348.616) (-344.705) -- 0:00:16
729500 -- [-349.461] (-344.939) (-350.268) (-345.028) * (-348.169) [-346.015] (-346.277) (-345.065) -- 0:00:16
730000 -- (-347.255) (-348.995) (-345.714) [-346.176] * (-351.631) (-349.525) (-347.259) [-345.836] -- 0:00:16
Average standard deviation of split frequencies: 0.010403
730500 -- [-350.856] (-349.027) (-345.511) (-349.537) * (-352.296) (-346.457) (-353.242) [-345.787] -- 0:00:16
731000 -- (-349.044) (-347.721) [-345.133] (-349.318) * (-349.304) [-345.374] (-349.537) (-348.917) -- 0:00:16
731500 -- (-348.207) (-347.270) (-346.044) [-347.660] * [-346.282] (-345.419) (-346.444) (-348.458) -- 0:00:16
732000 -- (-347.206) [-349.389] (-351.170) (-347.153) * (-348.371) (-345.957) (-348.995) [-346.663] -- 0:00:16
732500 -- (-345.660) (-348.186) (-348.107) [-346.152] * (-345.750) (-345.523) (-346.929) [-347.602] -- 0:00:16
733000 -- (-345.358) (-345.804) [-345.647] (-346.364) * (-348.339) (-345.328) [-346.805] (-349.495) -- 0:00:16
733500 -- [-344.690] (-349.319) (-345.734) (-345.056) * (-348.290) (-345.634) [-346.320] (-348.637) -- 0:00:16
734000 -- (-344.819) (-347.583) [-345.990] (-346.718) * (-349.105) (-347.646) (-345.878) [-349.034] -- 0:00:16
734500 -- (-345.447) [-345.055] (-345.575) (-349.623) * (-352.600) (-345.261) (-345.131) [-348.172] -- 0:00:16
735000 -- (-346.568) (-347.123) (-350.047) [-347.549] * (-347.361) [-347.459] (-344.582) (-345.934) -- 0:00:16
Average standard deviation of split frequencies: 0.010128
735500 -- (-345.131) [-346.253] (-345.241) (-345.296) * [-344.977] (-346.263) (-345.271) (-344.990) -- 0:00:16
736000 -- (-348.573) (-347.844) [-344.606] (-345.756) * [-346.449] (-346.598) (-346.177) (-350.001) -- 0:00:16
736500 -- (-344.615) (-349.231) (-349.566) [-351.603] * [-346.855] (-345.413) (-346.134) (-346.954) -- 0:00:16
737000 -- [-345.144] (-349.965) (-344.782) (-349.996) * (-345.975) [-347.949] (-346.409) (-347.937) -- 0:00:16
737500 -- (-347.441) (-348.926) [-344.881] (-345.463) * (-345.722) [-347.414] (-347.627) (-348.420) -- 0:00:16
738000 -- [-345.653] (-349.780) (-349.630) (-348.317) * (-347.538) (-350.540) (-347.874) [-345.455] -- 0:00:16
738500 -- (-350.086) [-346.910] (-345.410) (-345.002) * [-344.908] (-346.412) (-346.293) (-353.869) -- 0:00:16
739000 -- [-347.797] (-347.563) (-347.509) (-346.783) * (-347.220) [-348.026] (-348.292) (-349.672) -- 0:00:16
739500 -- (-347.436) (-345.648) [-345.584] (-349.330) * (-345.455) [-347.906] (-345.431) (-351.182) -- 0:00:16
740000 -- (-346.874) (-346.270) [-344.932] (-346.899) * [-344.641] (-347.737) (-348.719) (-350.803) -- 0:00:16
Average standard deviation of split frequencies: 0.010064
740500 -- (-349.431) (-345.109) (-345.792) [-346.772] * (-344.951) (-347.336) [-350.104] (-345.755) -- 0:00:16
741000 -- [-350.184] (-349.898) (-344.970) (-346.231) * (-345.880) (-347.459) (-352.500) [-351.206] -- 0:00:16
741500 -- (-348.476) (-345.915) [-344.966] (-351.671) * (-348.639) (-346.258) [-345.361] (-348.325) -- 0:00:16
742000 -- [-345.320] (-344.993) (-348.475) (-350.191) * (-347.369) (-346.517) (-347.818) [-347.259] -- 0:00:15
742500 -- (-347.632) [-344.656] (-345.269) (-346.555) * [-346.564] (-348.522) (-346.859) (-345.676) -- 0:00:15
743000 -- (-346.348) (-347.893) (-346.639) [-345.846] * (-352.208) (-346.117) [-347.994] (-345.887) -- 0:00:15
743500 -- (-346.350) (-346.325) (-346.272) [-348.423] * [-345.733] (-346.553) (-348.711) (-346.286) -- 0:00:15
744000 -- (-345.449) (-349.402) (-346.840) [-345.966] * (-346.497) (-347.623) [-346.442] (-347.406) -- 0:00:15
744500 -- (-345.651) (-345.809) [-346.040] (-344.719) * (-350.928) [-348.072] (-346.623) (-346.021) -- 0:00:15
745000 -- (-349.977) [-345.385] (-345.643) (-346.703) * [-350.019] (-347.782) (-351.292) (-349.838) -- 0:00:15
Average standard deviation of split frequencies: 0.010584
745500 -- [-347.571] (-344.831) (-348.160) (-348.921) * [-347.789] (-345.912) (-346.477) (-351.112) -- 0:00:15
746000 -- (-346.972) [-348.378] (-347.248) (-348.561) * (-345.066) (-349.485) [-347.422] (-351.999) -- 0:00:15
746500 -- (-348.243) [-346.696] (-346.201) (-346.164) * (-344.457) (-351.785) (-346.608) [-346.704] -- 0:00:15
747000 -- (-345.370) [-346.086] (-346.416) (-346.113) * (-347.068) [-350.496] (-346.100) (-351.837) -- 0:00:15
747500 -- (-346.749) [-345.587] (-345.817) (-348.408) * (-346.627) (-352.906) [-347.080] (-347.451) -- 0:00:15
748000 -- [-348.921] (-345.802) (-352.434) (-348.176) * (-347.660) (-351.859) (-345.973) [-346.189] -- 0:00:15
748500 -- (-348.070) [-345.902] (-345.782) (-347.335) * (-347.204) (-353.638) (-346.788) [-346.916] -- 0:00:15
749000 -- (-345.157) (-344.993) (-346.728) [-345.532] * (-349.334) (-349.749) [-347.378] (-345.747) -- 0:00:15
749500 -- (-347.115) (-348.101) [-345.335] (-346.327) * (-348.015) [-345.201] (-345.976) (-344.636) -- 0:00:15
750000 -- [-345.334] (-346.846) (-347.423) (-345.391) * (-345.964) (-345.914) [-347.647] (-346.060) -- 0:00:15
Average standard deviation of split frequencies: 0.010754
750500 -- (-349.166) (-348.361) (-348.655) [-347.932] * (-348.277) (-348.781) (-352.473) [-349.715] -- 0:00:15
751000 -- (-346.211) (-346.974) [-345.357] (-347.234) * (-350.068) [-346.978] (-348.038) (-345.742) -- 0:00:15
751500 -- (-345.036) (-348.449) (-346.124) [-346.134] * [-344.864] (-347.065) (-346.537) (-346.526) -- 0:00:15
752000 -- (-345.350) (-350.954) [-347.006] (-352.842) * (-344.461) (-345.840) (-348.037) [-347.412] -- 0:00:15
752500 -- [-347.541] (-349.035) (-351.844) (-349.623) * (-346.819) [-347.891] (-344.858) (-348.407) -- 0:00:15
753000 -- (-345.584) (-346.845) (-346.264) [-347.227] * (-349.250) (-349.187) (-351.457) [-349.053] -- 0:00:15
753500 -- (-348.366) (-348.072) (-347.219) [-348.320] * [-347.313] (-347.249) (-349.857) (-349.559) -- 0:00:15
754000 -- (-346.709) (-345.875) (-349.910) [-346.296] * (-351.818) [-346.044] (-346.360) (-346.909) -- 0:00:15
754500 -- [-345.539] (-348.722) (-346.459) (-348.470) * (-351.815) (-345.870) [-346.116] (-345.672) -- 0:00:15
755000 -- (-345.545) [-346.876] (-346.387) (-345.613) * (-349.362) (-347.061) [-348.655] (-345.183) -- 0:00:15
Average standard deviation of split frequencies: 0.010483
755500 -- (-346.382) [-347.123] (-346.400) (-347.699) * (-348.444) (-346.323) (-345.530) [-346.183] -- 0:00:15
756000 -- [-346.344] (-347.545) (-345.967) (-348.220) * (-346.969) (-345.309) [-347.606] (-346.611) -- 0:00:15
756500 -- (-345.381) [-351.694] (-344.857) (-346.618) * (-347.613) [-345.629] (-345.855) (-347.423) -- 0:00:15
757000 -- (-346.573) [-346.779] (-351.454) (-346.510) * (-349.971) (-346.349) (-347.746) [-348.484] -- 0:00:15
757500 -- (-347.511) [-344.914] (-346.699) (-347.507) * (-346.817) (-348.532) [-347.078] (-348.166) -- 0:00:15
758000 -- (-345.585) (-350.400) [-347.243] (-345.613) * [-345.719] (-350.221) (-346.277) (-346.416) -- 0:00:15
758500 -- (-347.605) [-348.189] (-346.181) (-345.055) * (-349.759) (-346.407) [-347.254] (-347.182) -- 0:00:14
759000 -- (-346.474) (-351.195) [-345.603] (-348.584) * [-350.073] (-347.875) (-346.111) (-346.943) -- 0:00:14
759500 -- (-345.598) (-345.708) (-350.023) [-344.935] * [-347.111] (-346.923) (-349.940) (-345.121) -- 0:00:14
760000 -- (-345.019) (-350.106) (-351.630) [-344.716] * (-350.389) (-346.274) [-349.024] (-344.891) -- 0:00:14
Average standard deviation of split frequencies: 0.010458
760500 -- (-348.709) (-347.397) [-347.370] (-344.673) * [-344.540] (-345.186) (-345.094) (-344.399) -- 0:00:14
761000 -- [-347.731] (-349.139) (-346.613) (-344.688) * (-345.380) [-347.119] (-347.171) (-346.260) -- 0:00:14
761500 -- (-348.078) [-348.173] (-352.117) (-345.320) * (-352.231) (-346.765) [-347.276] (-345.856) -- 0:00:14
762000 -- (-345.027) (-350.012) (-347.289) [-345.092] * (-348.786) (-347.404) [-350.080] (-348.924) -- 0:00:14
762500 -- [-345.577] (-347.881) (-346.724) (-352.259) * (-349.885) (-344.807) (-348.041) [-348.002] -- 0:00:14
763000 -- (-347.734) [-351.888] (-345.567) (-345.461) * (-348.022) [-344.678] (-345.580) (-345.136) -- 0:00:14
763500 -- (-347.456) (-348.733) [-346.390] (-349.710) * (-345.044) [-348.945] (-348.509) (-347.059) -- 0:00:14
764000 -- [-346.043] (-349.231) (-345.246) (-348.629) * (-346.196) (-347.174) (-345.884) [-344.710] -- 0:00:14
764500 -- [-344.856] (-355.015) (-348.441) (-350.225) * (-345.356) (-345.952) [-347.485] (-349.381) -- 0:00:14
765000 -- (-346.538) [-349.295] (-347.323) (-346.120) * (-346.703) [-347.672] (-349.430) (-349.606) -- 0:00:14
Average standard deviation of split frequencies: 0.010424
765500 -- (-350.537) (-353.799) (-346.141) [-347.214] * (-348.313) (-346.261) (-349.552) [-348.921] -- 0:00:14
766000 -- (-349.738) (-346.960) (-344.892) [-349.977] * [-349.288] (-346.469) (-346.507) (-346.971) -- 0:00:14
766500 -- (-346.049) (-345.109) (-347.080) [-347.931] * [-346.659] (-345.855) (-346.033) (-346.957) -- 0:00:14
767000 -- (-346.572) (-348.279) [-346.038] (-345.472) * (-348.677) [-347.446] (-345.024) (-347.240) -- 0:00:14
767500 -- (-346.950) (-346.290) (-347.805) [-346.714] * (-347.863) (-348.856) (-346.465) [-349.260] -- 0:00:14
768000 -- (-347.141) [-347.258] (-347.080) (-352.299) * (-346.932) [-347.670] (-346.787) (-347.341) -- 0:00:14
768500 -- [-344.938] (-349.099) (-348.760) (-352.937) * (-351.582) [-352.658] (-346.116) (-349.516) -- 0:00:14
769000 -- [-345.171] (-349.004) (-349.928) (-346.852) * (-350.978) [-347.648] (-346.626) (-345.498) -- 0:00:14
769500 -- (-351.947) (-348.431) (-347.113) [-345.308] * (-347.908) (-347.429) [-346.124] (-345.333) -- 0:00:14
770000 -- (-350.065) (-345.765) (-348.239) [-345.205] * (-349.065) [-347.621] (-346.701) (-346.869) -- 0:00:14
Average standard deviation of split frequencies: 0.010255
770500 -- [-348.789] (-345.920) (-345.702) (-346.862) * [-346.536] (-345.157) (-349.400) (-347.042) -- 0:00:14
771000 -- [-348.499] (-344.982) (-346.379) (-347.025) * [-346.391] (-345.454) (-352.822) (-345.794) -- 0:00:14
771500 -- (-345.749) [-347.273] (-345.249) (-347.079) * [-346.243] (-349.067) (-349.172) (-348.856) -- 0:00:14
772000 -- (-348.445) (-346.956) [-348.153] (-347.381) * (-346.695) [-344.789] (-353.543) (-347.559) -- 0:00:14
772500 -- (-346.376) (-348.215) (-345.212) [-347.212] * (-347.724) (-346.314) [-349.063] (-346.720) -- 0:00:14
773000 -- (-346.308) (-347.947) (-345.616) [-347.564] * (-349.024) (-346.020) [-344.522] (-347.321) -- 0:00:14
773500 -- (-344.730) (-349.535) (-346.124) [-346.258] * (-352.410) (-345.671) (-345.776) [-345.024] -- 0:00:14
774000 -- (-347.596) (-344.842) [-345.914] (-346.709) * (-347.439) [-345.684] (-347.028) (-347.746) -- 0:00:14
774500 -- (-345.940) (-345.467) [-345.276] (-348.090) * [-346.456] (-349.592) (-345.372) (-348.997) -- 0:00:13
775000 -- (-346.095) [-347.041] (-346.025) (-348.572) * (-346.403) (-346.245) (-346.948) [-345.302] -- 0:00:13
Average standard deviation of split frequencies: 0.010649
775500 -- (-349.339) (-346.069) (-345.042) [-346.016] * (-346.503) (-352.501) (-348.937) [-346.960] -- 0:00:13
776000 -- (-345.806) (-347.043) (-345.909) [-347.531] * [-347.405] (-348.218) (-349.865) (-345.397) -- 0:00:13
776500 -- [-345.278] (-346.992) (-349.490) (-345.459) * (-347.142) (-348.662) [-347.623] (-346.797) -- 0:00:13
777000 -- (-346.827) [-347.963] (-348.083) (-345.618) * (-347.486) (-346.147) [-345.892] (-346.143) -- 0:00:13
777500 -- (-344.871) (-346.967) [-346.476] (-345.245) * (-345.989) [-350.191] (-347.736) (-351.949) -- 0:00:13
778000 -- (-348.142) [-346.710] (-344.667) (-347.088) * (-347.672) (-347.311) [-350.052] (-351.808) -- 0:00:13
778500 -- [-346.443] (-348.356) (-346.581) (-350.761) * (-351.825) [-348.246] (-356.520) (-351.422) -- 0:00:13
779000 -- (-348.230) (-346.939) (-348.290) [-345.644] * (-349.244) (-347.043) [-346.315] (-347.458) -- 0:00:13
779500 -- (-353.634) (-345.349) (-347.033) [-348.323] * [-345.094] (-346.763) (-348.120) (-346.343) -- 0:00:13
780000 -- (-348.837) (-346.848) [-345.543] (-346.479) * (-347.300) [-347.858] (-349.356) (-349.756) -- 0:00:13
Average standard deviation of split frequencies: 0.010945
780500 -- (-351.416) [-348.748] (-345.841) (-344.503) * (-353.513) [-346.945] (-348.014) (-346.774) -- 0:00:13
781000 -- (-348.407) [-353.386] (-346.784) (-346.349) * (-352.271) (-346.892) [-347.484] (-350.338) -- 0:00:13
781500 -- (-347.721) (-348.579) (-346.471) [-347.502] * [-350.599] (-347.111) (-345.463) (-347.902) -- 0:00:13
782000 -- [-345.937] (-347.819) (-349.337) (-351.400) * (-347.174) (-347.010) [-346.526] (-350.308) -- 0:00:13
782500 -- (-348.696) [-345.324] (-349.290) (-347.337) * [-349.246] (-347.985) (-350.181) (-349.799) -- 0:00:13
783000 -- (-346.218) [-345.287] (-351.604) (-348.813) * (-347.054) (-348.018) (-351.169) [-349.741] -- 0:00:13
783500 -- [-346.932] (-346.558) (-348.553) (-345.934) * [-346.687] (-346.147) (-347.423) (-346.982) -- 0:00:13
784000 -- (-345.296) [-345.058] (-346.385) (-345.245) * (-347.734) [-347.341] (-347.153) (-348.106) -- 0:00:13
784500 -- [-347.050] (-348.524) (-349.238) (-344.797) * (-348.151) (-347.661) (-347.023) [-345.352] -- 0:00:13
785000 -- [-346.635] (-345.535) (-348.073) (-345.233) * (-347.102) (-351.327) (-345.824) [-350.027] -- 0:00:13
Average standard deviation of split frequencies: 0.010758
785500 -- [-347.323] (-347.540) (-347.039) (-346.242) * (-349.068) (-349.382) (-344.331) [-346.028] -- 0:00:13
786000 -- (-345.281) (-346.829) (-347.960) [-346.831] * [-345.200] (-352.801) (-345.276) (-344.435) -- 0:00:13
786500 -- [-344.927] (-346.230) (-346.160) (-347.139) * (-345.479) (-344.947) [-351.337] (-346.579) -- 0:00:13
787000 -- (-351.461) (-345.854) [-346.493] (-349.028) * (-346.742) (-346.726) [-352.518] (-347.337) -- 0:00:13
787500 -- [-345.562] (-345.392) (-350.775) (-345.797) * (-347.934) [-347.791] (-350.804) (-346.703) -- 0:00:13
788000 -- (-344.970) [-344.608] (-345.022) (-346.741) * [-346.695] (-345.164) (-345.617) (-346.128) -- 0:00:13
788500 -- (-346.393) (-345.059) (-349.045) [-346.787] * (-348.030) (-344.915) (-347.311) [-346.717] -- 0:00:13
789000 -- (-347.112) (-347.496) (-346.097) [-346.338] * [-346.531] (-346.698) (-348.795) (-349.202) -- 0:00:13
789500 -- (-345.432) (-346.729) (-346.541) [-345.296] * (-345.358) [-345.944] (-346.819) (-346.296) -- 0:00:13
790000 -- (-347.983) (-347.018) (-346.892) [-347.467] * (-344.777) (-345.659) [-344.794] (-349.350) -- 0:00:13
Average standard deviation of split frequencies: 0.009937
790500 -- (-345.619) [-347.326] (-344.915) (-345.021) * (-350.624) (-347.058) [-345.453] (-349.055) -- 0:00:12
791000 -- [-345.358] (-346.252) (-349.010) (-347.385) * (-346.920) (-347.206) (-344.920) [-352.380] -- 0:00:12
791500 -- (-344.641) [-346.197] (-347.450) (-345.269) * (-347.578) (-346.341) [-347.588] (-351.138) -- 0:00:12
792000 -- (-345.301) (-347.327) [-346.711] (-347.359) * [-346.107] (-347.917) (-346.686) (-345.044) -- 0:00:12
792500 -- (-345.608) (-350.126) (-347.019) [-345.528] * (-347.337) (-346.904) [-345.890] (-345.109) -- 0:00:12
793000 -- (-350.590) (-350.762) [-348.720] (-347.094) * (-347.208) (-348.068) [-345.965] (-344.567) -- 0:00:12
793500 -- [-347.119] (-353.867) (-347.223) (-349.431) * (-345.087) (-348.038) (-344.767) [-344.582] -- 0:00:12
794000 -- (-348.123) [-347.145] (-345.174) (-345.706) * (-346.488) (-349.991) (-345.799) [-347.735] -- 0:00:12
794500 -- (-348.122) (-346.069) (-347.459) [-347.308] * (-350.160) [-344.915] (-347.606) (-346.733) -- 0:00:12
795000 -- [-345.970] (-348.189) (-345.008) (-349.686) * [-347.157] (-349.249) (-349.862) (-349.777) -- 0:00:12
Average standard deviation of split frequencies: 0.010581
795500 -- (-346.420) (-345.567) [-347.405] (-347.509) * (-345.997) (-345.841) (-346.640) [-345.630] -- 0:00:12
796000 -- (-345.585) (-346.718) (-346.364) [-347.529] * (-344.597) [-344.801] (-351.440) (-345.345) -- 0:00:12
796500 -- (-346.029) (-346.808) [-345.757] (-344.949) * (-345.483) [-346.899] (-347.761) (-346.250) -- 0:00:12
797000 -- (-345.575) (-345.474) [-345.703] (-347.220) * (-345.990) [-345.362] (-348.185) (-346.384) -- 0:00:12
797500 -- (-347.836) (-345.058) [-346.295] (-347.821) * [-345.753] (-344.659) (-345.950) (-344.944) -- 0:00:12
798000 -- (-347.642) [-345.628] (-346.360) (-345.519) * (-345.622) (-346.031) [-345.793] (-345.611) -- 0:00:12
798500 -- [-347.107] (-345.310) (-354.056) (-351.268) * (-346.176) [-346.715] (-346.356) (-345.210) -- 0:00:12
799000 -- [-348.636] (-347.001) (-347.774) (-350.983) * (-345.603) (-345.982) (-345.100) [-345.639] -- 0:00:12
799500 -- (-348.341) [-348.936] (-345.012) (-346.805) * (-347.894) [-346.285] (-345.558) (-344.707) -- 0:00:12
800000 -- (-347.820) (-351.184) (-346.039) [-348.959] * (-351.423) (-347.614) (-345.216) [-344.758] -- 0:00:12
Average standard deviation of split frequencies: 0.010598
800500 -- (-346.683) (-351.220) (-345.554) [-346.430] * (-348.267) (-346.617) [-345.785] (-344.673) -- 0:00:12
801000 -- (-345.492) [-347.024] (-345.520) (-346.699) * (-347.109) (-347.653) (-346.672) [-346.342] -- 0:00:12
801500 -- (-349.092) (-345.373) [-348.085] (-351.012) * (-346.387) [-346.854] (-345.175) (-348.841) -- 0:00:12
802000 -- (-347.360) [-346.007] (-346.589) (-347.717) * (-348.469) (-345.983) (-345.750) [-347.843] -- 0:00:12
802500 -- [-347.179] (-346.877) (-347.293) (-347.780) * (-352.028) (-351.042) [-347.274] (-348.938) -- 0:00:12
803000 -- [-346.443] (-347.953) (-348.039) (-348.663) * (-344.568) (-347.494) [-346.646] (-345.558) -- 0:00:12
803500 -- (-346.905) (-345.866) (-346.558) [-345.219] * (-346.070) (-346.674) (-346.466) [-346.068] -- 0:00:12
804000 -- [-345.260] (-346.946) (-347.003) (-345.246) * (-349.558) [-344.630] (-344.922) (-346.846) -- 0:00:12
804500 -- (-346.412) [-345.475] (-346.826) (-345.283) * (-348.541) (-348.163) [-345.026] (-345.812) -- 0:00:12
805000 -- (-346.128) (-344.853) [-347.518] (-346.870) * [-345.408] (-345.334) (-345.324) (-350.929) -- 0:00:12
Average standard deviation of split frequencies: 0.010052
805500 -- [-346.457] (-350.271) (-345.991) (-347.192) * [-345.117] (-345.438) (-347.505) (-348.603) -- 0:00:12
806000 -- (-348.049) (-345.928) (-346.116) [-347.673] * (-349.563) [-345.836] (-346.177) (-349.264) -- 0:00:12
806500 -- [-345.755] (-347.196) (-346.345) (-347.815) * (-347.302) [-345.092] (-347.266) (-346.788) -- 0:00:11
807000 -- [-347.417] (-345.751) (-346.100) (-348.340) * [-345.620] (-346.467) (-349.618) (-345.672) -- 0:00:11
807500 -- (-345.896) (-346.995) [-346.676] (-344.827) * (-347.594) (-346.811) (-347.328) [-346.192] -- 0:00:11
808000 -- [-346.749] (-346.719) (-345.203) (-345.326) * (-346.316) (-348.370) (-344.849) [-345.004] -- 0:00:11
808500 -- (-347.042) (-348.242) (-345.491) [-345.267] * (-345.467) [-351.644] (-349.618) (-346.219) -- 0:00:11
809000 -- [-347.270] (-346.609) (-347.452) (-350.677) * (-348.632) [-346.067] (-346.537) (-349.267) -- 0:00:11
809500 -- (-348.947) (-346.157) (-346.073) [-352.056] * (-347.466) [-347.826] (-345.425) (-348.099) -- 0:00:11
810000 -- [-345.776] (-345.554) (-348.602) (-345.841) * (-348.407) (-347.925) (-346.058) [-349.614] -- 0:00:11
Average standard deviation of split frequencies: 0.010661
810500 -- [-345.470] (-346.861) (-348.329) (-349.194) * (-347.858) [-347.544] (-345.242) (-346.016) -- 0:00:11
811000 -- [-348.213] (-350.908) (-360.012) (-350.748) * [-347.906] (-347.638) (-344.974) (-348.461) -- 0:00:11
811500 -- (-350.299) (-348.073) (-352.678) [-347.720] * (-350.445) [-345.608] (-344.601) (-349.227) -- 0:00:11
812000 -- [-345.862] (-348.298) (-349.677) (-346.997) * (-351.625) (-349.830) [-344.390] (-347.778) -- 0:00:11
812500 -- [-345.559] (-347.984) (-346.712) (-353.325) * (-347.441) (-351.554) [-344.515] (-346.505) -- 0:00:11
813000 -- (-345.794) (-348.282) [-345.517] (-347.391) * [-346.177] (-347.204) (-345.101) (-347.158) -- 0:00:11
813500 -- (-346.157) (-348.784) [-345.931] (-347.479) * [-345.930] (-347.338) (-349.146) (-348.108) -- 0:00:11
814000 -- (-350.181) (-348.324) [-348.460] (-348.379) * (-345.823) [-347.754] (-348.096) (-345.395) -- 0:00:11
814500 -- (-345.456) (-347.230) [-348.670] (-347.954) * [-346.040] (-345.693) (-345.515) (-346.938) -- 0:00:11
815000 -- (-347.646) (-345.845) [-348.167] (-348.009) * (-345.223) (-344.879) [-346.770] (-347.986) -- 0:00:11
Average standard deviation of split frequencies: 0.010591
815500 -- (-347.625) (-345.498) (-348.878) [-345.498] * (-346.065) (-346.683) (-346.340) [-348.830] -- 0:00:11
816000 -- (-348.194) [-346.794] (-351.680) (-344.959) * (-344.932) (-348.262) (-346.367) [-345.084] -- 0:00:11
816500 -- (-348.800) [-345.759] (-346.451) (-346.087) * (-346.576) (-345.644) (-348.486) [-346.066] -- 0:00:11
817000 -- (-349.483) [-348.154] (-346.744) (-346.771) * (-352.186) (-347.326) [-345.919] (-346.949) -- 0:00:11
817500 -- [-346.468] (-347.808) (-345.795) (-347.145) * (-350.378) (-348.125) (-345.615) [-345.302] -- 0:00:11
818000 -- (-346.117) [-347.597] (-347.157) (-347.457) * (-350.607) (-348.492) (-345.971) [-345.167] -- 0:00:11
818500 -- (-349.906) (-346.909) (-347.139) [-348.279] * (-348.067) (-350.548) [-345.712] (-348.631) -- 0:00:11
819000 -- (-346.509) (-348.905) [-348.626] (-351.919) * [-346.364] (-346.625) (-349.205) (-346.927) -- 0:00:11
819500 -- (-348.037) [-345.332] (-351.809) (-345.486) * [-347.561] (-347.789) (-348.830) (-346.036) -- 0:00:11
820000 -- (-346.011) (-345.080) [-346.882] (-347.117) * [-348.458] (-349.615) (-344.881) (-348.014) -- 0:00:11
Average standard deviation of split frequencies: 0.011319
820500 -- (-347.676) (-347.592) [-344.575] (-348.954) * (-346.051) (-349.802) [-345.019] (-346.278) -- 0:00:11
821000 -- (-347.213) [-346.354] (-347.401) (-348.685) * (-347.658) (-345.212) [-345.913] (-346.209) -- 0:00:11
821500 -- (-346.237) (-346.716) (-346.919) [-347.379] * (-346.433) (-345.520) (-349.986) [-346.468] -- 0:00:11
822000 -- (-346.033) [-347.734] (-347.548) (-345.582) * (-347.741) [-345.587] (-346.417) (-345.313) -- 0:00:11
822500 -- (-347.252) [-347.511] (-347.112) (-346.905) * (-346.847) (-346.119) (-346.828) [-345.530] -- 0:00:11
823000 -- (-345.156) (-346.374) [-346.035] (-346.112) * (-352.598) (-346.020) (-348.043) [-347.543] -- 0:00:10
823500 -- (-346.361) (-347.055) (-346.158) [-345.102] * [-345.916] (-345.309) (-348.890) (-347.231) -- 0:00:10
824000 -- (-348.056) [-345.437] (-347.964) (-346.861) * (-345.582) (-345.150) (-345.662) [-347.920] -- 0:00:10
824500 -- [-345.515] (-346.442) (-348.556) (-345.285) * [-344.661] (-349.051) (-350.518) (-347.671) -- 0:00:10
825000 -- (-346.035) (-349.282) (-351.463) [-345.670] * [-345.851] (-347.389) (-353.514) (-347.331) -- 0:00:10
Average standard deviation of split frequencies: 0.011002
825500 -- (-345.703) [-347.752] (-350.536) (-346.590) * (-347.633) (-346.831) (-346.773) [-345.189] -- 0:00:10
826000 -- (-347.640) (-349.960) (-346.887) [-348.285] * (-344.505) (-345.697) (-346.696) [-345.115] -- 0:00:10
826500 -- [-345.780] (-348.874) (-347.831) (-347.871) * (-347.621) [-346.490] (-347.093) (-345.751) -- 0:00:10
827000 -- (-348.152) (-347.168) [-345.642] (-347.364) * (-347.735) (-346.765) [-346.656] (-345.209) -- 0:00:10
827500 -- (-346.485) (-346.618) (-348.034) [-346.121] * (-350.798) (-347.222) [-345.404] (-347.112) -- 0:00:10
828000 -- (-344.928) (-348.112) [-347.429] (-344.894) * (-346.164) (-345.600) [-346.013] (-359.130) -- 0:00:10
828500 -- (-346.823) (-349.358) [-345.801] (-351.435) * (-350.034) (-346.668) (-345.740) [-345.085] -- 0:00:10
829000 -- (-346.655) (-347.032) (-345.158) [-350.440] * (-348.220) (-344.595) [-344.801] (-345.329) -- 0:00:10
829500 -- [-346.202] (-346.945) (-345.141) (-349.920) * (-344.886) (-345.790) (-346.331) [-345.165] -- 0:00:10
830000 -- (-347.614) (-345.054) (-347.814) [-350.360] * (-344.700) (-345.328) (-347.177) [-346.831] -- 0:00:10
Average standard deviation of split frequencies: 0.010605
830500 -- (-346.390) (-347.235) [-346.095] (-346.482) * (-346.459) (-351.098) [-344.646] (-347.485) -- 0:00:10
831000 -- [-345.277] (-347.365) (-347.481) (-346.858) * (-350.063) [-347.130] (-347.030) (-346.151) -- 0:00:10
831500 -- (-347.246) (-346.453) [-346.427] (-346.410) * (-345.552) (-347.881) [-348.825] (-346.063) -- 0:00:10
832000 -- (-345.409) (-345.557) [-345.666] (-347.668) * (-345.731) (-347.325) (-347.311) [-347.221] -- 0:00:10
832500 -- (-348.698) (-351.950) (-347.501) [-349.580] * (-345.549) (-347.066) (-346.302) [-344.946] -- 0:00:10
833000 -- [-346.910] (-346.896) (-346.826) (-347.396) * (-345.442) (-345.367) (-346.316) [-344.639] -- 0:00:10
833500 -- (-345.977) (-346.676) [-344.635] (-348.180) * (-350.003) (-348.592) [-347.424] (-345.741) -- 0:00:10
834000 -- [-345.907] (-347.177) (-344.621) (-345.846) * [-346.039] (-350.312) (-345.146) (-346.812) -- 0:00:10
834500 -- (-346.491) (-345.074) [-346.004] (-346.658) * [-345.120] (-345.278) (-347.458) (-346.628) -- 0:00:10
835000 -- [-347.083] (-347.252) (-346.279) (-345.493) * (-350.083) (-344.853) [-347.224] (-347.841) -- 0:00:10
Average standard deviation of split frequencies: 0.011145
835500 -- (-348.428) (-349.262) (-356.204) [-347.805] * (-345.499) [-347.710] (-348.430) (-349.089) -- 0:00:10
836000 -- (-344.590) (-350.576) [-345.629] (-345.262) * (-345.352) (-348.124) (-346.775) [-349.113] -- 0:00:10
836500 -- (-346.371) [-346.033] (-345.720) (-346.805) * (-347.509) (-349.229) [-345.986] (-346.023) -- 0:00:10
837000 -- [-344.552] (-346.909) (-347.573) (-345.938) * [-346.425] (-347.371) (-345.085) (-345.976) -- 0:00:10
837500 -- (-347.707) (-346.570) (-349.442) [-348.421] * [-347.163] (-347.545) (-345.454) (-347.211) -- 0:00:10
838000 -- [-346.103] (-347.444) (-348.261) (-348.411) * (-347.495) [-345.040] (-349.489) (-347.930) -- 0:00:10
838500 -- [-346.584] (-347.708) (-345.720) (-346.988) * (-344.803) (-348.711) [-346.765] (-352.004) -- 0:00:10
839000 -- (-346.374) (-347.172) (-347.529) [-345.211] * [-344.865] (-346.605) (-352.511) (-350.194) -- 0:00:09
839500 -- (-344.488) (-347.206) (-350.666) [-345.126] * (-345.342) (-346.454) [-347.640] (-345.704) -- 0:00:09
840000 -- [-346.708] (-348.814) (-350.694) (-347.167) * (-350.310) (-347.144) (-348.797) [-344.883] -- 0:00:09
Average standard deviation of split frequencies: 0.011611
840500 -- (-345.390) (-347.750) (-348.770) [-344.665] * [-349.064] (-345.351) (-350.782) (-347.082) -- 0:00:09
841000 -- (-350.653) [-346.446] (-346.461) (-344.899) * (-350.312) (-345.680) (-345.618) [-345.598] -- 0:00:09
841500 -- [-349.940] (-351.488) (-346.437) (-346.112) * [-346.731] (-345.905) (-346.951) (-346.292) -- 0:00:09
842000 -- (-347.743) (-350.135) [-348.087] (-346.580) * (-347.460) (-347.563) (-346.760) [-344.420] -- 0:00:09
842500 -- (-345.265) (-349.826) [-346.599] (-347.027) * (-345.966) (-345.419) (-350.910) [-346.981] -- 0:00:09
843000 -- (-346.660) (-347.992) [-345.159] (-346.885) * (-345.351) (-344.720) (-345.504) [-345.784] -- 0:00:09
843500 -- (-349.115) (-350.500) [-346.749] (-348.238) * (-345.311) (-345.892) [-345.760] (-345.885) -- 0:00:09
844000 -- (-347.806) [-345.842] (-349.523) (-346.592) * (-350.849) (-344.939) [-345.347] (-352.694) -- 0:00:09
844500 -- [-345.558] (-346.814) (-348.983) (-346.715) * (-344.757) (-346.994) (-345.404) [-346.532] -- 0:00:09
845000 -- (-345.217) (-346.919) (-347.572) [-348.547] * (-351.806) [-345.063] (-345.225) (-344.985) -- 0:00:09
Average standard deviation of split frequencies: 0.011341
845500 -- [-345.462] (-345.314) (-345.273) (-346.515) * [-346.472] (-347.846) (-348.662) (-346.838) -- 0:00:09
846000 -- (-348.111) [-347.113] (-349.110) (-346.500) * (-348.004) (-346.566) [-346.780] (-346.889) -- 0:00:09
846500 -- (-347.309) (-352.367) [-345.447] (-345.334) * [-346.192] (-345.267) (-350.679) (-346.211) -- 0:00:09
847000 -- [-346.692] (-345.689) (-346.699) (-347.414) * (-345.518) (-348.379) (-349.247) [-347.830] -- 0:00:09
847500 -- (-351.943) (-347.621) (-344.839) [-346.450] * (-347.326) [-348.347] (-347.394) (-345.540) -- 0:00:09
848000 -- (-350.566) [-346.457] (-347.224) (-348.281) * (-347.253) (-349.015) [-346.486] (-349.855) -- 0:00:09
848500 -- (-347.423) (-347.998) (-346.452) [-346.613] * [-345.244] (-349.219) (-344.639) (-348.529) -- 0:00:09
849000 -- (-347.639) [-349.911] (-345.032) (-346.988) * (-345.007) (-345.088) [-347.918] (-344.986) -- 0:00:09
849500 -- (-345.533) (-347.601) [-347.390] (-348.720) * (-345.385) (-345.409) (-346.532) [-346.177] -- 0:00:09
850000 -- (-345.716) (-346.114) (-350.680) [-347.052] * (-346.158) [-344.848] (-346.029) (-349.278) -- 0:00:09
Average standard deviation of split frequencies: 0.011572
850500 -- (-345.686) [-346.398] (-346.241) (-350.950) * (-345.962) [-346.492] (-345.391) (-345.036) -- 0:00:09
851000 -- [-348.154] (-352.733) (-345.864) (-345.459) * (-344.969) (-346.409) (-345.626) [-344.839] -- 0:00:09
851500 -- (-346.814) (-347.310) (-345.306) [-347.697] * (-347.956) (-349.085) (-346.592) [-349.024] -- 0:00:09
852000 -- [-346.982] (-345.266) (-349.141) (-346.671) * (-346.005) (-345.157) (-344.711) [-351.496] -- 0:00:09
852500 -- (-345.480) (-345.684) [-349.172] (-347.264) * (-346.616) [-346.738] (-345.704) (-348.641) -- 0:00:09
853000 -- [-349.290] (-348.436) (-350.224) (-346.727) * (-346.140) (-346.731) [-346.715] (-348.021) -- 0:00:09
853500 -- [-347.141] (-348.100) (-349.483) (-345.875) * (-347.533) [-345.556] (-348.276) (-347.232) -- 0:00:09
854000 -- (-348.477) (-346.321) (-347.041) [-348.377] * (-349.499) [-348.529] (-347.579) (-347.850) -- 0:00:09
854500 -- (-345.942) (-348.640) [-347.443] (-347.928) * (-345.720) [-347.150] (-348.926) (-347.611) -- 0:00:09
855000 -- (-345.568) (-345.141) [-346.080] (-354.848) * (-346.600) (-347.838) (-348.425) [-346.929] -- 0:00:08
Average standard deviation of split frequencies: 0.011338
855500 -- (-346.283) (-346.829) [-345.599] (-349.734) * [-344.873] (-347.125) (-345.217) (-345.781) -- 0:00:08
856000 -- [-349.351] (-345.823) (-350.394) (-348.208) * (-350.181) (-347.072) [-345.209] (-346.990) -- 0:00:08
856500 -- (-347.308) [-347.236] (-347.524) (-345.216) * (-345.510) (-345.876) (-348.726) [-348.390] -- 0:00:08
857000 -- (-348.269) (-345.299) [-346.895] (-349.932) * (-352.361) (-345.202) (-349.215) [-345.778] -- 0:00:08
857500 -- (-348.213) (-349.270) (-346.350) [-347.387] * (-346.888) [-345.633] (-345.648) (-347.818) -- 0:00:08
858000 -- (-345.942) (-347.942) (-344.507) [-346.313] * (-346.277) (-347.070) (-345.316) [-344.702] -- 0:00:08
858500 -- (-347.951) (-346.649) (-345.377) [-345.916] * (-348.281) [-345.641] (-345.651) (-346.485) -- 0:00:08
859000 -- (-349.338) [-344.898] (-346.229) (-347.840) * (-348.727) [-345.184] (-350.387) (-344.692) -- 0:00:08
859500 -- (-345.133) (-346.978) (-348.489) [-346.486] * (-350.764) [-347.749] (-350.423) (-346.850) -- 0:00:08
860000 -- (-347.771) (-346.873) [-345.894] (-352.176) * (-345.385) (-351.813) [-348.104] (-347.893) -- 0:00:08
Average standard deviation of split frequencies: 0.011470
860500 -- (-345.812) (-344.408) (-346.984) [-347.031] * (-345.729) (-347.007) [-347.296] (-346.553) -- 0:00:08
861000 -- (-347.715) (-346.684) [-346.442] (-351.110) * (-346.821) [-347.877] (-350.152) (-348.961) -- 0:00:08
861500 -- [-347.607] (-346.434) (-351.371) (-346.919) * (-349.261) (-348.892) [-346.510] (-353.563) -- 0:00:08
862000 -- [-345.669] (-350.545) (-346.223) (-348.031) * (-345.358) (-347.125) [-347.006] (-345.333) -- 0:00:08
862500 -- (-345.485) (-346.096) (-350.614) [-345.588] * (-352.225) (-348.299) [-344.826] (-344.750) -- 0:00:08
863000 -- (-345.868) (-346.673) [-350.181] (-346.778) * (-347.516) (-347.160) (-347.097) [-345.249] -- 0:00:08
863500 -- (-346.059) [-344.825] (-346.299) (-346.724) * (-348.829) (-349.003) [-344.873] (-346.188) -- 0:00:08
864000 -- (-347.109) [-345.048] (-345.530) (-348.941) * (-348.120) [-346.258] (-349.441) (-347.356) -- 0:00:08
864500 -- (-345.524) (-350.216) [-348.431] (-349.185) * [-347.820] (-346.485) (-347.378) (-344.882) -- 0:00:08
865000 -- (-348.471) (-347.164) [-344.527] (-349.214) * (-347.866) (-347.064) [-348.200] (-345.789) -- 0:00:08
Average standard deviation of split frequencies: 0.010887
865500 -- (-345.630) (-349.234) [-346.440] (-345.956) * [-344.652] (-345.466) (-345.831) (-345.875) -- 0:00:08
866000 -- (-345.192) [-348.545] (-347.628) (-346.719) * (-349.566) [-344.843] (-348.081) (-344.588) -- 0:00:08
866500 -- (-344.503) [-345.607] (-346.366) (-348.260) * (-348.657) (-347.354) [-345.835] (-345.372) -- 0:00:08
867000 -- (-346.346) (-347.901) (-345.338) [-347.190] * (-347.099) (-347.007) (-348.090) [-344.989] -- 0:00:08
867500 -- (-345.432) (-348.721) [-344.953] (-346.300) * (-348.149) (-348.097) (-345.460) [-346.620] -- 0:00:08
868000 -- (-346.876) [-348.376] (-346.448) (-349.811) * (-348.804) (-348.530) [-345.914] (-347.071) -- 0:00:08
868500 -- (-346.514) (-346.252) [-346.373] (-346.080) * (-347.279) (-346.933) (-346.955) [-347.051] -- 0:00:08
869000 -- (-345.461) (-347.186) (-349.203) [-345.999] * (-344.904) (-347.334) [-345.740] (-348.535) -- 0:00:08
869500 -- [-345.563] (-345.444) (-345.075) (-348.234) * [-345.523] (-345.971) (-347.148) (-346.522) -- 0:00:08
870000 -- (-346.531) (-346.634) [-348.626] (-345.298) * (-345.200) (-346.806) (-348.669) [-346.472] -- 0:00:08
Average standard deviation of split frequencies: 0.010860
870500 -- (-345.823) (-346.630) [-348.749] (-346.687) * (-348.560) (-345.669) [-350.934] (-350.913) -- 0:00:08
871000 -- [-350.075] (-345.842) (-348.940) (-350.042) * (-353.671) [-345.896] (-344.989) (-345.975) -- 0:00:07
871500 -- (-345.153) [-345.511] (-345.929) (-344.784) * (-346.033) (-345.112) [-345.262] (-347.435) -- 0:00:07
872000 -- [-345.727] (-345.123) (-345.441) (-345.408) * (-346.806) [-344.586] (-347.464) (-353.353) -- 0:00:07
872500 -- (-345.526) (-345.297) (-345.622) [-345.241] * (-344.596) (-345.437) (-346.114) [-348.050] -- 0:00:07
873000 -- (-352.186) [-346.820] (-352.161) (-347.685) * (-347.711) (-346.177) (-346.094) [-346.107] -- 0:00:07
873500 -- (-353.907) (-345.160) (-345.798) [-348.368] * [-346.629] (-344.862) (-351.760) (-345.996) -- 0:00:07
874000 -- (-346.282) (-349.482) (-347.253) [-347.427] * (-347.638) (-345.734) [-345.134] (-347.867) -- 0:00:07
874500 -- (-349.289) (-348.762) (-347.434) [-346.715] * (-345.515) (-348.953) [-350.121] (-344.769) -- 0:00:07
875000 -- (-349.115) (-346.774) [-346.065] (-346.537) * [-346.033] (-346.127) (-346.144) (-344.746) -- 0:00:07
Average standard deviation of split frequencies: 0.010699
875500 -- [-347.223] (-346.224) (-347.359) (-347.561) * (-348.116) (-347.066) [-346.678] (-347.484) -- 0:00:07
876000 -- (-347.182) [-348.729] (-346.547) (-345.106) * (-345.475) (-347.531) (-348.354) [-347.970] -- 0:00:07
876500 -- (-345.725) (-346.977) (-347.864) [-346.148] * (-344.684) (-347.873) [-346.201] (-345.082) -- 0:00:07
877000 -- (-345.612) (-349.822) (-346.024) [-347.332] * (-347.469) [-347.710] (-347.533) (-348.164) -- 0:00:07
877500 -- (-346.049) [-351.008] (-346.740) (-347.434) * (-347.548) (-345.078) (-347.050) [-348.108] -- 0:00:07
878000 -- (-346.857) [-348.927] (-345.867) (-348.345) * (-345.929) [-345.142] (-345.561) (-347.122) -- 0:00:07
878500 -- (-346.614) (-349.750) (-346.931) [-346.037] * (-345.534) (-347.200) [-346.599] (-348.256) -- 0:00:07
879000 -- (-345.015) (-348.952) (-349.108) [-345.719] * [-344.813] (-346.632) (-346.659) (-347.863) -- 0:00:07
879500 -- [-345.853] (-345.917) (-346.214) (-344.904) * [-347.638] (-347.270) (-346.236) (-345.555) -- 0:00:07
880000 -- (-346.106) [-346.864] (-346.881) (-345.676) * (-346.257) [-347.235] (-347.743) (-348.890) -- 0:00:07
Average standard deviation of split frequencies: 0.010611
880500 -- (-346.119) [-348.999] (-346.135) (-345.730) * (-347.006) (-346.260) (-345.628) [-345.119] -- 0:00:07
881000 -- (-344.828) (-347.834) (-349.233) [-347.325] * (-346.807) (-346.013) (-345.257) [-345.532] -- 0:00:07
881500 -- (-346.832) (-346.473) (-348.412) [-344.578] * [-348.524] (-346.694) (-345.336) (-344.817) -- 0:00:07
882000 -- (-347.543) (-347.047) (-346.396) [-344.392] * (-350.215) [-348.096] (-347.508) (-345.589) -- 0:00:07
882500 -- (-345.672) (-344.848) (-351.042) [-345.756] * (-345.935) (-345.777) [-348.443] (-347.461) -- 0:00:07
883000 -- (-348.655) [-346.843] (-347.533) (-347.160) * (-348.103) (-345.019) (-348.508) [-352.289] -- 0:00:07
883500 -- (-346.632) [-351.861] (-346.151) (-345.320) * [-346.120] (-346.487) (-345.051) (-351.372) -- 0:00:07
884000 -- (-349.582) (-348.845) (-346.171) [-346.627] * [-349.278] (-348.424) (-349.025) (-345.619) -- 0:00:07
884500 -- [-345.453] (-350.853) (-346.308) (-347.207) * (-353.069) (-346.366) (-346.064) [-346.044] -- 0:00:07
885000 -- (-345.358) [-345.776] (-347.364) (-346.608) * (-346.785) (-345.576) [-345.201] (-345.661) -- 0:00:07
Average standard deviation of split frequencies: 0.010516
885500 -- [-346.507] (-346.992) (-346.509) (-348.228) * (-350.936) (-347.555) (-347.105) [-345.387] -- 0:00:06
886000 -- (-347.752) (-348.899) (-346.925) [-347.700] * (-346.965) (-345.822) [-348.112] (-351.901) -- 0:00:07
886500 -- [-347.355] (-346.639) (-347.636) (-349.747) * (-346.517) (-348.825) (-350.537) [-347.146] -- 0:00:07
887000 -- (-344.910) (-348.634) [-349.367] (-348.120) * (-347.378) (-350.712) (-346.824) [-348.321] -- 0:00:07
887500 -- (-347.861) (-349.956) (-348.834) [-344.982] * [-348.402] (-347.772) (-345.202) (-350.068) -- 0:00:06
888000 -- [-347.564] (-353.965) (-347.731) (-346.785) * [-346.151] (-345.286) (-346.149) (-349.622) -- 0:00:06
888500 -- (-348.437) (-348.460) [-345.872] (-346.445) * [-348.442] (-346.324) (-352.917) (-347.627) -- 0:00:06
889000 -- (-347.905) (-345.434) [-345.040] (-349.758) * (-345.134) (-345.733) (-346.625) [-346.756] -- 0:00:06
889500 -- (-348.955) (-345.435) (-345.881) [-348.639] * (-347.190) (-347.050) (-347.192) [-347.119] -- 0:00:06
890000 -- (-347.416) (-347.473) (-349.564) [-345.849] * (-346.234) [-345.740] (-349.229) (-348.587) -- 0:00:06
Average standard deviation of split frequencies: 0.010461
890500 -- (-346.159) (-349.167) (-349.108) [-348.419] * (-345.853) (-346.149) (-348.772) [-349.393] -- 0:00:06
891000 -- (-350.549) (-348.491) (-346.946) [-348.174] * (-349.943) [-344.901] (-348.737) (-346.371) -- 0:00:06
891500 -- (-347.782) (-348.140) [-348.232] (-345.600) * (-345.546) (-345.977) (-347.613) [-351.271] -- 0:00:06
892000 -- (-349.589) (-346.921) (-349.094) [-347.526] * (-347.553) [-345.951] (-353.978) (-347.757) -- 0:00:06
892500 -- (-347.932) (-346.402) (-347.255) [-346.064] * (-346.160) (-344.941) (-349.001) [-347.821] -- 0:00:06
893000 -- (-346.883) (-346.370) [-345.631] (-345.745) * (-350.320) (-347.469) [-345.306] (-346.857) -- 0:00:06
893500 -- [-347.171] (-345.846) (-347.100) (-345.428) * [-350.388] (-347.655) (-349.438) (-344.551) -- 0:00:06
894000 -- (-351.878) (-347.980) (-349.456) [-345.339] * (-346.150) [-350.135] (-349.659) (-349.265) -- 0:00:06
894500 -- (-347.724) [-347.013] (-345.131) (-346.568) * [-348.511] (-351.680) (-348.752) (-349.407) -- 0:00:06
895000 -- (-350.245) (-351.730) (-346.152) [-344.446] * (-348.464) (-346.280) (-346.167) [-348.606] -- 0:00:06
Average standard deviation of split frequencies: 0.010584
895500 -- (-347.326) [-344.941] (-346.062) (-345.136) * (-346.177) [-348.470] (-347.775) (-350.701) -- 0:00:06
896000 -- (-344.683) (-346.171) (-348.068) [-345.726] * (-348.264) (-345.842) (-346.262) [-346.600] -- 0:00:06
896500 -- (-347.702) [-345.744] (-347.202) (-351.155) * (-346.458) (-344.860) (-347.749) [-345.680] -- 0:00:06
897000 -- (-348.462) [-346.065] (-347.800) (-346.808) * [-345.918] (-349.867) (-346.865) (-345.480) -- 0:00:06
897500 -- (-348.461) (-350.210) (-348.852) [-349.762] * [-348.226] (-347.036) (-348.457) (-345.408) -- 0:00:06
898000 -- (-345.232) [-346.275] (-347.791) (-348.493) * (-346.940) (-346.799) [-347.223] (-348.839) -- 0:00:06
898500 -- (-346.249) (-347.303) (-349.634) [-346.833] * (-352.394) (-347.423) (-346.342) [-347.501] -- 0:00:06
899000 -- [-344.450] (-345.289) (-354.477) (-345.552) * (-348.621) (-347.391) [-346.360] (-346.337) -- 0:00:06
899500 -- (-344.697) (-348.510) [-346.591] (-346.322) * (-347.151) (-350.035) (-348.392) [-346.966] -- 0:00:06
900000 -- (-350.173) (-348.029) (-348.725) [-346.936] * (-347.541) (-345.701) (-351.365) [-344.899] -- 0:00:06
Average standard deviation of split frequencies: 0.010653
900500 -- (-345.510) [-346.615] (-348.527) (-347.951) * (-351.943) (-345.962) [-347.938] (-345.074) -- 0:00:06
901000 -- [-347.288] (-346.762) (-345.024) (-347.704) * [-350.849] (-345.948) (-348.231) (-346.563) -- 0:00:06
901500 -- [-347.165] (-349.070) (-346.126) (-347.870) * (-350.850) (-347.208) [-346.582] (-347.999) -- 0:00:06
902000 -- (-347.447) (-348.948) (-346.778) [-344.744] * (-346.722) [-346.773] (-345.889) (-346.637) -- 0:00:05
902500 -- (-346.915) (-347.199) [-350.456] (-345.686) * (-345.670) [-345.212] (-346.098) (-347.032) -- 0:00:05
903000 -- (-348.397) (-345.077) (-351.419) [-345.392] * [-347.127] (-347.817) (-349.379) (-348.276) -- 0:00:06
903500 -- (-347.737) (-345.574) [-348.801] (-346.946) * (-348.353) [-347.263] (-345.146) (-345.506) -- 0:00:05
904000 -- (-344.975) [-347.090] (-344.860) (-344.446) * [-347.463] (-345.253) (-350.925) (-345.680) -- 0:00:05
904500 -- (-345.251) (-345.943) [-346.481] (-347.100) * (-345.210) (-346.001) (-352.384) [-346.318] -- 0:00:05
905000 -- [-346.455] (-347.997) (-345.384) (-347.606) * [-352.931] (-346.004) (-346.647) (-345.684) -- 0:00:05
Average standard deviation of split frequencies: 0.010493
905500 -- (-348.347) [-346.691] (-345.964) (-345.175) * (-346.615) [-349.724] (-345.753) (-345.518) -- 0:00:05
906000 -- (-347.100) (-344.474) [-345.950] (-349.739) * (-350.535) (-350.504) [-344.887] (-345.975) -- 0:00:05
906500 -- [-346.617] (-346.622) (-345.824) (-348.903) * (-350.820) (-347.698) [-344.389] (-352.202) -- 0:00:05
907000 -- [-344.971] (-345.707) (-349.016) (-347.699) * (-349.609) (-349.585) (-345.616) [-350.119] -- 0:00:05
907500 -- (-347.579) (-344.790) [-346.244] (-347.372) * (-348.274) (-346.981) (-347.820) [-346.626] -- 0:00:05
908000 -- (-349.463) (-345.964) [-348.874] (-350.104) * (-349.536) (-346.557) [-345.085] (-347.505) -- 0:00:05
908500 -- (-348.985) (-348.778) [-347.079] (-344.973) * (-345.841) [-347.733] (-346.695) (-348.977) -- 0:00:05
909000 -- [-346.198] (-346.448) (-349.309) (-345.108) * (-351.376) (-350.438) (-347.080) [-345.358] -- 0:00:05
909500 -- (-349.488) [-345.828] (-345.272) (-348.979) * (-347.173) [-345.053] (-345.741) (-344.548) -- 0:00:05
910000 -- (-347.936) [-348.143] (-347.816) (-346.997) * (-347.161) (-346.906) [-346.515] (-345.262) -- 0:00:05
Average standard deviation of split frequencies: 0.010583
910500 -- [-350.162] (-346.043) (-344.982) (-347.353) * (-347.056) (-348.350) [-348.239] (-345.049) -- 0:00:05
911000 -- (-349.098) (-346.856) (-348.018) [-348.787] * (-346.822) (-346.174) (-345.722) [-346.150] -- 0:00:05
911500 -- (-350.091) (-346.577) [-345.836] (-345.068) * (-347.242) (-347.961) [-344.752] (-346.857) -- 0:00:05
912000 -- (-346.961) (-347.238) [-349.277] (-344.817) * [-344.719] (-345.949) (-350.238) (-345.427) -- 0:00:05
912500 -- (-347.995) (-344.864) (-349.161) [-346.673] * (-345.435) (-346.219) (-345.419) [-348.024] -- 0:00:05
913000 -- (-346.071) (-345.141) (-345.817) [-346.121] * (-347.744) [-345.789] (-346.010) (-349.111) -- 0:00:05
913500 -- (-350.391) [-345.179] (-344.821) (-345.013) * (-346.700) [-345.451] (-346.464) (-344.553) -- 0:00:05
914000 -- (-346.616) (-347.135) [-347.146] (-346.021) * [-349.995] (-345.086) (-345.025) (-345.051) -- 0:00:05
914500 -- (-346.081) [-345.017] (-347.578) (-345.359) * (-346.584) (-345.127) [-346.195] (-348.228) -- 0:00:05
915000 -- (-347.569) (-345.043) (-350.081) [-345.114] * [-346.535] (-348.132) (-346.503) (-346.348) -- 0:00:05
Average standard deviation of split frequencies: 0.009978
915500 -- (-348.516) (-346.567) (-350.879) [-346.602] * (-347.642) (-347.114) (-345.875) [-347.482] -- 0:00:05
916000 -- (-348.854) (-351.730) [-349.274] (-347.383) * (-345.544) [-348.922] (-346.262) (-345.768) -- 0:00:05
916500 -- (-351.950) (-349.434) (-347.626) [-349.460] * (-348.643) (-348.067) (-345.769) [-344.990] -- 0:00:05
917000 -- [-346.496] (-346.527) (-346.705) (-346.952) * (-347.058) [-345.392] (-346.999) (-344.564) -- 0:00:05
917500 -- [-345.424] (-345.666) (-346.765) (-347.420) * [-345.319] (-344.626) (-344.760) (-347.457) -- 0:00:05
918000 -- (-345.584) (-344.691) [-347.797] (-347.238) * (-347.271) (-346.804) (-346.093) [-347.669] -- 0:00:05
918500 -- (-345.599) (-349.576) [-347.315] (-345.682) * [-346.313] (-349.958) (-346.020) (-346.612) -- 0:00:04
919000 -- [-345.527] (-349.467) (-346.093) (-349.087) * (-348.929) [-345.839] (-346.178) (-345.910) -- 0:00:04
919500 -- [-346.600] (-345.589) (-347.544) (-344.325) * (-344.890) (-346.521) [-344.935] (-348.403) -- 0:00:04
920000 -- (-348.424) [-346.237] (-345.602) (-349.241) * (-347.039) [-345.100] (-349.214) (-345.360) -- 0:00:04
Average standard deviation of split frequencies: 0.009728
920500 -- [-349.094] (-349.110) (-345.238) (-345.766) * (-348.501) (-344.709) (-347.750) [-348.129] -- 0:00:04
921000 -- (-346.422) (-345.633) (-347.498) [-346.090] * [-349.220] (-347.435) (-350.525) (-355.411) -- 0:00:04
921500 -- (-347.211) [-346.496] (-348.485) (-347.756) * [-347.050] (-348.775) (-344.525) (-349.603) -- 0:00:04
922000 -- (-347.918) (-350.484) [-349.024] (-349.916) * (-344.879) [-346.388] (-345.118) (-347.251) -- 0:00:04
922500 -- (-347.190) (-346.252) (-345.075) [-351.272] * (-345.817) [-345.543] (-345.754) (-347.093) -- 0:00:04
923000 -- [-344.744] (-348.297) (-346.739) (-344.699) * (-344.905) (-351.128) [-350.033] (-347.205) -- 0:00:04
923500 -- (-347.038) [-347.338] (-347.338) (-346.008) * (-345.931) [-351.170] (-351.973) (-352.833) -- 0:00:04
924000 -- [-347.198] (-346.967) (-346.133) (-346.922) * (-345.393) [-347.019] (-347.560) (-348.155) -- 0:00:04
924500 -- (-347.518) (-348.547) (-344.619) [-345.876] * (-347.635) (-349.413) [-350.069] (-347.805) -- 0:00:04
925000 -- (-345.782) (-347.353) (-345.870) [-347.009] * [-345.318] (-351.047) (-347.894) (-344.813) -- 0:00:04
Average standard deviation of split frequencies: 0.009702
925500 -- (-349.670) (-350.754) (-350.221) [-350.842] * [-346.439] (-349.309) (-346.063) (-348.569) -- 0:00:04
926000 -- (-348.075) [-345.879] (-344.411) (-348.608) * (-345.617) (-345.542) [-347.676] (-351.530) -- 0:00:04
926500 -- (-347.520) (-349.506) [-344.790] (-349.654) * (-352.489) [-344.834] (-350.242) (-354.890) -- 0:00:04
927000 -- (-348.130) (-350.137) (-346.382) [-348.680] * (-345.233) (-346.314) (-345.774) [-346.783] -- 0:00:04
927500 -- (-348.831) [-346.073] (-346.213) (-350.545) * (-344.969) [-345.163] (-345.757) (-344.970) -- 0:00:04
928000 -- (-347.481) (-351.386) (-346.129) [-348.746] * [-345.825] (-347.288) (-344.755) (-349.208) -- 0:00:04
928500 -- [-345.580] (-356.361) (-346.682) (-347.708) * (-345.637) [-346.687] (-347.579) (-347.573) -- 0:00:04
929000 -- (-346.776) (-350.880) [-346.952] (-348.774) * (-345.619) [-345.506] (-346.491) (-347.215) -- 0:00:04
929500 -- (-351.433) [-345.040] (-347.562) (-347.808) * [-344.410] (-347.098) (-345.580) (-349.008) -- 0:00:04
930000 -- (-347.829) (-346.291) (-347.263) [-345.380] * (-346.652) (-350.870) (-352.037) [-346.526] -- 0:00:04
Average standard deviation of split frequencies: 0.009952
930500 -- (-345.071) (-346.817) (-348.697) [-345.704] * [-345.295] (-345.953) (-346.350) (-347.106) -- 0:00:04
931000 -- (-345.337) (-346.232) [-345.822] (-347.806) * (-345.298) [-348.427] (-346.688) (-344.673) -- 0:00:04
931500 -- (-345.077) (-349.600) [-346.922] (-347.515) * [-347.254] (-348.074) (-345.581) (-349.007) -- 0:00:04
932000 -- (-345.239) [-347.788] (-346.619) (-345.082) * [-346.432] (-348.322) (-348.204) (-345.940) -- 0:00:04
932500 -- (-345.052) [-347.267] (-346.353) (-346.629) * (-348.830) (-344.618) [-346.786] (-344.698) -- 0:00:04
933000 -- (-345.271) (-352.530) (-348.396) [-345.385] * (-349.153) (-344.685) [-345.229] (-345.019) -- 0:00:04
933500 -- (-347.485) (-351.482) [-346.934] (-347.704) * (-345.258) (-346.471) [-345.920] (-346.307) -- 0:00:04
934000 -- (-345.236) (-351.929) (-344.824) [-349.414] * [-347.516] (-346.567) (-347.156) (-345.457) -- 0:00:04
934500 -- [-346.744] (-347.628) (-344.802) (-345.295) * (-347.888) (-345.796) (-350.777) [-346.652] -- 0:00:03
935000 -- [-345.462] (-349.489) (-345.602) (-347.225) * (-348.746) (-346.639) (-345.275) [-345.901] -- 0:00:03
Average standard deviation of split frequencies: 0.009717
935500 -- (-351.954) (-346.166) [-346.374] (-345.923) * (-346.677) (-344.727) [-347.648] (-348.584) -- 0:00:03
936000 -- [-346.350] (-346.774) (-345.584) (-344.913) * (-348.185) [-346.014] (-345.606) (-344.391) -- 0:00:03
936500 -- (-353.712) (-344.889) (-345.369) [-344.845] * [-345.497] (-346.162) (-353.244) (-345.668) -- 0:00:03
937000 -- (-346.188) [-349.153] (-346.895) (-344.999) * (-345.701) (-346.635) (-348.100) [-344.642] -- 0:00:03
937500 -- (-345.328) [-351.929] (-347.025) (-347.326) * [-345.170] (-348.019) (-348.173) (-344.957) -- 0:00:03
938000 -- (-349.892) (-349.384) [-345.377] (-346.363) * (-346.375) (-349.522) (-345.537) [-346.846] -- 0:00:03
938500 -- (-350.471) (-346.485) (-345.782) [-346.345] * (-345.426) (-348.270) [-346.738] (-346.228) -- 0:00:03
939000 -- [-349.126] (-345.881) (-348.773) (-347.944) * (-345.772) [-347.352] (-348.351) (-345.192) -- 0:00:03
939500 -- (-354.604) [-347.146] (-346.162) (-350.275) * (-346.552) (-346.330) [-345.452] (-345.092) -- 0:00:03
940000 -- (-346.811) (-346.383) [-346.068] (-345.731) * (-348.263) (-349.439) [-347.482] (-348.455) -- 0:00:03
Average standard deviation of split frequencies: 0.009835
940500 -- (-346.751) [-344.986] (-346.227) (-348.337) * [-346.293] (-351.632) (-347.087) (-346.039) -- 0:00:03
941000 -- (-345.272) (-347.890) (-345.884) [-346.776] * (-348.446) [-347.129] (-346.390) (-345.637) -- 0:00:03
941500 -- (-345.544) (-345.999) [-345.434] (-344.791) * (-350.665) [-346.212] (-346.994) (-347.877) -- 0:00:03
942000 -- (-346.098) [-349.264] (-346.541) (-351.739) * [-347.401] (-344.628) (-346.325) (-347.985) -- 0:00:03
942500 -- (-344.809) [-347.962] (-346.472) (-349.663) * (-347.226) [-345.324] (-346.136) (-346.553) -- 0:00:03
943000 -- (-345.586) (-350.507) (-346.800) [-348.535] * (-345.538) (-346.903) [-352.315] (-345.068) -- 0:00:03
943500 -- (-345.714) [-346.969] (-348.187) (-348.929) * (-345.700) (-345.394) [-346.177] (-346.572) -- 0:00:03
944000 -- (-353.493) (-346.541) [-349.607] (-347.119) * (-345.874) [-345.418] (-346.079) (-346.802) -- 0:00:03
944500 -- (-349.452) (-347.344) [-345.526] (-349.179) * (-347.235) (-346.208) [-345.587] (-345.840) -- 0:00:03
945000 -- [-345.197] (-348.306) (-346.525) (-347.809) * (-347.925) (-347.681) (-348.887) [-347.167] -- 0:00:03
Average standard deviation of split frequencies: 0.010054
945500 -- [-344.628] (-347.295) (-349.776) (-348.571) * [-345.824] (-346.664) (-346.373) (-346.266) -- 0:00:03
946000 -- [-345.159] (-346.418) (-351.392) (-348.591) * (-345.797) (-346.534) [-348.053] (-352.992) -- 0:00:03
946500 -- (-344.839) [-345.378] (-348.638) (-346.397) * [-344.774] (-344.848) (-348.716) (-350.342) -- 0:00:03
947000 -- (-344.839) (-347.591) (-345.587) [-348.416] * (-347.987) (-345.718) (-346.926) [-346.815] -- 0:00:03
947500 -- (-345.807) (-353.128) (-345.542) [-347.924] * [-345.812] (-346.339) (-345.140) (-346.632) -- 0:00:03
948000 -- (-350.007) (-349.030) [-349.054] (-348.553) * [-346.660] (-345.733) (-347.414) (-346.963) -- 0:00:03
948500 -- (-346.700) (-345.505) [-349.367] (-348.742) * [-349.053] (-344.644) (-347.368) (-347.496) -- 0:00:03
949000 -- (-345.192) (-346.195) [-345.654] (-346.592) * [-346.397] (-347.021) (-345.316) (-347.501) -- 0:00:03
949500 -- (-348.091) (-348.256) [-345.353] (-344.974) * [-345.161] (-345.411) (-345.653) (-347.204) -- 0:00:03
950000 -- (-346.906) (-345.150) [-348.833] (-345.185) * (-345.606) [-345.625] (-347.051) (-344.832) -- 0:00:03
Average standard deviation of split frequencies: 0.009719
950500 -- (-345.515) (-351.273) (-346.315) [-347.941] * [-348.450] (-346.688) (-345.094) (-347.617) -- 0:00:03
951000 -- (-345.861) (-348.483) [-346.327] (-346.214) * [-346.019] (-347.344) (-344.843) (-346.313) -- 0:00:02
951500 -- [-346.016] (-346.558) (-352.597) (-347.407) * (-345.043) [-347.373] (-346.409) (-346.438) -- 0:00:02
952000 -- [-345.154] (-347.130) (-346.789) (-345.072) * (-344.804) [-347.371] (-347.150) (-345.158) -- 0:00:02
952500 -- (-348.709) (-349.220) [-345.539] (-345.527) * (-345.301) (-348.763) (-345.388) [-346.690] -- 0:00:02
953000 -- (-348.894) (-346.634) [-345.642] (-345.226) * (-345.180) (-346.424) [-344.765] (-345.807) -- 0:00:02
953500 -- (-351.380) [-345.075] (-345.882) (-345.072) * (-351.569) (-349.103) [-347.816] (-346.678) -- 0:00:02
954000 -- (-346.661) (-346.519) (-347.604) [-347.953] * (-349.569) (-347.388) [-345.375] (-346.564) -- 0:00:02
954500 -- (-347.533) (-346.056) [-345.862] (-347.921) * (-346.448) [-348.137] (-345.108) (-345.184) -- 0:00:02
955000 -- (-348.154) [-349.641] (-345.217) (-346.379) * [-345.353] (-345.245) (-346.626) (-345.748) -- 0:00:02
Average standard deviation of split frequencies: 0.010125
955500 -- (-345.026) (-355.928) [-348.230] (-346.033) * (-345.275) (-345.851) (-346.480) [-346.418] -- 0:00:02
956000 -- [-345.581] (-346.645) (-352.898) (-350.171) * (-349.239) [-348.548] (-348.246) (-345.370) -- 0:00:02
956500 -- (-344.719) (-348.136) [-345.131] (-346.219) * [-346.896] (-346.585) (-352.376) (-347.516) -- 0:00:02
957000 -- [-345.711] (-349.078) (-347.803) (-346.586) * (-349.156) (-349.165) [-348.923] (-348.428) -- 0:00:02
957500 -- (-346.859) (-349.358) (-348.858) [-345.766] * (-349.370) (-345.699) [-345.166] (-346.713) -- 0:00:02
958000 -- (-344.787) [-346.768] (-355.699) (-346.877) * (-349.205) (-347.124) [-347.105] (-346.164) -- 0:00:02
958500 -- (-344.884) (-345.048) [-346.822] (-345.422) * [-350.034] (-348.875) (-345.629) (-345.419) -- 0:00:02
959000 -- (-348.794) [-345.023] (-345.628) (-347.792) * (-348.164) [-344.762] (-345.757) (-348.689) -- 0:00:02
959500 -- (-344.782) [-348.203] (-345.396) (-347.552) * (-347.212) (-345.245) (-346.717) [-346.827] -- 0:00:02
960000 -- (-346.380) (-348.345) [-345.750] (-345.889) * (-351.503) (-347.914) (-347.180) [-347.736] -- 0:00:02
Average standard deviation of split frequencies: 0.010501
960500 -- (-348.107) (-347.527) (-347.036) [-345.215] * (-348.222) [-346.018] (-345.399) (-346.337) -- 0:00:02
961000 -- (-346.760) (-346.656) [-348.670] (-346.245) * (-347.122) (-345.182) (-345.379) [-345.523] -- 0:00:02
961500 -- (-348.426) (-348.718) [-346.640] (-345.659) * [-347.655] (-348.471) (-349.447) (-347.512) -- 0:00:02
962000 -- (-348.605) (-345.688) [-348.027] (-348.532) * (-346.820) (-348.849) (-345.671) [-345.938] -- 0:00:02
962500 -- (-347.694) (-347.616) (-345.008) [-346.120] * (-347.672) [-345.490] (-346.409) (-347.566) -- 0:00:02
963000 -- [-346.548] (-347.088) (-345.200) (-346.791) * [-346.123] (-345.437) (-345.311) (-345.660) -- 0:00:02
963500 -- (-346.811) (-348.536) [-347.009] (-353.666) * (-346.648) [-345.879] (-344.678) (-345.651) -- 0:00:02
964000 -- (-346.468) (-349.748) (-347.520) [-344.689] * (-348.040) (-347.296) (-345.200) [-345.611] -- 0:00:02
964500 -- (-345.442) [-344.766] (-347.760) (-344.520) * [-347.203] (-353.160) (-346.037) (-347.879) -- 0:00:02
965000 -- [-345.851] (-346.093) (-346.868) (-346.926) * (-346.647) (-350.980) (-351.380) [-346.787] -- 0:00:02
Average standard deviation of split frequencies: 0.010346
965500 -- (-346.884) [-345.782] (-349.382) (-344.576) * [-346.622] (-348.057) (-349.185) (-346.525) -- 0:00:02
966000 -- [-349.951] (-346.262) (-349.038) (-345.932) * (-346.037) (-350.212) (-347.117) [-345.011] -- 0:00:02
966500 -- [-348.627] (-348.216) (-345.818) (-345.751) * [-347.098] (-346.506) (-348.941) (-348.735) -- 0:00:02
967000 -- (-351.101) (-348.870) [-348.045] (-345.070) * (-345.450) (-346.450) (-346.582) [-348.157] -- 0:00:02
967500 -- (-348.060) [-345.266] (-346.287) (-347.146) * [-349.350] (-346.375) (-352.386) (-348.584) -- 0:00:01
968000 -- [-346.429] (-344.610) (-346.587) (-346.776) * (-347.790) [-347.283] (-346.952) (-346.020) -- 0:00:01
968500 -- [-345.859] (-344.994) (-347.282) (-344.757) * (-348.151) (-345.090) [-345.756] (-346.585) -- 0:00:01
969000 -- (-346.060) (-346.279) [-344.816] (-344.870) * (-349.535) (-352.270) (-350.486) [-349.204] -- 0:00:01
969500 -- [-344.712] (-348.965) (-345.480) (-344.722) * (-346.872) [-349.823] (-344.870) (-346.665) -- 0:00:01
970000 -- (-345.391) (-345.855) [-345.896] (-347.390) * (-345.766) (-345.660) [-348.152] (-345.737) -- 0:00:01
Average standard deviation of split frequencies: 0.010296
970500 -- (-345.123) [-346.018] (-345.418) (-346.438) * [-350.420] (-346.077) (-348.842) (-345.389) -- 0:00:01
971000 -- [-345.167] (-346.059) (-347.565) (-346.241) * (-347.025) (-346.677) [-348.677] (-349.544) -- 0:00:01
971500 -- (-346.522) (-344.480) (-346.684) [-348.565] * (-347.222) (-346.369) (-349.428) [-345.241] -- 0:00:01
972000 -- (-346.367) (-346.697) (-348.800) [-347.103] * (-345.619) (-346.956) [-347.220] (-350.180) -- 0:00:01
972500 -- [-346.409] (-351.998) (-347.498) (-346.202) * (-351.556) (-346.168) [-346.504] (-344.886) -- 0:00:01
973000 -- (-345.848) (-349.888) [-351.828] (-348.810) * (-348.718) [-345.991] (-350.483) (-347.263) -- 0:00:01
973500 -- (-345.092) [-346.134] (-350.361) (-346.377) * (-346.043) (-346.447) (-346.688) [-347.257] -- 0:00:01
974000 -- (-349.896) [-346.233] (-345.814) (-345.377) * [-346.976] (-350.264) (-344.710) (-350.256) -- 0:00:01
974500 -- (-345.408) (-352.542) [-346.681] (-345.150) * (-347.214) (-349.778) (-344.767) [-349.208] -- 0:00:01
975000 -- [-348.415] (-347.504) (-347.946) (-345.215) * [-347.127] (-345.411) (-345.025) (-348.351) -- 0:00:01
Average standard deviation of split frequencies: 0.009789
975500 -- [-345.190] (-345.394) (-347.069) (-350.046) * (-346.393) [-345.620] (-348.771) (-349.487) -- 0:00:01
976000 -- (-349.037) [-345.479] (-348.474) (-344.765) * (-345.670) (-347.001) [-347.037] (-345.229) -- 0:00:01
976500 -- (-346.671) (-350.021) [-349.916] (-351.815) * (-345.654) (-347.300) (-347.689) [-345.378] -- 0:00:01
977000 -- (-349.251) [-346.671] (-347.716) (-345.778) * (-345.472) (-352.175) (-345.834) [-346.602] -- 0:00:01
977500 -- (-347.328) [-347.306] (-344.764) (-347.306) * (-345.219) [-345.780] (-349.138) (-346.079) -- 0:00:01
978000 -- (-347.563) (-345.851) [-347.708] (-345.626) * (-347.507) (-344.834) [-344.810] (-349.346) -- 0:00:01
978500 -- [-346.667] (-347.815) (-347.687) (-346.030) * [-346.041] (-346.550) (-347.515) (-345.185) -- 0:00:01
979000 -- [-347.874] (-350.671) (-348.577) (-348.051) * (-349.591) (-349.142) [-346.605] (-344.943) -- 0:00:01
979500 -- (-348.762) (-352.414) [-344.630] (-348.780) * (-346.179) (-346.516) [-347.524] (-345.881) -- 0:00:01
980000 -- [-347.907] (-349.563) (-344.722) (-347.925) * (-346.127) [-345.969] (-348.670) (-347.004) -- 0:00:01
Average standard deviation of split frequencies: 0.009646
980500 -- (-346.033) (-348.968) (-347.199) [-345.717] * (-345.356) [-348.611] (-346.019) (-345.467) -- 0:00:01
981000 -- (-347.376) [-346.131] (-346.819) (-347.967) * (-346.088) (-345.753) (-345.284) [-346.747] -- 0:00:01
981500 -- (-347.938) [-345.613] (-346.783) (-345.026) * [-345.268] (-348.643) (-349.021) (-345.309) -- 0:00:01
982000 -- (-345.633) (-346.923) (-347.261) [-347.144] * [-347.051] (-346.549) (-346.269) (-345.458) -- 0:00:01
982500 -- [-345.090] (-347.055) (-345.451) (-346.771) * [-344.954] (-349.008) (-351.879) (-350.432) -- 0:00:01
983000 -- (-344.822) [-350.554] (-344.854) (-345.887) * (-349.399) [-346.623] (-345.893) (-348.179) -- 0:00:01
983500 -- [-344.886] (-351.835) (-346.608) (-345.700) * [-348.975] (-345.707) (-345.168) (-349.792) -- 0:00:01
984000 -- (-345.119) (-351.004) (-346.593) [-344.928] * [-345.411] (-345.948) (-346.776) (-347.937) -- 0:00:00
984500 -- (-347.076) (-347.649) [-346.822] (-347.901) * (-347.970) (-346.734) [-345.694] (-348.845) -- 0:00:00
985000 -- (-348.989) (-347.940) (-346.180) [-348.312] * (-348.972) (-348.025) (-344.397) [-345.211] -- 0:00:00
Average standard deviation of split frequencies: 0.009658
985500 -- (-345.612) (-350.125) [-345.642] (-345.816) * (-350.865) [-346.145] (-344.519) (-346.719) -- 0:00:00
986000 -- (-345.996) [-346.764] (-348.496) (-346.983) * (-350.154) (-348.812) (-349.260) [-345.606] -- 0:00:00
986500 -- [-346.158] (-345.275) (-347.278) (-346.814) * (-351.078) [-348.466] (-347.064) (-347.353) -- 0:00:00
987000 -- (-345.868) [-346.385] (-347.257) (-346.351) * (-348.586) (-347.168) [-345.833] (-345.505) -- 0:00:00
987500 -- (-346.666) [-346.387] (-348.930) (-347.897) * (-354.224) [-344.815] (-346.300) (-345.812) -- 0:00:00
988000 -- (-345.110) [-346.433] (-346.198) (-344.908) * (-346.532) (-346.331) (-346.106) [-346.309] -- 0:00:00
988500 -- [-347.573] (-347.605) (-345.014) (-345.377) * [-346.032] (-346.698) (-346.304) (-345.740) -- 0:00:00
989000 -- (-348.309) [-345.658] (-344.974) (-346.226) * [-347.318] (-346.657) (-351.983) (-345.949) -- 0:00:00
989500 -- (-346.715) [-346.477] (-349.031) (-347.793) * (-346.574) (-347.316) [-348.078] (-347.793) -- 0:00:00
990000 -- (-345.325) (-347.370) (-347.253) [-346.826] * (-346.568) [-345.360] (-344.915) (-347.922) -- 0:00:00
Average standard deviation of split frequencies: 0.009263
990500 -- [-347.864] (-348.930) (-346.355) (-347.361) * (-345.035) (-344.832) [-346.813] (-349.834) -- 0:00:00
991000 -- (-348.033) [-347.238] (-347.220) (-347.143) * (-346.131) (-345.179) [-347.311] (-346.404) -- 0:00:00
991500 -- (-345.557) (-346.695) [-349.805] (-350.948) * (-346.305) (-347.149) (-347.597) [-345.593] -- 0:00:00
992000 -- (-347.435) (-348.548) [-346.023] (-349.380) * (-346.271) (-345.679) [-345.746] (-346.420) -- 0:00:00
992500 -- [-345.213] (-346.498) (-345.462) (-347.072) * (-349.118) (-345.345) (-346.439) [-349.134] -- 0:00:00
993000 -- (-347.981) (-347.723) (-345.770) [-348.834] * (-346.136) (-348.138) [-346.879] (-344.880) -- 0:00:00
993500 -- (-346.302) (-346.008) (-345.688) [-345.762] * (-347.242) [-345.706] (-349.660) (-352.186) -- 0:00:00
994000 -- (-346.738) [-344.754] (-345.831) (-348.205) * (-351.582) (-345.937) [-345.408] (-350.606) -- 0:00:00
994500 -- (-348.685) (-345.873) [-346.974] (-344.849) * (-354.841) [-344.902] (-346.422) (-348.451) -- 0:00:00
995000 -- [-345.311] (-348.024) (-346.291) (-344.851) * (-349.063) [-347.595] (-346.234) (-346.237) -- 0:00:00
Average standard deviation of split frequencies: 0.009277
995500 -- (-347.290) (-346.730) [-344.932] (-345.504) * (-350.499) (-345.834) (-352.385) [-345.458] -- 0:00:00
996000 -- (-346.986) (-346.469) (-349.574) [-344.624] * (-355.937) (-346.668) [-345.146] (-347.931) -- 0:00:00
996500 -- (-345.480) [-346.584] (-346.285) (-346.998) * (-349.741) (-346.298) [-345.822] (-348.587) -- 0:00:00
997000 -- (-345.172) (-344.917) (-345.552) [-347.787] * (-346.178) [-347.102] (-348.703) (-347.117) -- 0:00:00
997500 -- (-347.888) [-345.536] (-345.057) (-347.335) * [-346.773] (-344.711) (-350.968) (-345.572) -- 0:00:00
998000 -- (-348.401) [-348.024] (-347.621) (-348.346) * (-346.246) [-348.116] (-349.498) (-347.090) -- 0:00:00
998500 -- (-345.871) [-346.303] (-348.040) (-347.301) * (-344.325) (-347.908) [-348.936] (-349.126) -- 0:00:00
999000 -- (-346.856) (-345.709) (-346.528) [-347.516] * [-344.443] (-349.315) (-353.354) (-346.551) -- 0:00:00
999500 -- [-346.066] (-345.969) (-345.802) (-345.412) * (-345.015) [-345.659] (-344.482) (-347.197) -- 0:00:00
1000000 -- (-348.107) [-345.112] (-347.449) (-347.881) * [-349.128] (-346.016) (-347.182) (-347.733) -- 0:00:00
Average standard deviation of split frequencies: 0.009422
Analysis completed in 1 mins 1 seconds
Analysis used 59.75 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -344.25
Likelihood of best state for "cold" chain of run 2 was -344.25
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 60 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.9 % ( 32 %) Dirichlet(Pi{all})
40.9 % ( 38 %) Slider(Pi{all})
78.8 % ( 57 %) Multiplier(Alpha{1,2})
77.5 % ( 57 %) Multiplier(Alpha{3})
25.8 % ( 27 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % ( 99 %) NNI(Tau{all},V{all})
89.5 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.3 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 65 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
42.3 % ( 37 %) Dirichlet(Pi{all})
41.2 % ( 24 %) Slider(Pi{all})
78.5 % ( 55 %) Multiplier(Alpha{1,2})
78.3 % ( 44 %) Multiplier(Alpha{3})
26.4 % ( 21 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166457 0.82 0.67
3 | 166755 166831 0.84
4 | 166493 166725 166739
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166819 0.82 0.67
3 | 166705 166600 0.84
4 | 166325 166575 166976
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -346.18
| 1 22 2 |
| 2 2 1 2 2 2 2 |
| 2 2 21 2 1 |
| 1 11 1 2 * 2 1 *|
| 2 1 1 1 1 211 2 1 1 111 21 1 |
| 21 2 2 2*2 2 1 *1 1 1 21 1 2 |
| 1 2 2 1 1 12 2 * 2 2 1 21 |
|2 2 1 22 1 2 * 1 1 |
|1 1 2 1 1 121 2 1 * 12 1 |
| 1 21 1 1 2 2 2 |
| 22 |
| 21 |
| 2 2 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -347.84
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.03 -349.26
2 -346.02 -349.39
--------------------------------------
TOTAL -346.02 -349.33
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884730 0.090761 0.344674 1.477935 0.850715 1242.47 1371.73 1.001
r(A<->C){all} 0.163038 0.019956 0.000172 0.454469 0.124131 224.93 316.08 1.000
r(A<->G){all} 0.169389 0.018423 0.000073 0.446691 0.136658 192.60 208.38 1.001
r(A<->T){all} 0.162901 0.019882 0.000014 0.443531 0.127209 350.23 371.60 1.012
r(C<->G){all} 0.169271 0.021190 0.000132 0.469464 0.129201 175.02 219.91 1.000
r(C<->T){all} 0.169131 0.020621 0.000072 0.462240 0.131507 192.04 229.92 1.001
r(G<->T){all} 0.166271 0.018987 0.000054 0.444800 0.131469 102.44 123.35 1.012
pi(A){all} 0.273041 0.000800 0.218223 0.326822 0.272116 1249.78 1252.02 1.000
pi(C){all} 0.301753 0.000832 0.248654 0.360734 0.300761 1097.64 1207.23 1.000
pi(G){all} 0.253722 0.000775 0.201716 0.310862 0.252750 1149.26 1232.56 1.000
pi(T){all} 0.171484 0.000583 0.126406 0.220804 0.170318 1217.32 1337.20 1.000
alpha{1,2} 0.416432 0.231621 0.000267 1.393386 0.241164 1206.63 1220.68 1.000
alpha{3} 0.457414 0.235989 0.000207 1.453281 0.288222 1345.71 1365.76 1.000
pinvar{all} 0.993284 0.000064 0.978762 0.999996 0.995798 1151.18 1303.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .*...*
9 -- ..*..*
10 -- .***.*
11 -- .**.**
12 -- ....**
13 -- .**...
14 -- .*.*..
15 -- ..**..
16 -- ...**.
17 -- .****.
18 -- ...*.*
19 -- .*..*.
20 -- ..****
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 455 0.151566 0.008951 0.145237 0.157895 2
8 445 0.148235 0.004240 0.145237 0.151233 2
9 443 0.147568 0.003298 0.145237 0.149900 2
10 442 0.147235 0.005653 0.143238 0.151233 2
11 442 0.147235 0.007537 0.141905 0.152565 2
12 440 0.146569 0.005653 0.142572 0.150566 2
13 434 0.144570 0.007537 0.139241 0.149900 2
14 421 0.140240 0.014604 0.129913 0.150566 2
15 421 0.140240 0.013662 0.130580 0.149900 2
16 420 0.139907 0.003769 0.137242 0.142572 2
17 419 0.139574 0.017430 0.127249 0.151899 2
18 416 0.138574 0.004711 0.135243 0.141905 2
19 415 0.138241 0.008951 0.131912 0.144570 2
20 414 0.137908 0.025439 0.119920 0.155896 2
21 411 0.136909 0.009893 0.129913 0.143904 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096596 0.009115 0.000045 0.290652 0.067401 1.000 2
length{all}[2] 0.095327 0.009135 0.000079 0.288930 0.064596 1.000 2
length{all}[3] 0.098373 0.009416 0.000026 0.282010 0.067291 1.001 2
length{all}[4] 0.101482 0.010087 0.000022 0.295267 0.071478 1.000 2
length{all}[5] 0.100024 0.009854 0.000070 0.304041 0.068890 1.000 2
length{all}[6] 0.098651 0.009917 0.000003 0.294613 0.069466 1.000 2
length{all}[7] 0.101076 0.010432 0.000006 0.307882 0.072235 1.008 2
length{all}[8] 0.098098 0.009317 0.000604 0.285694 0.066640 0.998 2
length{all}[9] 0.101750 0.011559 0.000236 0.306715 0.068581 1.000 2
length{all}[10] 0.105314 0.010424 0.000055 0.311053 0.072039 0.998 2
length{all}[11] 0.102960 0.008925 0.000271 0.290265 0.074945 1.000 2
length{all}[12] 0.093285 0.008470 0.000084 0.277709 0.067367 1.002 2
length{all}[13] 0.097206 0.007778 0.000452 0.262795 0.075085 0.998 2
length{all}[14] 0.103069 0.013843 0.000025 0.318802 0.069200 1.000 2
length{all}[15] 0.089430 0.009158 0.000261 0.262948 0.060095 1.001 2
length{all}[16] 0.100553 0.009378 0.000169 0.301424 0.072218 1.000 2
length{all}[17] 0.098590 0.008610 0.000247 0.278423 0.072603 1.000 2
length{all}[18] 0.101338 0.009238 0.000540 0.293176 0.076456 1.001 2
length{all}[19] 0.090474 0.007751 0.000112 0.273879 0.060806 0.999 2
length{all}[20] 0.092636 0.007509 0.000072 0.272489 0.065714 0.998 2
length{all}[21] 0.112358 0.014770 0.000005 0.338929 0.077123 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009422
Maximum standard deviation of split frequencies = 0.025439
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 252
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 40 patterns at 84 / 84 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 40 patterns at 84 / 84 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
39040 bytes for conP
3520 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.104523 0.053602 0.066677 0.010478 0.028673 0.049217 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -365.274725
Iterating by ming2
Initial: fx= 365.274725
x= 0.10452 0.05360 0.06668 0.01048 0.02867 0.04922 0.30000 1.30000
1 h-m-p 0.0000 0.0001 199.8289 ++ 360.176041 m 0.0001 13 | 1/8
2 h-m-p 0.0005 0.0077 44.2428 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 182.4746 +++ 352.765856 m 0.0002 45 | 2/8
4 h-m-p 0.0010 0.0096 35.9343 -----------.. | 2/8
5 h-m-p 0.0000 0.0003 163.4608 +++ 346.029871 m 0.0003 77 | 3/8
6 h-m-p 0.0013 0.0130 27.3500 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 141.8627 ++ 344.947454 m 0.0001 108 | 4/8
8 h-m-p 0.0003 0.0182 20.1524 ----------.. | 4/8
9 h-m-p 0.0000 0.0002 115.7195 +++ 342.794444 m 0.0002 139 | 5/8
10 h-m-p 0.0010 0.0270 13.7121 -----------.. | 5/8
11 h-m-p 0.0000 0.0005 81.7522 +++ 339.659938 m 0.0005 171 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 339.659938 m 8.0000 182 | 6/8
13 h-m-p 0.1533 8.0000 0.0001 +++ 339.659938 m 8.0000 196 | 6/8
14 h-m-p 0.0160 8.0000 0.3422 +++Y 339.659938 0 2.3253 212 | 6/8
15 h-m-p 1.6000 8.0000 0.0544 C 339.659938 0 1.8536 225 | 6/8
16 h-m-p 1.6000 8.0000 0.0098 Y 339.659938 0 0.8344 238 | 6/8
17 h-m-p 1.6000 8.0000 0.0009 Y 339.659938 0 0.4000 251 | 6/8
18 h-m-p 1.3962 8.0000 0.0002 C 339.659938 0 1.3962 264 | 6/8
19 h-m-p 1.6000 8.0000 0.0000 Y 339.659938 0 1.6000 277 | 6/8
20 h-m-p 0.1292 8.0000 0.0002 +++ 339.659938 m 8.0000 291 | 6/8
21 h-m-p 0.0654 8.0000 0.0225 ++Y 339.659938 0 0.7630 306 | 6/8
22 h-m-p 1.6000 8.0000 0.0006 --Y 339.659938 0 0.0250 321 | 6/8
23 h-m-p 0.0657 8.0000 0.0002 ++++ 339.659938 m 8.0000 336 | 6/8
24 h-m-p 0.0160 8.0000 1.8533 ---------C 339.659938 0 0.0000 358 | 6/8
25 h-m-p 0.0160 8.0000 0.0053 +++++ 339.659937 m 8.0000 372 | 6/8
26 h-m-p 0.0197 0.8203 2.1572 +++ 339.659923 m 0.8203 386 | 7/8
27 h-m-p 1.6000 8.0000 0.7041 ++ 339.659919 m 8.0000 397 | 7/8
28 h-m-p 1.6000 8.0000 1.0506 ++ 339.659917 m 8.0000 409 | 7/8
29 h-m-p 1.6000 8.0000 2.4226 ++ 339.659916 m 8.0000 420 | 7/8
30 h-m-p 0.0276 0.1382 267.6953 ---------Y 339.659916 0 0.0000 440 | 7/8
31 h-m-p 1.6000 8.0000 0.0000 C 339.659916 0 1.6000 451 | 7/8
32 h-m-p 1.1663 8.0000 0.0000 -------------Y 339.659916 0 0.0000 476
Out..
lnL = -339.659916
477 lfun, 477 eigenQcodon, 2862 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078026 0.073294 0.089304 0.025735 0.036601 0.025230 0.000100 0.583942 0.335842
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.615576
np = 9
lnL0 = -365.983598
Iterating by ming2
Initial: fx= 365.983598
x= 0.07803 0.07329 0.08930 0.02574 0.03660 0.02523 0.00011 0.58394 0.33584
1 h-m-p 0.0000 0.0000 191.5776 ++ 365.704370 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0016 96.4410 ++++ 353.761774 m 0.0016 28 | 2/9
3 h-m-p 0.0000 0.0000 130.2857 ++ 353.601856 m 0.0000 40 | 3/9
4 h-m-p 0.0000 0.0006 112.2593 +++ 350.262840 m 0.0006 53 | 4/9
5 h-m-p 0.0001 0.0005 210.0800 ++ 341.716107 m 0.0005 65 | 5/9
6 h-m-p 0.0001 0.0006 62.6751 ++ 341.089971 m 0.0006 77 | 6/9
7 h-m-p 0.0011 0.0053 6.1704 -----------.. | 6/9
8 h-m-p 0.0000 0.0000 115.9706 ++ 340.770893 m 0.0000 110 | 7/9
9 h-m-p 0.0010 0.3839 1.8463 -----------.. | 7/9
10 h-m-p 0.0000 0.0002 82.0216 +++ 339.659958 m 0.0002 144 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 ++ 339.659958 m 8.0000 156 | 7/9
12 h-m-p 0.0160 8.0000 0.0423 +++++ 339.659943 m 8.0000 172 | 7/9
13 h-m-p 0.2676 1.3381 0.2433 ++ 339.659937 m 1.3381 186 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 339.659937 0 1.6000 200 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 N 339.659937 0 1.6000 213
Out..
lnL = -339.659937
214 lfun, 642 eigenQcodon, 2568 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082912 0.076466 0.020358 0.060202 0.104655 0.025350 0.000100 1.664416 0.269736 0.470402 39.131644
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 2.114845
np = 11
lnL0 = -354.377904
Iterating by ming2
Initial: fx= 354.377904
x= 0.08291 0.07647 0.02036 0.06020 0.10465 0.02535 0.00011 1.66442 0.26974 0.47040 39.13164
1 h-m-p 0.0000 0.0000 50.0789 ++ 354.359752 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0569 10.2854 +++++ 349.195021 m 0.0569 33 | 2/11
3 h-m-p 0.0000 0.0002 563.3336 ++ 347.926242 m 0.0002 47 | 3/11
4 h-m-p 0.0000 0.0000 2552.2121 ++ 347.458033 m 0.0000 61 | 4/11
5 h-m-p 0.0000 0.0000 19450.9399 ++ 347.396851 m 0.0000 75 | 5/11
6 h-m-p 0.0005 0.0025 27.5628 ++ 347.075640 m 0.0025 89 | 6/11
7 h-m-p 0.0067 0.0337 5.5037 ++ 343.267452 m 0.0337 103 | 7/11
8 h-m-p 0.0061 0.0573 25.7236 ++ 339.659931 m 0.0573 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 339.659931 m 8.0000 131 | 8/11
10 h-m-p 0.0160 8.0000 0.0175 --------N 339.659931 0 0.0000 156 | 8/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 339.659931 m 8.0000 176 | 8/11
12 h-m-p 0.0160 8.0000 1.7825 +++++ 339.659916 m 8.0000 196 | 8/11
13 h-m-p 1.6000 8.0000 0.0349 ++ 339.659916 m 8.0000 210 | 8/11
14 h-m-p 1.6000 8.0000 0.0090 ++ 339.659916 m 8.0000 227 | 8/11
15 h-m-p 0.0938 8.0000 0.7706 ----Y 339.659916 0 0.0001 248 | 8/11
16 h-m-p 0.2171 8.0000 0.0003 Y 339.659916 0 0.2171 265 | 8/11
17 h-m-p 0.1495 8.0000 0.0005 Y 339.659916 0 0.1495 282 | 8/11
18 h-m-p 0.2109 8.0000 0.0003 --C 339.659916 0 0.0033 301 | 8/11
19 h-m-p 0.2062 8.0000 0.0000 ------------Y 339.659916 0 0.0000 330
Out..
lnL = -339.659916
331 lfun, 1324 eigenQcodon, 5958 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -339.658111 S = -339.657984 -0.000048
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:03
did 20 / 40 patterns 0:03
did 30 / 40 patterns 0:03
did 40 / 40 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.100144 0.070530 0.053651 0.026921 0.037663 0.037458 0.000100 0.232482 1.510359
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 28.384105
np = 9
lnL0 = -365.834499
Iterating by ming2
Initial: fx= 365.834499
x= 0.10014 0.07053 0.05365 0.02692 0.03766 0.03746 0.00011 0.23248 1.51036
1 h-m-p 0.0000 0.0000 189.1919 ++ 365.686585 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0200 29.4952 +++++ 355.599559 m 0.0200 29 | 2/9
3 h-m-p 0.0001 0.0005 216.4992 ++ 350.075956 m 0.0005 41 | 3/9
4 h-m-p 0.0000 0.0001 20.2094 --------.. | 3/9
5 h-m-p 0.0000 0.0000 161.2173 ++ 349.998638 m 0.0000 71 | 4/9
6 h-m-p 0.0004 0.1828 5.1772 ----------.. | 4/9
7 h-m-p 0.0000 0.0002 139.2466 +++ 345.569024 m 0.0002 104 | 5/9
8 h-m-p 0.0068 0.2764 3.7800 -------------.. | 5/9
9 h-m-p 0.0000 0.0002 114.8085 +++ 342.430543 m 0.0002 140 | 6/9
10 h-m-p 0.0090 1.2091 2.1316 -------------.. | 6/9
11 h-m-p 0.0000 0.0004 81.6960 +++ 339.659953 m 0.0004 176 | 7/9
12 h-m-p 1.2145 8.0000 0.0000 ++ 339.659953 m 8.0000 188 | 7/9
13 h-m-p 0.0174 8.0000 0.0023 +++++ 339.659953 m 8.0000 205 | 7/9
14 h-m-p 0.0297 8.0000 0.6217 +++++ 339.659948 m 8.0000 222 | 7/9
15 h-m-p 1.6000 8.0000 0.2105 ++ 339.659948 m 8.0000 236 | 7/9
16 h-m-p 0.6210 8.0000 2.7124 ++ 339.659947 m 8.0000 250 | 7/9
17 h-m-p 1.6000 8.0000 3.2110 ++ 339.659947 m 8.0000 262 | 7/9
18 h-m-p 0.5415 2.7075 26.1310 ++ 339.659947 m 2.7075 274 | 8/9
19 h-m-p 0.1220 0.6102 33.8629 ---------------.. | 8/9
20 h-m-p 0.0160 8.0000 0.0000 C 339.659947 0 0.0160 311 | 8/9
21 h-m-p 0.0210 8.0000 0.0000 -----Y 339.659947 0 0.0000 329
Out..
lnL = -339.659947
330 lfun, 3630 eigenQcodon, 19800 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.107453 0.067703 0.074331 0.057302 0.095462 0.068432 0.000100 0.900000 0.850149 1.156164 37.002950
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 2.871507
np = 11
lnL0 = -354.578670
Iterating by ming2
Initial: fx= 354.578670
x= 0.10745 0.06770 0.07433 0.05730 0.09546 0.06843 0.00011 0.90000 0.85015 1.15616 37.00295
1 h-m-p 0.0000 0.0000 47.1302 ++ 354.565104 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 2541.4836 ++ 346.126087 m 0.0001 30 | 2/11
3 h-m-p 0.0006 0.0032 14.2174 ++ 345.021658 m 0.0032 44 | 3/11
4 h-m-p 0.0000 0.0000 48.1810 ++ 344.924741 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 393.0681 ++ 344.907723 m 0.0000 72 | 4/11
6 h-m-p 0.0004 0.0076 2.8288 +++ 344.854578 m 0.0076 87 | 5/11
7 h-m-p 0.0002 0.0012 37.5985 ++ 344.179321 m 0.0012 101 | 6/11
8 h-m-p 0.0000 0.0001 90.8621 ++ 343.903210 m 0.0001 115 | 6/11
9 h-m-p 0.0000 0.0000 24.6308
h-m-p: 0.00000000e+00 0.00000000e+00 2.46308437e+01 343.903210
.. | 6/11
10 h-m-p 0.0000 0.0006 167.8086 +++ 339.659922 m 0.0006 141 | 7/11
11 h-m-p 1.6000 8.0000 0.0000 ++ 339.659922 m 8.0000 155 | 7/11
12 h-m-p 0.0161 8.0000 0.0003 +++++ 339.659922 m 8.0000 176 | 7/11
13 h-m-p 0.0074 3.6970 0.6688 ++++
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
+ 339.659918 m 3.6970 197
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85303, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
14 h-m-p -0.0000 -0.0000 0.4058
h-m-p: -1.08910767e-16 -5.44553836e-16 4.05823581e-01 339.659918
..
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85303, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
+ 339.659918 m 8.0000 233
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85330, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85303, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
16 h-m-p 0.0125 6.2559 0.1199
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.85317, 0.00500) = 1.000000e+00 2000 rounds
+++++ 339.659916 m 6.2559 254 | 8/11
17 h-m-p 1.6000 8.0000 0.0023 ++ 339.659916 m 8.0000 272 | 8/11
18 h-m-p 0.0005 0.0025 9.3477 -----------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0000 --C 339.659916 0 0.0003 314
Out..
lnL = -339.659916
315 lfun, 3780 eigenQcodon, 20790 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -339.658149 S = -339.657984 -0.000072
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:14
did 20 / 40 patterns 0:14
did 30 / 40 patterns 0:15
did 40 / 40 patterns 0:15
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=84
NC_011896_1_WP_010907775_1_544_MLBR_RS02585 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
NC_002677_1_NP_301451_1_323_ML0527 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
**************************************************
NC_011896_1_WP_010907775_1_544_MLBR_RS02585 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
NC_002677_1_NP_301451_1_323_ML0527 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
**********************************
>NC_011896_1_WP_010907775_1_544_MLBR_RS02585 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA CA >NC_002677_1_NP_301451_1_323_ML0527 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA CA >NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA CA >NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA CA >NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA CA >NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA CA
>NC_011896_1_WP_010907775_1_544_MLBR_RS02585 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT >NC_002677_1_NP_301451_1_323_ML0527 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT >NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT >NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT >NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT >NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
#NEXUS
[ID: 1584819900]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907775_1_544_MLBR_RS02585
NC_002677_1_NP_301451_1_323_ML0527
NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485
NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890
NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850
NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907775_1_544_MLBR_RS02585,
2 NC_002677_1_NP_301451_1_323_ML0527,
3 NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485,
4 NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890,
5 NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850,
6 NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06740078,2:0.06459602,3:0.0672909,4:0.07147839,5:0.06888976,6:0.06946609);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06740078,2:0.06459602,3:0.0672909,4:0.07147839,5:0.06888976,6:0.06946609);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.03 -349.26
2 -346.02 -349.39
--------------------------------------
TOTAL -346.02 -349.33
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884730 0.090761 0.344674 1.477935 0.850715 1242.47 1371.73 1.001
r(A<->C){all} 0.163038 0.019956 0.000172 0.454469 0.124131 224.93 316.08 1.000
r(A<->G){all} 0.169389 0.018423 0.000073 0.446691 0.136658 192.60 208.38 1.001
r(A<->T){all} 0.162901 0.019882 0.000014 0.443531 0.127209 350.23 371.60 1.012
r(C<->G){all} 0.169271 0.021190 0.000132 0.469464 0.129201 175.02 219.91 1.000
r(C<->T){all} 0.169131 0.020621 0.000072 0.462240 0.131507 192.04 229.92 1.001
r(G<->T){all} 0.166271 0.018987 0.000054 0.444800 0.131469 102.44 123.35 1.012
pi(A){all} 0.273041 0.000800 0.218223 0.326822 0.272116 1249.78 1252.02 1.000
pi(C){all} 0.301753 0.000832 0.248654 0.360734 0.300761 1097.64 1207.23 1.000
pi(G){all} 0.253722 0.000775 0.201716 0.310862 0.252750 1149.26 1232.56 1.000
pi(T){all} 0.171484 0.000583 0.126406 0.220804 0.170318 1217.32 1337.20 1.000
alpha{1,2} 0.416432 0.231621 0.000267 1.393386 0.241164 1206.63 1220.68 1.000
alpha{3} 0.457414 0.235989 0.000207 1.453281 0.288222 1345.71 1365.76 1.000
pinvar{all} 0.993284 0.000064 0.978762 0.999996 0.995798 1151.18 1303.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0527/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 84
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 4 4 4 4 4 4 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 1 1 1 1 1 1
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 5 5 5 5 5 5 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 2 2 2 2 2 2 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 1 1 1 1 1 1 | Gly GGT 0 0 0 0 0 0
GTC 0 0 0 0 0 0 | GCC 3 3 3 3 3 3 | GAC 0 0 0 0 0 0 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 4 4 4 4 4 4 | GCG 3 3 3 3 3 3 | GAG 0 0 0 0 0 0 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907775_1_544_MLBR_RS02585
position 1: T:0.13095 C:0.27381 A:0.28571 G:0.30952
position 2: T:0.22619 C:0.32143 A:0.25000 G:0.20238
position 3: T:0.15476 C:0.30952 A:0.28571 G:0.25000
Average T:0.17063 C:0.30159 A:0.27381 G:0.25397
#2: NC_002677_1_NP_301451_1_323_ML0527
position 1: T:0.13095 C:0.27381 A:0.28571 G:0.30952
position 2: T:0.22619 C:0.32143 A:0.25000 G:0.20238
position 3: T:0.15476 C:0.30952 A:0.28571 G:0.25000
Average T:0.17063 C:0.30159 A:0.27381 G:0.25397
#3: NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485
position 1: T:0.13095 C:0.27381 A:0.28571 G:0.30952
position 2: T:0.22619 C:0.32143 A:0.25000 G:0.20238
position 3: T:0.15476 C:0.30952 A:0.28571 G:0.25000
Average T:0.17063 C:0.30159 A:0.27381 G:0.25397
#4: NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890
position 1: T:0.13095 C:0.27381 A:0.28571 G:0.30952
position 2: T:0.22619 C:0.32143 A:0.25000 G:0.20238
position 3: T:0.15476 C:0.30952 A:0.28571 G:0.25000
Average T:0.17063 C:0.30159 A:0.27381 G:0.25397
#5: NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850
position 1: T:0.13095 C:0.27381 A:0.28571 G:0.30952
position 2: T:0.22619 C:0.32143 A:0.25000 G:0.20238
position 3: T:0.15476 C:0.30952 A:0.28571 G:0.25000
Average T:0.17063 C:0.30159 A:0.27381 G:0.25397
#6: NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940
position 1: T:0.13095 C:0.27381 A:0.28571 G:0.30952
position 2: T:0.22619 C:0.32143 A:0.25000 G:0.20238
position 3: T:0.15476 C:0.30952 A:0.28571 G:0.25000
Average T:0.17063 C:0.30159 A:0.27381 G:0.25397
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 0 | TCC 0 | TAC 12 | TGC 12
Leu L TTA 6 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 24 | Arg R CGT 0
CTC 6 | CCC 6 | CAC 0 | CGC 6
CTA 18 | CCA 6 | Gln Q CAA 12 | CGA 6
CTG 18 | CCG 6 | CAG 12 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 30 | Asn N AAT 0 | Ser S AGT 0
ATC 24 | ACC 12 | AAC 24 | AGC 12
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 6 | ACG 6 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 6 | Gly G GGT 0
GTC 0 | GCC 18 | GAC 0 | GGC 24
GTA 6 | GCA 12 | Glu E GAA 12 | GGA 18
GTG 24 | GCG 18 | GAG 0 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13095 C:0.27381 A:0.28571 G:0.30952
position 2: T:0.22619 C:0.32143 A:0.25000 G:0.20238
position 3: T:0.15476 C:0.30952 A:0.28571 G:0.25000
Average T:0.17063 C:0.30159 A:0.27381 G:0.25397
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -339.659916 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 37.002950
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907775_1_544_MLBR_RS02585: 0.000004, NC_002677_1_NP_301451_1_323_ML0527: 0.000004, NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485: 0.000004, NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890: 0.000004, NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850: 0.000004, NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 37.00295
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 191.6 60.4 37.0030 0.0000 0.0000 0.0 0.0
7..2 0.000 191.6 60.4 37.0030 0.0000 0.0000 0.0 0.0
7..3 0.000 191.6 60.4 37.0030 0.0000 0.0000 0.0 0.0
7..4 0.000 191.6 60.4 37.0030 0.0000 0.0000 0.0 0.0
7..5 0.000 191.6 60.4 37.0030 0.0000 0.0000 0.0 0.0
7..6 0.000 191.6 60.4 37.0030 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -339.659937 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.026379
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907775_1_544_MLBR_RS02585: 0.000004, NC_002677_1_NP_301451_1_323_ML0527: 0.000004, NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485: 0.000004, NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890: 0.000004, NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850: 0.000004, NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.02638 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 191.6 60.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 191.6 60.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 191.6 60.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 191.6 60.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 191.6 60.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 191.6 60.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -339.659916 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.003886 0.000081 0.000001 37.636877
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907775_1_544_MLBR_RS02585: 0.000004, NC_002677_1_NP_301451_1_323_ML0527: 0.000004, NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485: 0.000004, NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890: 0.000004, NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850: 0.000004, NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00389 0.00008 0.99603
w: 0.00000 1.00000 37.63688
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 191.6 60.4 37.4877 0.0000 0.0000 0.0 0.0
7..2 0.000 191.6 60.4 37.4877 0.0000 0.0000 0.0 0.0
7..3 0.000 191.6 60.4 37.4877 0.0000 0.0000 0.0 0.0
7..4 0.000 191.6 60.4 37.4877 0.0000 0.0000 0.0 0.0
7..5 0.000 191.6 60.4 37.4877 0.0000 0.0000 0.0 0.0
7..6 0.000 191.6 60.4 37.4877 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907775_1_544_MLBR_RS02585)
Pr(w>1) post mean +- SE for w
1 V 0.996** 37.488
2 V 0.996** 37.488
3 Y 0.996** 37.488
4 L 0.996** 37.488
5 E 0.996** 37.488
6 N 0.996** 37.488
7 H 0.996** 37.488
8 G 0.996** 37.488
9 V 0.996** 37.488
10 K 0.996** 37.488
11 G 0.996** 37.488
12 H 0.996** 37.488
13 H 0.996** 37.488
14 R 0.996** 37.488
15 Q 0.996** 37.488
16 P 0.996** 37.488
17 Q 0.996** 37.488
18 R 0.996** 37.488
19 A 0.996** 37.488
20 L 0.996** 37.488
21 H 0.996** 37.488
22 Q 0.996** 37.488
23 A 0.996** 37.488
24 S 0.996** 37.488
25 S 0.996** 37.488
26 S 0.996** 37.488
27 L 0.996** 37.488
28 I 0.996** 37.488
29 N 0.996** 37.488
30 A 0.996** 37.488
31 Y 0.996** 37.488
32 G 0.996** 37.488
33 Y 0.996** 37.488
34 G 0.996** 37.488
35 I 0.996** 37.488
36 K 0.996** 37.488
37 L 0.996** 37.488
38 L 0.996** 37.488
39 C 0.996** 37.488
40 L 0.996** 37.488
41 C 0.996** 37.488
42 P 0.996** 37.488
43 G 0.996** 37.488
44 S 0.996** 37.488
45 I 0.996** 37.488
46 P 0.996** 37.488
47 A 0.996** 37.488
48 T 0.996** 37.488
49 R 0.996** 37.488
50 T 0.996** 37.488
51 T 0.996** 37.488
52 R 0.996** 37.488
53 Q 0.996** 37.488
54 S 0.996** 37.488
55 V 0.996** 37.488
56 V 0.996** 37.488
57 D 0.996** 37.488
58 L 0.996** 37.488
59 T 0.996** 37.488
60 S 0.996** 37.488
61 V 0.996** 37.488
62 S 0.996** 37.488
63 T 0.996** 37.488
64 G 0.996** 37.488
65 T 0.996** 37.488
66 A 0.996** 37.488
67 T 0.996** 37.488
68 R 0.996** 37.488
69 T 0.996** 37.488
70 A 0.996** 37.488
71 M 0.996** 37.488
72 T 0.996** 37.488
73 N 0.996** 37.488
74 L 0.996** 37.488
75 A 0.996** 37.488
76 G 0.996** 37.488
77 N 0.996** 37.488
78 I 0.996** 37.488
79 E 0.996** 37.488
80 A 0.996** 37.488
81 A 0.996** 37.488
82 G 0.996** 37.488
83 K 0.996** 37.488
84 T 0.996** 37.488
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907775_1_544_MLBR_RS02585)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -339.659947 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 99.000000 78.337329
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907775_1_544_MLBR_RS02585: 0.000004, NC_002677_1_NP_301451_1_323_ML0527: 0.000004, NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485: 0.000004, NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890: 0.000004, NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850: 0.000004, NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 99.00000 q = 78.33733
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.49670 0.51960 0.53321 0.54406 0.55378 0.56317 0.57283 0.58355 0.59688 0.61907
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 191.6 60.4 0.5583 0.0000 0.0000 0.0 0.0
7..2 0.000 191.6 60.4 0.5583 0.0000 0.0000 0.0 0.0
7..3 0.000 191.6 60.4 0.5583 0.0000 0.0000 0.0 0.0
7..4 0.000 191.6 60.4 0.5583 0.0000 0.0000 0.0 0.0
7..5 0.000 191.6 60.4 0.5583 0.0000 0.0000 0.0 0.0
7..6 0.000 191.6 60.4 0.5583 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -339.659916 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 2.853167 0.005689 37.671341
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907775_1_544_MLBR_RS02585: 0.000004, NC_002677_1_NP_301451_1_323_ML0527: 0.000004, NZ_LVXE01000008_1_WP_010907775_1_2738_A3216_RS04485: 0.000004, NZ_LYPH01000055_1_WP_010907775_1_2065_A8144_RS09890: 0.000004, NZ_CP029543_1_WP_010907775_1_558_DIJ64_RS02850: 0.000004, NZ_AP014567_1_WP_010907775_1_576_JK2ML_RS02940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 2.85317 q = 0.00569
(p1 = 0.99999) w = 37.67134
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.99997 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 37.67134
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 191.6 60.4 37.6710 0.0000 0.0000 0.0 0.0
7..2 0.000 191.6 60.4 37.6710 0.0000 0.0000 0.0 0.0
7..3 0.000 191.6 60.4 37.6710 0.0000 0.0000 0.0 0.0
7..4 0.000 191.6 60.4 37.6710 0.0000 0.0000 0.0 0.0
7..5 0.000 191.6 60.4 37.6710 0.0000 0.0000 0.0 0.0
7..6 0.000 191.6 60.4 37.6710 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907775_1_544_MLBR_RS02585)
Pr(w>1) post mean +- SE for w
1 V 1.000** 37.671
2 V 1.000** 37.671
3 Y 1.000** 37.671
4 L 1.000** 37.671
5 E 1.000** 37.671
6 N 1.000** 37.671
7 H 1.000** 37.671
8 G 1.000** 37.671
9 V 1.000** 37.671
10 K 1.000** 37.671
11 G 1.000** 37.671
12 H 1.000** 37.671
13 H 1.000** 37.671
14 R 1.000** 37.671
15 Q 1.000** 37.671
16 P 1.000** 37.671
17 Q 1.000** 37.671
18 R 1.000** 37.671
19 A 1.000** 37.671
20 L 1.000** 37.671
21 H 1.000** 37.671
22 Q 1.000** 37.671
23 A 1.000** 37.671
24 S 1.000** 37.671
25 S 1.000** 37.671
26 S 1.000** 37.671
27 L 1.000** 37.671
28 I 1.000** 37.671
29 N 1.000** 37.671
30 A 1.000** 37.671
31 Y 1.000** 37.671
32 G 1.000** 37.671
33 Y 1.000** 37.671
34 G 1.000** 37.671
35 I 1.000** 37.671
36 K 1.000** 37.671
37 L 1.000** 37.671
38 L 1.000** 37.671
39 C 1.000** 37.671
40 L 1.000** 37.671
41 C 1.000** 37.671
42 P 1.000** 37.671
43 G 1.000** 37.671
44 S 1.000** 37.671
45 I 1.000** 37.671
46 P 1.000** 37.671
47 A 1.000** 37.671
48 T 1.000** 37.671
49 R 1.000** 37.671
50 T 1.000** 37.671
51 T 1.000** 37.671
52 R 1.000** 37.671
53 Q 1.000** 37.671
54 S 1.000** 37.671
55 V 1.000** 37.671
56 V 1.000** 37.671
57 D 1.000** 37.671
58 L 1.000** 37.671
59 T 1.000** 37.671
60 S 1.000** 37.671
61 V 1.000** 37.671
62 S 1.000** 37.671
63 T 1.000** 37.671
64 G 1.000** 37.671
65 T 1.000** 37.671
66 A 1.000** 37.671
67 T 1.000** 37.671
68 R 1.000** 37.671
69 T 1.000** 37.671
70 A 1.000** 37.671
71 M 1.000** 37.671
72 T 1.000** 37.671
73 N 1.000** 37.671
74 L 1.000** 37.671
75 A 1.000** 37.671
76 G 1.000** 37.671
77 N 1.000** 37.671
78 I 1.000** 37.671
79 E 1.000** 37.671
80 A 1.000** 37.671
81 A 1.000** 37.671
82 G 1.000** 37.671
83 K 1.000** 37.671
84 T 1.000** 37.671
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907775_1_544_MLBR_RS02585)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:15
Model 1: NearlyNeutral -339.659937 Model 2: PositiveSelection -339.659916 Model 0: one-ratio -339.659916 Model 7: beta -339.659947 Model 8: beta&w>1 -339.659916 Model 0 vs 1 4.200000000764703E-5 Model 2 vs 1 4.200000000764703E-5 Model 8 vs 7 6.199999995715189E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
