--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:55:47 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0527/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.03 -349.26
2 -346.02 -349.39
--------------------------------------
TOTAL -346.02 -349.33
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884730 0.090761 0.344674 1.477935 0.850715 1242.47 1371.73 1.001
r(A<->C){all} 0.163038 0.019956 0.000172 0.454469 0.124131 224.93 316.08 1.000
r(A<->G){all} 0.169389 0.018423 0.000073 0.446691 0.136658 192.60 208.38 1.001
r(A<->T){all} 0.162901 0.019882 0.000014 0.443531 0.127209 350.23 371.60 1.012
r(C<->G){all} 0.169271 0.021190 0.000132 0.469464 0.129201 175.02 219.91 1.000
r(C<->T){all} 0.169131 0.020621 0.000072 0.462240 0.131507 192.04 229.92 1.001
r(G<->T){all} 0.166271 0.018987 0.000054 0.444800 0.131469 102.44 123.35 1.012
pi(A){all} 0.273041 0.000800 0.218223 0.326822 0.272116 1249.78 1252.02 1.000
pi(C){all} 0.301753 0.000832 0.248654 0.360734 0.300761 1097.64 1207.23 1.000
pi(G){all} 0.253722 0.000775 0.201716 0.310862 0.252750 1149.26 1232.56 1.000
pi(T){all} 0.171484 0.000583 0.126406 0.220804 0.170318 1217.32 1337.20 1.000
alpha{1,2} 0.416432 0.231621 0.000267 1.393386 0.241164 1206.63 1220.68 1.000
alpha{3} 0.457414 0.235989 0.000207 1.453281 0.288222 1345.71 1365.76 1.000
pinvar{all} 0.993284 0.000064 0.978762 0.999996 0.995798 1151.18 1303.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -339.659937
Model 2: PositiveSelection -339.659916
Model 0: one-ratio -339.659916
Model 7: beta -339.659947
Model 8: beta&w>1 -339.659916
Model 0 vs 1 4.200000000764703E-5
Model 2 vs 1 4.200000000764703E-5
Model 8 vs 7 6.199999995715189E-5
>C1
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C2
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C3
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C4
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C5
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C6
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=84
C1 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C2 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C3 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C4 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C5 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C6 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
**************************************************
C1 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C2 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C3 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C4 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C5 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C6 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
**********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2520]--->[2520]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.606 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C2 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C3 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C4 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C5 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
C6 VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
**************************************************
C1 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C2 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C3 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C4 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C5 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
C6 TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
**********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C2 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C3 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C4 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C5 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
C6 GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
**************************************************
C1 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C2 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C3 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C4 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C5 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
C6 ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
**************************************************
C1 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C2 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C3 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C4 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C5 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
C6 GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
**************************************************
C1 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C2 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C3 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C4 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C5 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
C6 ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
**************************************************
C1 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C2 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C3 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C4 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C5 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
C6 GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
**************************************************
C1 CA
C2 CA
C3 CA
C4 CA
C5 CA
C6 CA
**
>C1
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C2
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C3
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C4
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C5
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C6
GTGGTTTACCTGGAAAACCATGGCGTGAAAGGACATCATCGGCAGCCCCA
ACGCGCCCTACATCAAGCATCAAGCAGCCTCATCAACGCCTACGGATATG
GGATCAAATTACTATGCCTATGCCCGGGCTCAATCCCAGCGACCCGAACT
ACACGGCAGTCAGTGGTGGATCTGACTTCGGTATCAACTGGAACTGCCAC
GCGGACTGCTATGACCAACCTGGCAGGCAACATCGAAGCGGCGGGCAAGA
CA
>C1
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C2
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C3
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C4
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C5
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
>C6
VVYLENHGVKGHHRQPQRALHQASSSLINAYGYGIKLLCLCPGSIPATRT
TRQSVVDLTSVSTGTATRTAMTNLAGNIEAAGKT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 252 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579802067
Setting output file names to "/data/4res/ML0527/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1252515960
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1584819900
Seed = 656765123
Swapseed = 1579802067
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -563.987998 -- -24.965149
Chain 2 -- -563.988084 -- -24.965149
Chain 3 -- -563.988052 -- -24.965149
Chain 4 -- -563.988084 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -563.987998 -- -24.965149
Chain 2 -- -563.988052 -- -24.965149
Chain 3 -- -563.987998 -- -24.965149
Chain 4 -- -563.988052 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-563.988] (-563.988) (-563.988) (-563.988) * [-563.988] (-563.988) (-563.988) (-563.988)
500 -- (-349.393) (-361.555) (-355.441) [-364.108] * (-352.098) (-352.385) (-357.447) [-353.844] -- 0:00:00
1000 -- (-355.388) (-352.805) [-357.592] (-354.124) * (-354.693) [-353.508] (-355.368) (-354.200) -- 0:00:00
1500 -- (-360.843) (-357.847) [-358.187] (-360.876) * (-357.364) (-353.351) (-351.981) [-353.167] -- 0:00:00
2000 -- [-350.659] (-363.327) (-362.491) (-353.936) * (-356.511) (-355.643) [-353.354] (-351.638) -- 0:00:00
2500 -- (-350.387) (-357.564) (-350.810) [-357.417] * (-358.477) [-349.639] (-361.637) (-354.008) -- 0:06:39
3000 -- (-358.227) [-353.015] (-352.682) (-361.198) * (-355.085) [-351.972] (-361.658) (-359.611) -- 0:05:32
3500 -- [-353.713] (-354.084) (-362.861) (-366.329) * (-358.728) (-351.733) [-356.078] (-355.999) -- 0:04:44
4000 -- (-360.731) (-355.518) (-357.781) [-357.846] * (-363.374) (-363.040) (-361.907) [-354.854] -- 0:04:09
4500 -- (-350.673) [-351.050] (-358.539) (-360.084) * [-355.274] (-358.440) (-350.020) (-352.710) -- 0:03:41
5000 -- (-354.262) [-357.343] (-356.994) (-361.796) * (-355.188) (-355.540) (-361.461) [-353.076] -- 0:03:19
Average standard deviation of split frequencies: 0.092852
5500 -- (-359.947) (-358.245) (-359.522) [-353.473] * (-357.866) [-352.882] (-360.551) (-352.284) -- 0:03:00
6000 -- (-356.546) (-357.450) [-353.926] (-355.876) * (-358.312) (-352.052) (-355.597) [-356.096] -- 0:02:45
6500 -- (-358.905) (-357.121) [-352.296] (-358.677) * (-362.290) (-361.924) [-360.944] (-373.805) -- 0:02:32
7000 -- [-350.622] (-358.003) (-359.293) (-361.613) * (-358.297) (-364.066) [-353.151] (-354.547) -- 0:02:21
7500 -- (-355.593) (-353.543) [-352.507] (-359.958) * (-365.231) (-357.556) (-357.828) [-353.439] -- 0:02:12
8000 -- (-352.961) [-356.479] (-354.032) (-359.213) * (-355.659) (-356.584) [-352.551] (-356.278) -- 0:02:04
8500 -- [-355.513] (-355.098) (-350.802) (-364.256) * (-353.442) (-345.385) (-351.534) [-354.982] -- 0:01:56
9000 -- (-355.476) [-354.305] (-360.467) (-358.152) * (-354.942) (-346.546) [-356.290] (-358.260) -- 0:01:50
9500 -- (-355.054) (-356.175) [-359.660] (-349.528) * (-357.111) [-346.257] (-360.329) (-353.520) -- 0:01:44
10000 -- (-357.320) (-360.755) (-353.913) [-345.072] * (-360.767) [-345.979] (-358.481) (-356.980) -- 0:01:39
Average standard deviation of split frequencies: 0.056821
10500 -- (-352.548) [-358.516] (-364.695) (-344.974) * (-358.648) (-347.542) (-364.111) [-356.319] -- 0:01:34
11000 -- (-360.814) (-361.657) (-366.357) [-346.322] * (-352.094) (-348.701) (-356.814) [-361.925] -- 0:01:29
11500 -- (-359.376) (-357.139) [-353.501] (-352.941) * (-355.299) [-346.022] (-368.719) (-351.033) -- 0:01:25
12000 -- (-357.108) (-371.782) (-355.407) [-346.568] * [-356.737] (-350.086) (-356.712) (-360.537) -- 0:01:22
12500 -- (-366.398) (-371.809) (-354.505) [-347.687] * (-358.163) (-346.326) (-345.786) [-356.422] -- 0:01:19
13000 -- [-346.070] (-371.240) (-356.141) (-347.582) * (-362.636) [-346.564] (-350.412) (-353.903) -- 0:01:15
13500 -- (-345.709) (-367.567) [-352.241] (-348.410) * [-357.824] (-346.471) (-347.193) (-361.030) -- 0:01:13
14000 -- (-344.865) (-366.602) (-362.400) [-346.974] * (-355.415) (-345.661) [-345.285] (-358.195) -- 0:01:10
14500 -- (-351.282) (-358.930) (-365.948) [-350.594] * (-375.198) (-345.022) [-347.335] (-352.606) -- 0:01:07
15000 -- (-348.428) [-357.014] (-357.364) (-347.093) * [-357.619] (-345.661) (-347.229) (-351.804) -- 0:01:05
Average standard deviation of split frequencies: 0.053314
15500 -- (-346.466) (-358.494) (-355.533) [-345.472] * (-354.430) (-346.642) [-346.784] (-354.231) -- 0:01:03
16000 -- [-349.439] (-358.751) (-351.035) (-349.081) * (-363.425) (-346.578) (-347.667) [-354.888] -- 0:01:01
16500 -- (-348.293) (-358.783) [-353.396] (-345.363) * (-362.665) (-346.932) (-347.926) [-357.729] -- 0:00:59
17000 -- (-345.723) (-360.172) [-352.663] (-347.737) * (-359.262) [-352.866] (-346.937) (-353.595) -- 0:00:57
17500 -- (-346.141) [-353.620] (-353.990) (-345.676) * (-348.543) (-346.939) [-346.702] (-360.303) -- 0:01:52
18000 -- (-345.986) [-346.142] (-366.974) (-346.167) * (-347.737) (-349.066) (-348.426) [-351.243] -- 0:01:49
18500 -- (-347.927) (-345.482) (-361.230) [-346.856] * (-349.845) [-346.501] (-345.799) (-354.291) -- 0:01:46
19000 -- (-349.572) (-347.535) [-352.951] (-347.347) * (-346.999) [-346.380] (-350.448) (-360.662) -- 0:01:43
19500 -- (-347.449) (-345.845) (-351.813) [-345.438] * [-348.417] (-348.590) (-345.623) (-358.484) -- 0:01:40
20000 -- (-348.545) [-344.736] (-364.686) (-346.185) * (-347.051) (-348.249) (-348.931) [-358.390] -- 0:01:38
Average standard deviation of split frequencies: 0.044419
20500 -- (-348.833) (-350.987) (-367.630) [-346.127] * [-345.915] (-348.057) (-345.100) (-354.957) -- 0:01:35
21000 -- [-348.430] (-347.118) (-355.795) (-345.183) * [-348.046] (-345.376) (-348.262) (-361.047) -- 0:01:33
21500 -- (-350.117) [-346.677] (-345.090) (-347.573) * (-345.420) [-349.959] (-346.591) (-354.412) -- 0:01:31
22000 -- (-347.331) (-346.901) [-346.484] (-348.445) * (-345.150) (-345.142) (-346.743) [-348.738] -- 0:01:28
22500 -- (-347.650) (-344.536) (-346.270) [-346.557] * [-346.772] (-348.712) (-349.870) (-357.272) -- 0:01:26
23000 -- (-346.106) [-348.706] (-346.310) (-345.526) * (-348.616) (-346.870) [-345.905] (-348.751) -- 0:01:24
23500 -- [-345.766] (-346.873) (-345.916) (-347.519) * (-346.493) [-346.486] (-344.826) (-355.848) -- 0:01:23
24000 -- (-345.839) [-345.913] (-345.351) (-345.888) * (-351.760) [-344.605] (-346.120) (-352.150) -- 0:01:21
24500 -- (-351.843) (-349.319) [-349.713] (-347.543) * (-348.440) (-347.111) [-346.059] (-357.641) -- 0:01:19
25000 -- (-351.488) [-346.452] (-347.066) (-347.619) * [-348.088] (-345.321) (-347.681) (-358.351) -- 0:01:18
Average standard deviation of split frequencies: 0.042608
25500 -- (-345.384) (-347.075) [-345.929] (-347.646) * (-344.639) (-348.214) (-346.360) [-349.309] -- 0:01:16
26000 -- (-345.664) (-351.005) (-345.878) [-347.790] * (-351.107) [-345.730] (-346.480) (-352.521) -- 0:01:14
26500 -- (-344.775) (-346.762) [-345.377] (-345.984) * [-347.268] (-345.614) (-345.934) (-357.531) -- 0:01:13
27000 -- (-345.339) (-345.637) [-346.060] (-345.230) * [-346.924] (-345.680) (-344.955) (-360.090) -- 0:01:12
27500 -- (-347.038) [-346.013] (-349.054) (-346.128) * (-347.372) (-345.174) [-346.137] (-362.245) -- 0:01:10
28000 -- (-345.838) (-346.806) [-346.749] (-350.597) * (-346.818) [-345.957] (-352.560) (-361.341) -- 0:01:09
28500 -- [-347.927] (-344.978) (-347.947) (-347.855) * (-347.172) (-346.952) (-345.606) [-349.365] -- 0:01:08
29000 -- [-346.833] (-346.213) (-346.658) (-345.851) * (-346.575) (-345.637) [-347.345] (-355.629) -- 0:01:06
29500 -- (-349.256) (-345.938) (-347.491) [-348.628] * [-346.262] (-345.339) (-346.097) (-359.906) -- 0:01:05
30000 -- (-349.773) (-347.029) [-346.181] (-350.063) * (-345.254) (-347.824) (-348.144) [-352.323] -- 0:01:04
Average standard deviation of split frequencies: 0.031598
30500 -- (-348.047) (-345.673) [-345.059] (-352.630) * (-345.209) (-346.413) [-345.993] (-361.129) -- 0:01:35
31000 -- (-348.720) [-346.417] (-353.103) (-353.432) * (-348.384) [-345.819] (-345.728) (-356.444) -- 0:01:33
31500 -- (-347.986) [-346.644] (-349.298) (-347.538) * (-348.457) [-345.730] (-346.407) (-355.083) -- 0:01:32
32000 -- (-347.086) (-349.134) [-346.779] (-346.133) * (-346.532) [-345.089] (-345.745) (-353.273) -- 0:01:30
32500 -- (-345.099) (-345.770) [-345.398] (-346.732) * (-345.783) (-345.334) (-348.099) [-354.057] -- 0:01:29
33000 -- (-344.995) (-345.055) (-346.456) [-347.447] * (-348.756) [-347.038] (-347.435) (-356.330) -- 0:01:27
33500 -- (-349.759) (-347.083) (-345.434) [-350.692] * [-346.511] (-346.105) (-344.898) (-362.158) -- 0:01:26
34000 -- [-346.876] (-345.775) (-346.940) (-346.023) * (-348.094) (-346.007) (-345.602) [-350.282] -- 0:01:25
34500 -- (-346.157) (-347.822) (-347.348) [-344.890] * [-346.898] (-344.702) (-348.429) (-361.740) -- 0:01:23
35000 -- [-346.464] (-346.235) (-346.941) (-345.518) * [-346.136] (-345.037) (-344.625) (-355.433) -- 0:01:22
Average standard deviation of split frequencies: 0.032736
35500 -- [-346.267] (-348.297) (-346.578) (-346.154) * (-348.413) [-345.644] (-347.515) (-365.369) -- 0:01:21
36000 -- (-346.755) (-347.345) [-345.490] (-346.822) * [-346.616] (-346.802) (-346.785) (-359.176) -- 0:01:20
36500 -- (-346.280) (-354.628) (-346.900) [-348.166] * (-345.899) [-345.123] (-347.153) (-366.849) -- 0:01:19
37000 -- (-348.299) (-348.353) [-349.727] (-347.147) * (-347.412) [-344.947] (-346.028) (-359.033) -- 0:01:18
37500 -- (-347.546) (-346.552) (-347.689) [-344.893] * (-347.574) [-344.976] (-348.856) (-349.634) -- 0:01:17
38000 -- (-347.389) [-347.960] (-350.228) (-350.676) * (-346.139) (-348.683) (-344.892) [-348.329] -- 0:01:15
38500 -- [-345.839] (-346.783) (-347.124) (-349.418) * (-345.038) [-345.655] (-347.982) (-345.955) -- 0:01:14
39000 -- (-345.438) (-345.678) (-348.117) [-349.107] * [-345.411] (-346.561) (-345.557) (-345.834) -- 0:01:13
39500 -- (-348.263) (-345.409) [-345.639] (-345.939) * (-349.403) (-347.708) [-348.181] (-348.091) -- 0:01:12
40000 -- (-348.792) (-346.642) (-349.717) [-346.458] * (-351.099) (-346.737) (-346.560) [-348.569] -- 0:01:12
Average standard deviation of split frequencies: 0.034094
40500 -- (-351.020) (-350.410) (-345.106) [-345.523] * (-345.584) (-347.813) [-345.812] (-346.112) -- 0:01:11
41000 -- (-350.716) (-352.678) [-350.763] (-344.788) * (-346.666) [-346.104] (-346.335) (-351.781) -- 0:01:10
41500 -- (-350.408) (-352.023) [-346.691] (-345.784) * [-349.255] (-351.209) (-345.585) (-348.006) -- 0:01:09
42000 -- (-345.666) [-347.775] (-349.973) (-345.288) * (-346.569) (-348.642) [-345.338] (-345.369) -- 0:01:08
42500 -- (-345.083) [-345.819] (-345.910) (-346.344) * (-346.736) (-353.347) (-347.198) [-348.113] -- 0:01:07
43000 -- [-345.562] (-346.565) (-344.704) (-349.443) * (-345.950) (-349.130) (-345.062) [-349.158] -- 0:01:06
43500 -- [-345.406] (-346.202) (-346.320) (-348.573) * (-346.122) (-347.106) (-346.635) [-345.708] -- 0:01:05
44000 -- (-348.456) (-345.503) (-346.084) [-346.331] * (-346.549) (-345.115) [-345.940] (-347.406) -- 0:01:05
44500 -- (-347.496) (-344.942) (-346.433) [-346.221] * [-348.157] (-346.818) (-348.714) (-345.808) -- 0:01:04
45000 -- (-349.148) (-346.645) (-346.307) [-345.630] * (-344.487) (-349.019) (-352.528) [-345.540] -- 0:01:03
Average standard deviation of split frequencies: 0.036091
45500 -- (-352.389) (-347.893) (-345.622) [-345.718] * (-344.855) (-346.939) (-346.283) [-344.650] -- 0:01:02
46000 -- (-345.262) (-348.494) [-348.143] (-348.129) * (-346.024) (-345.028) [-344.710] (-345.827) -- 0:01:02
46500 -- (-346.095) (-345.843) [-345.120] (-347.864) * (-345.865) (-348.500) [-347.684] (-346.797) -- 0:01:01
47000 -- (-346.538) [-350.186] (-345.162) (-348.130) * (-345.565) (-347.090) [-345.179] (-346.107) -- 0:01:00
47500 -- (-345.346) (-347.450) [-346.640] (-349.400) * (-347.049) (-352.051) (-347.257) [-346.039] -- 0:01:00
48000 -- (-346.174) [-351.394] (-346.723) (-345.290) * (-349.184) (-351.353) [-346.549] (-347.206) -- 0:01:19
48500 -- (-349.343) (-348.465) (-346.358) [-346.645] * [-350.995] (-350.885) (-347.395) (-346.267) -- 0:01:18
49000 -- (-346.922) (-347.057) (-350.602) [-346.280] * [-346.734] (-345.668) (-345.106) (-347.838) -- 0:01:17
49500 -- (-347.540) [-349.927] (-346.584) (-348.643) * (-345.254) [-345.928] (-345.172) (-347.191) -- 0:01:16
50000 -- (-348.343) (-350.238) (-346.119) [-348.177] * (-351.868) (-347.727) (-345.629) [-347.258] -- 0:01:16
Average standard deviation of split frequencies: 0.031295
50500 -- [-347.296] (-348.345) (-345.119) (-346.355) * (-348.129) [-350.163] (-344.839) (-346.000) -- 0:01:15
51000 -- (-345.004) (-345.307) (-347.163) [-348.533] * (-347.201) [-346.491] (-350.532) (-345.482) -- 0:01:14
51500 -- (-347.279) [-346.484] (-345.466) (-350.986) * (-346.666) (-350.282) (-350.102) [-345.193] -- 0:01:13
52000 -- (-345.163) (-347.783) (-348.153) [-345.502] * (-344.577) [-345.841] (-348.240) (-345.458) -- 0:01:12
52500 -- (-353.236) (-346.912) (-353.492) [-344.900] * (-350.849) (-347.451) (-347.708) [-344.743] -- 0:01:12
53000 -- (-346.046) (-346.620) [-346.912] (-350.780) * (-347.425) [-345.739] (-348.748) (-348.329) -- 0:01:11
53500 -- (-345.528) [-351.395] (-349.273) (-345.667) * (-348.008) [-347.873] (-346.828) (-346.344) -- 0:01:10
54000 -- (-346.625) (-348.230) (-346.171) [-348.678] * (-346.786) [-345.812] (-346.679) (-347.660) -- 0:01:10
54500 -- (-346.295) [-349.051] (-345.779) (-346.069) * (-345.957) (-345.791) [-347.251] (-346.284) -- 0:01:09
55000 -- (-345.924) (-349.624) (-345.086) [-346.970] * (-347.347) [-344.516] (-345.116) (-345.193) -- 0:01:08
Average standard deviation of split frequencies: 0.032906
55500 -- [-344.772] (-348.966) (-347.016) (-348.403) * (-348.847) (-346.008) (-347.388) [-346.767] -- 0:01:08
56000 -- [-345.918] (-346.309) (-346.328) (-347.964) * [-345.698] (-346.638) (-344.975) (-346.641) -- 0:01:07
56500 -- (-344.549) [-348.975] (-346.625) (-345.348) * (-347.035) (-345.512) (-344.718) [-348.435] -- 0:01:06
57000 -- (-347.507) (-346.255) (-346.300) [-345.503] * [-345.465] (-355.091) (-345.551) (-352.239) -- 0:01:06
57500 -- [-344.882] (-348.259) (-345.154) (-345.523) * [-345.436] (-348.679) (-344.812) (-350.222) -- 0:01:05
58000 -- (-348.512) (-344.989) [-347.833] (-345.630) * (-345.097) (-347.021) (-352.033) [-347.482] -- 0:01:04
58500 -- (-347.041) [-347.022] (-348.689) (-347.510) * (-348.267) (-347.263) (-353.081) [-345.455] -- 0:01:04
59000 -- [-346.780] (-345.543) (-349.626) (-346.382) * [-350.719] (-354.600) (-350.183) (-345.472) -- 0:01:03
59500 -- (-346.105) [-346.174] (-347.902) (-348.896) * [-348.028] (-353.810) (-348.844) (-346.642) -- 0:01:03
60000 -- (-348.125) [-344.863] (-352.145) (-345.948) * [-344.604] (-354.261) (-345.313) (-345.307) -- 0:01:02
Average standard deviation of split frequencies: 0.032141
60500 -- (-347.215) [-346.415] (-356.059) (-344.976) * (-345.280) (-350.091) (-347.456) [-346.196] -- 0:01:02
61000 -- (-345.988) [-347.547] (-346.299) (-345.970) * (-346.686) (-348.592) (-345.369) [-347.584] -- 0:01:01
61500 -- (-347.134) (-350.610) (-351.291) [-345.264] * (-347.078) (-346.405) (-346.024) [-346.609] -- 0:01:01
62000 -- (-346.451) (-348.511) [-344.767] (-351.180) * (-347.713) [-345.002] (-344.609) (-349.273) -- 0:01:00
62500 -- (-345.572) (-346.735) (-345.613) [-347.820] * (-348.883) (-346.115) [-345.936] (-348.129) -- 0:01:00
63000 -- (-346.997) (-345.254) [-348.079] (-346.043) * [-347.496] (-347.697) (-346.812) (-346.978) -- 0:00:59
63500 -- [-347.545] (-345.761) (-348.189) (-345.609) * (-350.023) (-348.438) (-345.408) [-346.920] -- 0:00:58
64000 -- [-345.814] (-346.078) (-346.665) (-349.704) * (-345.201) (-347.320) (-346.266) [-346.107] -- 0:00:58
64500 -- (-348.514) [-345.086] (-346.820) (-346.623) * (-347.551) (-349.670) [-346.246] (-352.062) -- 0:00:58
65000 -- (-347.180) (-346.377) (-346.821) [-347.229] * (-348.631) (-347.044) [-346.075] (-349.383) -- 0:01:11
Average standard deviation of split frequencies: 0.036037
65500 -- (-345.257) [-346.019] (-346.953) (-350.589) * (-347.421) (-349.887) (-345.742) [-347.501] -- 0:01:11
66000 -- (-347.131) (-347.478) [-346.182] (-348.156) * (-345.459) (-348.642) [-346.770] (-346.189) -- 0:01:10
66500 -- (-347.520) (-347.146) (-345.711) [-350.856] * (-345.606) (-345.717) [-347.321] (-345.667) -- 0:01:10
67000 -- (-349.366) (-345.045) [-345.716] (-345.708) * (-346.293) (-348.253) (-345.777) [-347.354] -- 0:01:09
67500 -- (-346.058) [-345.188] (-347.346) (-345.641) * (-348.552) [-346.331] (-347.011) (-348.890) -- 0:01:09
68000 -- (-345.764) (-346.360) (-348.352) [-346.969] * (-347.087) (-348.332) (-346.540) [-346.301] -- 0:01:08
68500 -- [-348.201] (-345.876) (-347.221) (-350.623) * (-346.287) (-350.328) (-345.052) [-349.002] -- 0:01:07
69000 -- [-345.510] (-345.345) (-347.563) (-346.245) * (-346.219) (-351.284) [-346.335] (-345.348) -- 0:01:07
69500 -- (-346.302) (-346.782) (-345.295) [-344.885] * (-345.737) (-350.399) (-347.450) [-345.056] -- 0:01:06
70000 -- (-345.728) [-346.164] (-346.109) (-347.046) * (-346.143) (-346.248) [-348.924] (-353.429) -- 0:01:06
Average standard deviation of split frequencies: 0.037357
70500 -- (-348.003) [-344.800] (-350.219) (-346.497) * (-349.571) (-346.214) [-349.414] (-344.880) -- 0:01:05
71000 -- (-351.776) [-347.820] (-345.962) (-350.898) * (-349.203) (-347.588) [-349.051] (-345.293) -- 0:01:05
71500 -- (-348.650) (-347.955) [-347.932] (-345.306) * [-345.631] (-348.651) (-347.309) (-345.763) -- 0:01:04
72000 -- (-351.025) (-346.548) [-346.924] (-347.185) * (-346.886) (-351.418) (-347.214) [-344.791] -- 0:01:04
72500 -- [-346.599] (-345.815) (-345.550) (-345.699) * (-346.823) (-345.926) [-349.798] (-348.344) -- 0:01:03
73000 -- (-346.853) (-348.020) [-345.950] (-346.218) * (-348.065) (-345.550) [-348.783] (-345.921) -- 0:01:03
73500 -- (-347.626) (-346.020) [-344.940] (-353.280) * (-348.250) (-348.285) [-345.600] (-347.353) -- 0:01:03
74000 -- [-345.855] (-346.299) (-349.878) (-349.497) * (-346.294) (-345.391) (-345.978) [-346.129] -- 0:01:02
74500 -- (-351.780) (-345.732) (-345.342) [-347.460] * (-348.375) [-346.557] (-347.828) (-346.692) -- 0:01:02
75000 -- [-347.653] (-345.670) (-345.585) (-347.780) * [-344.785] (-347.768) (-349.582) (-345.851) -- 0:01:01
Average standard deviation of split frequencies: 0.039077
75500 -- [-345.664] (-346.738) (-346.255) (-351.836) * (-348.467) (-349.895) (-347.967) [-345.474] -- 0:01:01
76000 -- [-347.971] (-347.200) (-346.673) (-349.700) * (-349.557) (-348.330) [-346.601] (-347.916) -- 0:01:00
76500 -- (-348.083) (-350.760) [-346.329] (-349.152) * [-348.047] (-346.941) (-346.274) (-346.835) -- 0:01:00
77000 -- (-345.990) (-346.680) [-346.662] (-348.330) * (-350.952) [-345.594] (-346.873) (-345.294) -- 0:00:59
77500 -- (-352.293) [-347.338] (-346.767) (-346.151) * (-345.230) (-346.966) (-344.523) [-345.603] -- 0:00:59
78000 -- (-345.857) (-345.145) (-348.458) [-346.316] * (-350.032) (-347.183) [-346.179] (-346.564) -- 0:00:59
78500 -- (-344.898) (-344.946) (-352.057) [-345.389] * (-351.021) (-345.734) (-346.794) [-345.826] -- 0:00:58
79000 -- (-345.775) (-345.796) (-346.944) [-346.231] * (-349.641) [-345.558] (-345.651) (-347.181) -- 0:00:58
79500 -- (-346.018) (-345.938) (-345.180) [-347.845] * (-346.503) [-345.249] (-347.060) (-349.690) -- 0:00:57
80000 -- (-345.123) (-344.955) (-344.742) [-345.797] * (-344.981) (-347.257) [-347.488] (-345.081) -- 0:00:57
Average standard deviation of split frequencies: 0.039237
80500 -- (-348.938) (-346.789) [-346.483] (-345.715) * (-348.384) (-349.090) [-345.323] (-345.208) -- 0:00:57
81000 -- (-347.223) (-347.061) [-347.480] (-346.876) * [-346.553] (-344.707) (-346.786) (-352.244) -- 0:00:56
81500 -- (-346.839) (-348.369) (-344.668) [-345.216] * (-349.035) (-345.948) (-345.694) [-350.097] -- 0:00:56
82000 -- (-344.964) (-352.988) [-345.381] (-346.437) * [-346.495] (-346.955) (-345.055) (-348.422) -- 0:01:07
82500 -- (-345.557) [-350.595] (-347.485) (-344.972) * (-347.958) (-346.126) (-346.027) [-345.215] -- 0:01:06
83000 -- (-346.008) (-345.961) [-350.353] (-345.467) * (-346.712) (-351.568) (-345.607) [-346.837] -- 0:01:06
83500 -- (-344.432) (-348.270) [-345.513] (-348.157) * (-345.326) (-345.291) [-345.406] (-348.384) -- 0:01:05
84000 -- (-346.960) (-345.560) [-345.406] (-347.033) * (-344.457) (-345.150) [-346.237] (-347.791) -- 0:01:05
84500 -- [-346.863] (-345.005) (-349.039) (-346.856) * (-346.273) (-345.573) (-346.476) [-347.769] -- 0:01:05
85000 -- [-346.240] (-346.229) (-344.735) (-352.402) * (-345.022) (-346.727) [-346.210] (-347.826) -- 0:01:04
Average standard deviation of split frequencies: 0.033574
85500 -- (-347.132) (-347.990) (-346.357) [-350.624] * (-346.018) (-345.669) [-348.648] (-351.179) -- 0:01:04
86000 -- [-345.320] (-349.853) (-347.856) (-349.155) * (-346.825) (-350.058) (-348.034) [-347.666] -- 0:01:03
86500 -- [-345.890] (-349.105) (-346.236) (-345.938) * (-345.620) (-346.728) (-346.172) [-344.804] -- 0:01:03
87000 -- [-345.310] (-348.714) (-346.678) (-346.570) * (-346.047) (-347.864) (-349.435) [-345.682] -- 0:01:02
87500 -- (-345.579) (-348.877) (-347.399) [-345.345] * [-346.959] (-347.775) (-351.674) (-348.602) -- 0:01:02
88000 -- (-347.306) (-345.904) (-346.329) [-346.914] * (-347.060) (-346.757) [-345.414] (-348.160) -- 0:01:02
88500 -- [-347.686] (-348.485) (-346.593) (-344.579) * (-347.713) [-349.898] (-348.180) (-351.096) -- 0:01:01
89000 -- [-345.997] (-348.502) (-346.805) (-345.034) * [-346.067] (-345.043) (-346.989) (-346.548) -- 0:01:01
89500 -- (-345.993) (-351.282) (-344.937) [-346.405] * (-346.570) (-344.857) (-349.809) [-346.643] -- 0:01:01
90000 -- (-347.619) (-345.953) (-347.937) [-346.119] * (-346.779) [-348.530] (-347.829) (-348.998) -- 0:01:00
Average standard deviation of split frequencies: 0.033796
90500 -- (-346.371) (-346.340) (-346.537) [-346.040] * (-346.636) [-348.089] (-345.622) (-348.157) -- 0:01:00
91000 -- [-346.634] (-345.005) (-346.919) (-348.676) * (-345.894) [-346.298] (-349.392) (-353.786) -- 0:00:59
91500 -- (-351.851) (-352.039) [-347.518] (-344.614) * [-352.617] (-346.862) (-347.330) (-350.438) -- 0:00:59
92000 -- (-345.280) (-345.465) (-347.785) [-344.970] * (-345.916) (-349.000) (-346.271) [-346.183] -- 0:00:59
92500 -- (-348.480) [-348.260] (-347.088) (-348.567) * (-352.633) (-349.287) (-347.887) [-345.421] -- 0:00:58
93000 -- [-345.547] (-348.786) (-345.899) (-348.185) * (-348.511) (-346.331) (-347.490) [-345.853] -- 0:00:58
93500 -- [-345.307] (-346.625) (-348.989) (-351.767) * [-349.210] (-345.978) (-345.572) (-347.175) -- 0:00:58
94000 -- (-346.934) (-345.211) [-347.076] (-346.865) * (-345.548) [-347.206] (-346.132) (-349.292) -- 0:00:57
94500 -- (-344.984) (-345.227) [-347.158] (-349.205) * (-347.062) (-348.697) [-345.800] (-344.883) -- 0:00:57
95000 -- (-347.236) [-347.350] (-346.396) (-344.888) * (-347.686) (-345.482) (-347.132) [-344.906] -- 0:00:57
Average standard deviation of split frequencies: 0.034373
95500 -- [-345.571] (-347.619) (-347.326) (-345.582) * (-345.435) (-346.089) (-348.293) [-347.378] -- 0:00:56
96000 -- [-345.147] (-347.370) (-346.486) (-347.536) * (-352.717) [-345.785] (-345.208) (-347.605) -- 0:00:56
96500 -- (-347.381) (-345.024) (-345.490) [-346.908] * [-351.086] (-345.773) (-345.962) (-351.172) -- 0:00:56
97000 -- (-346.699) (-347.151) (-345.984) [-349.847] * (-345.758) (-345.313) [-346.375] (-348.588) -- 0:00:55
97500 -- (-345.889) (-346.353) [-346.052] (-346.727) * [-345.830] (-345.333) (-344.972) (-348.790) -- 0:00:55
98000 -- [-345.944] (-345.989) (-349.436) (-345.328) * (-345.130) [-345.260] (-348.621) (-346.508) -- 0:00:55
98500 -- (-346.377) (-345.910) [-348.954] (-344.807) * (-346.584) [-344.781] (-347.302) (-344.609) -- 0:00:54
99000 -- [-346.299] (-348.906) (-346.694) (-346.298) * (-346.841) (-346.978) [-346.579] (-344.795) -- 0:01:03
99500 -- (-345.793) (-345.172) (-347.035) [-346.738] * [-345.936] (-346.051) (-344.886) (-345.046) -- 0:01:03
100000 -- (-350.353) [-345.148] (-347.585) (-345.865) * [-346.575] (-345.966) (-346.812) (-349.281) -- 0:01:02
Average standard deviation of split frequencies: 0.033170
100500 -- (-346.584) [-348.395] (-350.100) (-347.634) * (-345.141) [-345.484] (-348.482) (-347.465) -- 0:01:02
101000 -- (-346.091) (-347.424) [-350.528] (-344.869) * (-344.790) (-345.316) (-348.007) [-347.326] -- 0:01:02
101500 -- (-346.339) (-349.443) [-345.180] (-347.013) * (-345.768) [-347.929] (-346.236) (-347.804) -- 0:01:01
102000 -- (-346.564) [-346.966] (-347.864) (-345.975) * (-346.431) (-346.295) [-347.033] (-348.337) -- 0:01:01
102500 -- (-349.759) (-346.364) (-344.656) [-348.025] * (-344.833) (-345.719) (-345.635) [-348.882] -- 0:01:01
103000 -- (-351.667) (-345.708) (-345.713) [-346.963] * (-347.278) (-345.687) [-344.697] (-346.611) -- 0:01:00
103500 -- [-347.248] (-345.458) (-345.568) (-347.092) * [-345.393] (-348.578) (-345.841) (-347.735) -- 0:01:00
104000 -- [-348.008] (-345.981) (-345.548) (-347.335) * (-345.329) (-347.114) [-345.820] (-349.614) -- 0:01:00
104500 -- (-344.633) (-348.894) (-346.974) [-348.669] * (-345.491) [-348.707] (-346.546) (-347.932) -- 0:00:59
105000 -- (-344.429) (-346.344) [-346.389] (-349.840) * (-346.413) (-350.817) [-345.704] (-347.145) -- 0:00:59
Average standard deviation of split frequencies: 0.031686
105500 -- [-345.808] (-345.146) (-345.746) (-346.961) * (-347.067) (-349.388) [-346.450] (-345.819) -- 0:00:59
106000 -- (-344.459) (-348.041) [-346.266] (-348.647) * (-348.809) (-345.933) (-346.025) [-347.637] -- 0:00:59
106500 -- (-344.334) (-349.382) (-347.140) [-348.757] * (-346.311) (-349.038) (-346.025) [-345.925] -- 0:00:58
107000 -- [-346.311] (-349.891) (-349.688) (-348.533) * (-347.428) [-346.308] (-347.574) (-347.741) -- 0:00:58
107500 -- [-345.177] (-345.899) (-353.441) (-346.428) * (-345.458) (-346.310) [-348.472] (-346.000) -- 0:00:58
108000 -- [-351.008] (-345.450) (-350.359) (-345.973) * (-347.120) [-344.859] (-345.885) (-346.979) -- 0:00:57
108500 -- (-346.112) [-345.314] (-352.264) (-346.707) * (-345.381) [-349.613] (-344.310) (-347.777) -- 0:00:57
109000 -- (-347.078) (-346.037) [-354.634] (-347.927) * (-346.287) (-347.518) [-348.697] (-346.090) -- 0:00:57
109500 -- (-346.275) (-346.492) (-357.638) [-346.341] * (-347.531) (-348.264) [-347.241] (-345.631) -- 0:00:56
110000 -- [-347.334] (-347.822) (-350.051) (-348.695) * (-347.839) (-345.278) [-348.341] (-348.971) -- 0:00:56
Average standard deviation of split frequencies: 0.032303
110500 -- [-345.963] (-348.291) (-348.695) (-346.965) * (-346.906) (-346.467) [-346.996] (-346.742) -- 0:00:56
111000 -- (-346.614) [-345.243] (-350.279) (-346.833) * (-344.982) (-345.712) [-347.769] (-345.554) -- 0:00:56
111500 -- (-347.924) (-345.314) (-347.190) [-345.593] * (-346.683) (-345.933) [-347.207] (-347.784) -- 0:00:55
112000 -- (-349.937) [-345.243] (-346.298) (-345.956) * (-344.614) (-346.433) (-346.334) [-345.676] -- 0:00:55
112500 -- (-347.139) (-345.866) [-346.016] (-346.565) * [-345.386] (-349.210) (-351.448) (-345.202) -- 0:00:55
113000 -- [-348.295] (-345.919) (-345.897) (-349.594) * [-346.827] (-344.889) (-348.020) (-345.462) -- 0:00:54
113500 -- (-349.123) [-346.312] (-345.262) (-347.919) * (-349.793) (-346.043) [-345.596] (-350.457) -- 0:00:54
114000 -- (-344.961) (-347.530) [-347.530] (-354.383) * [-348.896] (-347.692) (-350.298) (-350.986) -- 0:00:54
114500 -- (-346.187) [-347.573] (-347.028) (-344.924) * (-346.434) [-345.358] (-350.114) (-351.187) -- 0:00:54
115000 -- (-346.379) (-346.335) (-348.679) [-345.590] * (-344.886) [-346.484] (-347.583) (-346.487) -- 0:00:53
Average standard deviation of split frequencies: 0.029971
115500 -- (-345.568) [-344.687] (-351.165) (-345.151) * (-351.336) (-346.420) [-348.722] (-345.186) -- 0:00:53
116000 -- (-344.766) (-347.641) [-346.057] (-349.219) * (-346.987) (-346.142) (-349.220) [-346.526] -- 0:01:00
116500 -- (-348.877) [-344.710] (-345.113) (-345.308) * [-346.656] (-347.542) (-347.398) (-345.322) -- 0:01:00
117000 -- (-351.570) [-345.427] (-345.317) (-346.410) * (-349.517) [-344.637] (-345.453) (-344.695) -- 0:01:00
117500 -- (-348.364) (-347.560) (-345.123) [-349.127] * (-344.991) (-351.024) (-345.942) [-347.753] -- 0:01:00
118000 -- (-346.575) (-348.417) (-348.114) [-348.725] * (-344.522) (-344.542) [-345.915] (-346.310) -- 0:00:59
118500 -- (-347.162) (-345.858) [-350.312] (-351.892) * (-351.131) [-347.416] (-345.549) (-346.070) -- 0:00:59
119000 -- [-345.846] (-345.577) (-349.129) (-344.997) * (-345.802) (-345.364) [-346.514] (-345.246) -- 0:00:59
119500 -- (-347.042) (-346.474) (-345.972) [-345.054] * (-345.823) [-347.186] (-345.224) (-345.113) -- 0:00:58
120000 -- (-351.744) (-346.800) (-345.463) [-345.023] * (-345.107) (-348.744) [-346.781] (-345.795) -- 0:00:58
Average standard deviation of split frequencies: 0.029300
120500 -- (-348.506) [-347.921] (-345.379) (-347.367) * (-346.384) (-347.593) [-345.976] (-347.955) -- 0:00:58
121000 -- (-346.964) (-344.836) [-345.702] (-346.401) * (-345.811) [-347.142] (-345.868) (-348.195) -- 0:00:58
121500 -- (-346.614) [-347.849] (-346.773) (-346.361) * (-345.751) [-346.482] (-344.673) (-347.033) -- 0:00:57
122000 -- (-344.697) [-346.405] (-350.270) (-346.990) * (-348.566) [-345.689] (-346.361) (-348.061) -- 0:00:57
122500 -- [-345.523] (-346.159) (-346.992) (-345.975) * [-348.412] (-344.919) (-345.457) (-346.186) -- 0:00:57
123000 -- (-346.782) (-348.055) [-348.262] (-346.404) * [-345.624] (-349.107) (-346.086) (-346.735) -- 0:00:57
123500 -- (-347.690) (-346.541) [-348.815] (-345.338) * (-345.976) [-347.290] (-346.599) (-346.560) -- 0:00:56
124000 -- (-349.163) (-345.668) [-347.050] (-350.124) * (-346.825) (-345.544) [-344.942] (-345.934) -- 0:00:56
124500 -- (-347.512) [-346.619] (-344.922) (-346.397) * (-345.718) (-348.354) [-347.453] (-346.491) -- 0:00:56
125000 -- [-346.542] (-346.426) (-345.816) (-345.747) * [-347.200] (-349.913) (-347.445) (-347.831) -- 0:00:56
Average standard deviation of split frequencies: 0.027328
125500 -- (-346.416) (-345.758) [-346.051] (-345.440) * (-346.554) (-347.153) [-345.855] (-349.446) -- 0:00:55
126000 -- [-346.732] (-349.496) (-347.159) (-344.934) * (-347.392) [-345.912] (-348.433) (-346.528) -- 0:00:55
126500 -- (-346.609) [-344.781] (-349.811) (-346.116) * (-345.739) [-346.901] (-346.645) (-345.154) -- 0:00:55
127000 -- [-345.213] (-348.644) (-347.615) (-345.314) * (-350.921) [-346.156] (-348.596) (-344.971) -- 0:00:54
127500 -- (-345.602) (-348.043) [-349.176] (-345.886) * (-348.315) (-349.562) [-346.849] (-347.078) -- 0:00:54
128000 -- (-345.502) (-347.588) (-345.469) [-346.355] * (-345.883) (-347.998) [-346.715] (-351.102) -- 0:00:54
128500 -- (-347.776) (-348.841) [-345.260] (-344.587) * [-351.193] (-344.803) (-344.820) (-346.865) -- 0:00:54
129000 -- (-346.362) (-347.665) [-345.943] (-346.520) * (-350.375) [-347.688] (-346.872) (-348.404) -- 0:00:54
129500 -- (-345.505) (-347.950) [-345.452] (-350.268) * [-347.885] (-345.968) (-347.555) (-345.445) -- 0:00:53
130000 -- (-347.521) (-346.046) [-347.934] (-347.066) * (-348.344) (-347.927) (-345.027) [-350.335] -- 0:00:53
Average standard deviation of split frequencies: 0.023122
130500 -- (-345.472) (-349.216) (-349.034) [-347.373] * [-345.551] (-347.605) (-348.666) (-345.062) -- 0:00:53
131000 -- (-345.119) [-344.974] (-347.012) (-345.113) * (-346.531) (-349.829) [-347.184] (-350.275) -- 0:00:53
131500 -- (-345.422) [-346.296] (-346.119) (-345.996) * [-346.855] (-346.415) (-345.486) (-348.020) -- 0:00:52
132000 -- [-346.317] (-346.550) (-346.746) (-346.906) * (-350.425) (-346.765) [-345.510] (-347.411) -- 0:00:52
132500 -- [-347.577] (-348.013) (-346.622) (-345.985) * (-347.369) (-347.738) (-350.702) [-345.840] -- 0:00:52
133000 -- (-345.597) (-351.274) (-347.466) [-348.100] * [-347.761] (-350.664) (-344.570) (-345.417) -- 0:00:58
133500 -- [-346.744] (-348.568) (-347.707) (-349.945) * (-348.131) (-349.309) [-346.661] (-345.983) -- 0:00:58
134000 -- (-346.159) (-347.213) [-346.415] (-348.197) * (-349.784) [-349.381] (-350.603) (-346.183) -- 0:00:58
134500 -- (-345.154) (-346.661) [-350.469] (-347.743) * (-350.924) (-346.637) (-348.936) [-346.511] -- 0:00:57
135000 -- (-345.873) (-347.117) [-344.915] (-346.847) * (-345.554) (-348.196) [-346.325] (-347.326) -- 0:00:57
Average standard deviation of split frequencies: 0.024421
135500 -- (-346.505) (-346.588) (-345.961) [-345.380] * (-346.641) (-348.544) (-345.643) [-348.452] -- 0:00:57
136000 -- (-347.572) (-345.950) (-348.750) [-345.023] * (-348.138) [-346.173] (-350.109) (-347.085) -- 0:00:57
136500 -- (-346.244) (-346.440) [-345.180] (-348.366) * (-347.919) (-348.027) (-346.729) [-347.224] -- 0:00:56
137000 -- (-346.846) (-346.409) (-347.117) [-345.250] * (-345.518) [-347.105] (-347.812) (-346.556) -- 0:00:56
137500 -- (-345.165) [-345.000] (-348.686) (-346.156) * [-346.427] (-345.084) (-348.178) (-349.283) -- 0:00:56
138000 -- [-346.551] (-346.958) (-346.206) (-348.352) * [-345.903] (-347.393) (-349.896) (-346.763) -- 0:00:56
138500 -- (-348.123) (-346.006) (-346.382) [-346.887] * (-345.563) [-347.061] (-345.720) (-347.087) -- 0:00:55
139000 -- (-344.848) (-348.741) (-349.726) [-345.516] * (-345.180) (-347.808) [-345.751] (-348.665) -- 0:00:55
139500 -- (-346.748) (-348.007) [-344.867] (-351.390) * (-345.322) (-348.436) (-344.812) [-345.990] -- 0:00:55
140000 -- (-350.766) [-345.777] (-344.762) (-346.319) * (-347.084) [-347.100] (-346.222) (-347.407) -- 0:00:55
Average standard deviation of split frequencies: 0.024677
140500 -- (-348.987) [-346.019] (-345.770) (-345.918) * (-349.484) (-346.195) (-349.485) [-347.746] -- 0:00:55
141000 -- (-347.562) (-346.353) (-344.976) [-346.101] * (-346.133) [-347.123] (-354.607) (-345.564) -- 0:00:54
141500 -- (-349.593) (-348.599) [-344.881] (-349.934) * (-346.116) (-348.503) (-345.359) [-346.035] -- 0:00:54
142000 -- (-348.346) (-344.930) (-345.059) [-346.934] * [-349.708] (-346.632) (-345.521) (-348.836) -- 0:00:54
142500 -- (-346.925) [-346.993] (-346.687) (-346.093) * (-347.863) [-347.306] (-351.896) (-345.609) -- 0:00:54
143000 -- (-348.122) (-346.668) (-348.460) [-345.875] * (-347.660) (-348.190) (-346.347) [-350.093] -- 0:00:53
143500 -- (-347.444) (-348.326) [-345.381] (-348.079) * [-345.632] (-348.379) (-349.397) (-348.573) -- 0:00:53
144000 -- (-347.106) (-348.134) [-346.657] (-345.945) * (-345.469) (-345.624) (-345.593) [-345.166] -- 0:00:53
144500 -- (-345.381) [-347.830] (-347.507) (-345.049) * [-348.861] (-346.143) (-345.450) (-356.133) -- 0:00:53
145000 -- (-345.862) [-346.544] (-345.352) (-345.908) * (-348.058) (-348.304) [-346.079] (-354.857) -- 0:00:53
Average standard deviation of split frequencies: 0.024363
145500 -- (-348.433) [-350.800] (-350.669) (-347.169) * (-349.667) (-347.503) [-346.368] (-348.304) -- 0:00:52
146000 -- (-345.949) (-346.820) (-345.732) [-345.874] * [-345.622] (-345.075) (-346.012) (-350.860) -- 0:00:52
146500 -- (-346.119) (-347.745) (-346.509) [-351.171] * (-346.104) (-345.658) [-345.470] (-349.276) -- 0:00:52
147000 -- (-346.551) (-349.110) [-347.974] (-349.307) * (-345.043) [-345.084] (-346.079) (-349.066) -- 0:00:52
147500 -- (-345.197) (-348.207) [-348.997] (-348.048) * (-349.040) (-345.716) (-346.651) [-346.094] -- 0:00:52
148000 -- (-345.124) (-345.819) [-347.124] (-347.736) * (-344.906) (-346.819) (-349.666) [-344.866] -- 0:00:51
148500 -- (-345.737) (-347.303) [-348.152] (-348.442) * (-346.787) (-345.198) [-347.100] (-346.898) -- 0:00:51
149000 -- (-345.282) (-348.995) (-349.012) [-345.402] * (-345.963) (-346.013) (-349.928) [-347.435] -- 0:00:51
149500 -- (-347.099) (-346.799) [-345.191] (-345.603) * [-345.630] (-349.309) (-352.274) (-349.009) -- 0:00:51
150000 -- (-345.488) (-345.684) [-348.372] (-349.803) * (-351.739) [-345.292] (-349.271) (-345.796) -- 0:00:56
Average standard deviation of split frequencies: 0.024434
150500 -- (-349.516) (-346.361) (-351.704) [-346.329] * (-349.834) (-348.956) [-346.290] (-345.258) -- 0:00:56
151000 -- [-346.080] (-345.353) (-348.131) (-345.925) * [-347.911] (-350.119) (-346.747) (-348.996) -- 0:00:56
151500 -- (-346.490) (-346.896) [-346.680] (-346.074) * (-348.046) (-349.735) [-347.168] (-345.142) -- 0:00:56
152000 -- (-350.237) [-349.659] (-346.747) (-344.956) * (-350.180) [-347.675] (-347.554) (-346.702) -- 0:00:55
152500 -- (-348.305) (-346.802) (-346.126) [-345.718] * (-347.214) (-346.947) [-346.518] (-356.075) -- 0:00:55
153000 -- [-345.984] (-346.832) (-346.313) (-344.660) * (-345.390) (-345.438) [-347.141] (-345.422) -- 0:00:55
153500 -- (-346.378) (-356.915) (-346.006) [-348.607] * [-345.539] (-347.813) (-345.096) (-344.971) -- 0:00:55
154000 -- [-344.893] (-345.678) (-345.205) (-348.950) * [-346.900] (-346.114) (-344.591) (-347.200) -- 0:00:54
154500 -- (-345.284) (-348.855) [-344.685] (-347.005) * (-346.829) (-346.554) (-345.246) [-346.008] -- 0:00:54
155000 -- (-345.775) (-346.602) (-348.123) [-345.484] * (-347.207) [-345.959] (-344.373) (-347.313) -- 0:00:54
Average standard deviation of split frequencies: 0.023213
155500 -- (-350.615) (-344.876) [-348.936] (-345.061) * (-346.763) [-346.742] (-347.050) (-348.051) -- 0:00:54
156000 -- (-351.529) (-346.873) [-347.352] (-345.278) * (-348.284) (-349.281) (-347.791) [-345.377] -- 0:00:54
156500 -- (-345.239) (-346.862) [-347.627] (-350.035) * (-349.754) (-348.055) [-345.698] (-346.708) -- 0:00:53
157000 -- (-346.609) [-347.994] (-350.042) (-346.591) * (-351.804) (-348.432) (-345.554) [-345.482] -- 0:00:53
157500 -- (-348.936) [-345.616] (-347.802) (-349.401) * (-349.949) (-350.013) [-345.443] (-348.138) -- 0:00:53
158000 -- (-347.811) [-345.938] (-348.295) (-345.895) * (-347.954) [-350.140] (-346.922) (-346.941) -- 0:00:53
158500 -- (-348.994) (-345.753) [-346.255] (-349.306) * (-345.149) (-351.890) [-346.332] (-345.800) -- 0:00:53
159000 -- [-346.711] (-345.223) (-347.566) (-349.981) * (-346.296) [-347.538] (-347.503) (-346.644) -- 0:00:52
159500 -- (-347.639) (-344.544) (-348.586) [-346.325] * (-349.312) (-348.612) [-345.513] (-344.576) -- 0:00:52
160000 -- [-346.020] (-346.405) (-348.846) (-347.979) * [-347.641] (-347.583) (-347.527) (-345.624) -- 0:00:52
Average standard deviation of split frequencies: 0.022272
160500 -- [-345.373] (-350.414) (-347.336) (-345.904) * [-344.989] (-346.331) (-351.746) (-346.163) -- 0:00:52
161000 -- [-347.810] (-347.770) (-345.846) (-347.834) * (-345.731) [-347.886] (-353.677) (-344.787) -- 0:00:52
161500 -- (-346.180) (-349.626) [-345.702] (-346.665) * (-347.587) [-347.801] (-345.915) (-347.797) -- 0:00:51
162000 -- (-345.949) (-346.565) (-344.481) [-346.599] * [-346.901] (-349.209) (-345.780) (-345.478) -- 0:00:51
162500 -- (-345.618) (-346.429) [-350.963] (-347.487) * (-346.715) [-350.288] (-348.463) (-346.045) -- 0:00:51
163000 -- (-344.756) (-344.854) [-347.753] (-344.742) * (-346.726) (-348.181) [-345.263] (-345.473) -- 0:00:51
163500 -- (-346.896) (-351.496) [-345.680] (-347.948) * [-347.505] (-346.099) (-347.252) (-344.564) -- 0:00:51
164000 -- (-346.726) (-347.615) (-349.206) [-346.912] * [-346.402] (-345.491) (-347.265) (-347.839) -- 0:00:50
164500 -- (-344.904) (-347.433) (-349.981) [-347.020] * (-347.803) [-344.856] (-344.853) (-347.242) -- 0:00:50
165000 -- (-345.460) (-347.023) [-352.552] (-348.359) * (-345.108) (-345.059) (-349.400) [-346.597] -- 0:00:50
Average standard deviation of split frequencies: 0.022718
165500 -- [-346.425] (-345.410) (-345.032) (-345.405) * (-347.570) (-346.798) [-347.153] (-349.748) -- 0:00:50
166000 -- (-346.730) (-346.039) [-346.564] (-348.109) * (-347.431) (-355.238) [-345.623] (-345.707) -- 0:00:50
166500 -- [-346.912] (-350.462) (-346.136) (-348.029) * (-345.648) (-348.793) (-345.026) [-348.691] -- 0:00:50
167000 -- (-355.781) (-349.930) (-350.005) [-346.796] * (-345.308) (-346.925) [-346.466] (-345.265) -- 0:00:54
167500 -- (-345.326) (-347.684) (-346.891) [-344.819] * (-345.808) [-345.759] (-344.735) (-346.873) -- 0:00:54
168000 -- (-346.087) [-347.813] (-347.860) (-346.061) * (-346.771) [-345.806] (-348.463) (-347.166) -- 0:00:54
168500 -- (-345.757) (-349.123) (-347.747) [-344.876] * (-348.650) [-345.916] (-348.429) (-346.360) -- 0:00:54
169000 -- (-347.145) [-346.214] (-348.706) (-347.374) * (-348.036) (-349.364) [-346.831] (-347.585) -- 0:00:54
169500 -- (-346.916) (-344.719) (-348.627) [-347.592] * (-347.076) (-349.681) (-345.636) [-346.038] -- 0:00:53
170000 -- (-346.921) [-344.647] (-346.832) (-346.551) * (-350.082) (-345.077) (-347.210) [-345.266] -- 0:00:53
Average standard deviation of split frequencies: 0.021720
170500 -- [-345.952] (-346.279) (-345.031) (-345.534) * (-348.525) (-346.251) [-345.885] (-345.544) -- 0:00:53
171000 -- (-346.413) (-346.075) [-347.375] (-346.967) * (-348.131) (-346.025) (-348.773) [-346.667] -- 0:00:53
171500 -- (-346.920) (-345.748) (-349.073) [-344.827] * (-346.704) [-345.794] (-346.402) (-345.555) -- 0:00:53
172000 -- (-352.816) [-345.140] (-349.995) (-348.642) * (-346.180) [-344.925] (-345.956) (-345.646) -- 0:00:52
172500 -- [-346.113] (-345.783) (-347.802) (-355.109) * (-346.997) (-346.478) (-346.082) [-346.434] -- 0:00:52
173000 -- (-345.715) [-347.140] (-345.854) (-349.503) * (-350.269) [-345.714] (-349.598) (-352.116) -- 0:00:52
173500 -- (-346.966) (-345.086) (-345.973) [-350.746] * [-346.491] (-347.339) (-347.761) (-345.501) -- 0:00:52
174000 -- (-347.488) (-346.045) (-348.341) [-346.255] * (-349.181) [-344.875] (-347.078) (-346.790) -- 0:00:52
174500 -- (-347.722) (-348.388) (-346.907) [-349.521] * (-347.782) [-345.655] (-345.648) (-349.221) -- 0:00:52
175000 -- (-347.322) [-348.675] (-349.314) (-345.538) * (-345.747) (-346.368) [-345.469] (-346.228) -- 0:00:51
Average standard deviation of split frequencies: 0.021045
175500 -- (-346.360) (-346.158) [-346.423] (-345.588) * (-348.238) [-344.703] (-346.897) (-344.811) -- 0:00:51
176000 -- [-345.052] (-347.100) (-351.860) (-346.682) * (-348.109) (-346.463) (-347.032) [-347.464] -- 0:00:51
176500 -- (-345.675) (-344.997) [-346.870] (-345.586) * (-346.421) (-348.014) [-346.041] (-346.384) -- 0:00:51
177000 -- (-345.027) (-346.065) (-346.208) [-346.661] * [-347.996] (-346.909) (-347.303) (-347.223) -- 0:00:51
177500 -- [-346.848] (-348.104) (-347.677) (-346.769) * [-347.660] (-349.663) (-345.175) (-349.903) -- 0:00:50
178000 -- (-347.355) (-345.784) [-346.025] (-346.672) * (-344.843) (-346.504) (-348.402) [-347.483] -- 0:00:50
178500 -- (-347.839) (-348.740) (-347.564) [-347.645] * (-346.516) (-350.038) [-346.625] (-350.211) -- 0:00:50
179000 -- (-346.304) [-346.106] (-354.555) (-346.769) * [-347.313] (-347.189) (-346.865) (-346.241) -- 0:00:50
179500 -- [-345.007] (-346.365) (-348.419) (-347.183) * (-347.016) (-345.009) (-350.410) [-348.232] -- 0:00:50
180000 -- [-348.237] (-344.596) (-346.412) (-348.787) * [-347.290] (-346.017) (-344.921) (-347.465) -- 0:00:50
Average standard deviation of split frequencies: 0.019507
180500 -- [-345.952] (-349.314) (-346.609) (-346.857) * [-349.664] (-346.932) (-347.857) (-349.036) -- 0:00:49
181000 -- [-346.320] (-346.640) (-347.359) (-345.588) * (-347.682) (-346.235) (-347.386) [-348.911] -- 0:00:49
181500 -- (-350.123) [-349.818] (-346.767) (-350.473) * (-346.474) (-348.233) [-346.100] (-346.196) -- 0:00:49
182000 -- [-345.946] (-347.509) (-346.635) (-346.371) * (-344.994) (-347.623) [-345.010] (-345.404) -- 0:00:49
182500 -- [-345.881] (-345.907) (-346.746) (-346.921) * (-346.276) [-346.880] (-345.750) (-346.183) -- 0:00:49
183000 -- (-345.718) (-351.195) [-345.072] (-345.749) * [-346.382] (-346.136) (-345.493) (-346.638) -- 0:00:49
183500 -- (-345.885) [-348.158] (-346.806) (-345.663) * (-345.947) (-346.953) (-344.811) [-345.087] -- 0:00:48
184000 -- [-346.142] (-347.519) (-345.028) (-347.457) * (-345.355) (-345.320) [-345.711] (-346.863) -- 0:00:53
184500 -- (-345.469) (-346.421) [-346.264] (-347.906) * (-351.793) (-346.999) [-346.197] (-345.861) -- 0:00:53
185000 -- [-344.997] (-346.512) (-346.964) (-345.725) * (-344.649) (-345.095) [-348.175] (-347.194) -- 0:00:52
Average standard deviation of split frequencies: 0.017017
185500 -- (-346.181) [-346.760] (-347.015) (-348.199) * (-346.231) (-349.231) [-345.703] (-348.877) -- 0:00:52
186000 -- (-345.265) (-351.325) (-348.068) [-347.066] * (-344.734) (-346.866) [-346.181] (-347.695) -- 0:00:52
186500 -- [-345.217] (-346.238) (-346.249) (-346.327) * (-350.903) [-347.358] (-346.311) (-347.987) -- 0:00:52
187000 -- (-349.549) [-347.796] (-345.449) (-347.003) * (-353.050) [-345.967] (-345.459) (-347.981) -- 0:00:52
187500 -- (-352.352) (-348.981) [-344.866] (-346.342) * [-351.350] (-345.733) (-349.723) (-346.642) -- 0:00:52
188000 -- (-349.507) [-346.397] (-346.399) (-345.328) * [-346.503] (-347.934) (-350.727) (-346.168) -- 0:00:51
188500 -- [-347.121] (-347.451) (-347.953) (-347.158) * (-350.420) (-348.069) [-347.712] (-344.889) -- 0:00:51
189000 -- (-346.841) (-349.223) [-347.626] (-347.592) * (-346.774) (-346.654) (-347.745) [-345.277] -- 0:00:51
189500 -- (-345.953) [-346.191] (-348.629) (-349.639) * (-346.616) (-344.570) (-349.173) [-347.488] -- 0:00:51
190000 -- (-345.599) (-347.113) (-348.460) [-346.798] * [-346.405] (-346.072) (-352.663) (-350.181) -- 0:00:51
Average standard deviation of split frequencies: 0.015576
190500 -- (-348.424) (-345.793) (-349.391) [-346.989] * [-345.885] (-346.096) (-348.057) (-347.585) -- 0:00:50
191000 -- (-352.200) (-346.931) [-347.088] (-345.173) * (-350.681) (-345.559) [-345.681] (-349.283) -- 0:00:50
191500 -- (-350.796) (-347.041) [-348.232] (-348.372) * (-347.004) (-347.010) [-346.827] (-345.508) -- 0:00:50
192000 -- (-345.759) (-346.300) (-346.366) [-346.024] * (-349.270) (-350.122) [-345.659] (-345.236) -- 0:00:50
192500 -- (-346.239) (-346.607) [-345.620] (-346.001) * [-347.024] (-347.649) (-345.242) (-345.239) -- 0:00:50
193000 -- [-344.762] (-345.771) (-346.944) (-344.858) * (-349.216) (-345.903) (-345.636) [-348.194] -- 0:00:50
193500 -- (-347.690) (-347.595) [-344.951] (-350.770) * (-350.969) (-346.433) (-345.860) [-347.434] -- 0:00:50
194000 -- (-346.447) [-345.680] (-348.553) (-349.083) * (-348.405) (-347.460) [-344.762] (-345.563) -- 0:00:49
194500 -- (-347.117) [-347.234] (-352.005) (-348.501) * (-349.229) [-345.045] (-346.673) (-345.445) -- 0:00:49
195000 -- (-345.270) (-346.934) (-351.064) [-346.773] * (-345.985) (-344.793) [-348.396] (-345.444) -- 0:00:49
Average standard deviation of split frequencies: 0.015754
195500 -- [-345.933] (-351.507) (-347.138) (-347.901) * (-345.915) (-345.714) (-348.022) [-346.747] -- 0:00:49
196000 -- (-346.622) (-348.396) [-345.384] (-347.336) * (-346.950) (-344.609) (-347.699) [-345.527] -- 0:00:49
196500 -- (-347.943) (-346.500) [-345.103] (-346.201) * (-347.784) (-345.357) (-347.502) [-344.910] -- 0:00:49
197000 -- (-345.511) (-346.004) (-346.588) [-344.734] * (-345.389) [-347.721] (-346.960) (-346.341) -- 0:00:48
197500 -- [-346.136] (-346.577) (-345.455) (-347.750) * (-347.417) (-347.266) [-348.819] (-348.716) -- 0:00:48
198000 -- (-347.303) [-349.376] (-346.393) (-347.728) * [-347.682] (-347.174) (-345.610) (-347.901) -- 0:00:48
198500 -- (-347.771) (-347.583) (-348.568) [-345.386] * (-349.987) (-346.494) [-344.637] (-349.205) -- 0:00:48
199000 -- (-346.755) (-345.823) (-346.928) [-346.209] * (-345.549) [-345.248] (-346.351) (-345.816) -- 0:00:48
199500 -- [-345.887] (-347.244) (-350.967) (-346.341) * (-345.570) [-345.011] (-349.549) (-345.628) -- 0:00:48
200000 -- (-345.852) (-346.217) [-346.372] (-348.166) * (-346.457) (-345.029) (-347.567) [-346.687] -- 0:00:48
Average standard deviation of split frequencies: 0.014213
200500 -- [-347.841] (-345.784) (-346.833) (-348.443) * (-344.790) (-349.755) (-353.961) [-344.820] -- 0:00:51
201000 -- [-345.348] (-345.990) (-346.969) (-347.052) * (-348.280) [-346.594] (-349.332) (-345.199) -- 0:00:51
201500 -- (-348.486) (-346.395) (-346.027) [-346.319] * (-346.645) (-349.303) (-344.804) [-348.060] -- 0:00:51
202000 -- [-345.818] (-351.210) (-346.492) (-346.635) * (-347.682) (-346.039) [-344.892] (-348.213) -- 0:00:51
202500 -- (-347.113) (-348.019) (-345.472) [-347.885] * [-344.463] (-345.906) (-349.582) (-346.289) -- 0:00:51
203000 -- [-346.711] (-350.763) (-347.935) (-346.952) * (-346.975) (-348.450) (-349.418) [-346.515] -- 0:00:51
203500 -- (-347.959) (-349.572) (-346.117) [-351.142] * (-346.059) (-346.471) (-352.597) [-345.949] -- 0:00:50
204000 -- (-345.085) [-344.783] (-345.082) (-346.226) * (-346.726) (-345.884) (-347.232) [-345.581] -- 0:00:50
204500 -- (-348.451) (-346.338) [-347.294] (-347.978) * (-347.984) (-345.758) [-345.626] (-344.525) -- 0:00:50
205000 -- (-348.217) [-348.868] (-345.806) (-346.534) * [-346.559] (-345.157) (-345.031) (-345.755) -- 0:00:50
Average standard deviation of split frequencies: 0.013839
205500 -- (-350.974) (-347.802) [-347.237] (-351.657) * [-345.383] (-347.776) (-347.419) (-346.803) -- 0:00:50
206000 -- [-345.620] (-349.279) (-350.439) (-346.519) * (-348.785) (-347.221) [-347.302] (-345.169) -- 0:00:50
206500 -- (-346.210) [-346.137] (-347.687) (-346.058) * [-346.747] (-348.852) (-346.795) (-346.495) -- 0:00:49
207000 -- [-344.986] (-351.758) (-347.309) (-344.910) * (-346.193) [-348.187] (-345.618) (-344.552) -- 0:00:49
207500 -- (-344.991) [-346.993] (-348.148) (-346.536) * (-346.892) (-346.719) (-346.481) [-345.891] -- 0:00:49
208000 -- (-349.014) (-348.944) (-348.826) [-345.757] * (-346.155) (-345.911) (-344.950) [-347.113] -- 0:00:49
208500 -- (-345.868) [-349.803] (-344.733) (-345.778) * [-345.676] (-346.907) (-347.871) (-347.782) -- 0:00:49
209000 -- [-345.215] (-349.707) (-345.218) (-346.515) * (-347.707) [-346.178] (-347.730) (-347.543) -- 0:00:49
209500 -- (-348.162) [-347.443] (-345.057) (-347.619) * [-345.005] (-351.178) (-345.862) (-351.169) -- 0:00:49
210000 -- (-351.017) (-349.107) (-345.128) [-346.917] * (-348.339) (-349.496) (-346.296) [-347.561] -- 0:00:48
Average standard deviation of split frequencies: 0.014604
210500 -- (-344.707) (-345.074) [-348.135] (-348.781) * (-349.403) [-348.589] (-345.901) (-346.150) -- 0:00:48
211000 -- (-345.253) (-347.883) [-346.385] (-345.905) * [-347.751] (-349.924) (-347.375) (-346.958) -- 0:00:48
211500 -- (-345.119) (-348.317) [-348.147] (-345.213) * (-352.278) [-346.484] (-345.639) (-345.234) -- 0:00:48
212000 -- (-349.776) [-344.994] (-345.301) (-348.089) * (-346.668) (-348.786) [-346.290] (-348.327) -- 0:00:48
212500 -- (-351.526) (-347.359) [-347.093] (-346.651) * (-345.406) (-346.371) [-345.188] (-345.605) -- 0:00:48
213000 -- (-347.502) (-347.829) [-346.907] (-346.660) * (-345.955) (-347.802) [-347.114] (-352.383) -- 0:00:48
213500 -- (-346.737) (-351.059) (-346.222) [-345.524] * (-346.505) [-350.063] (-346.051) (-347.431) -- 0:00:47
214000 -- (-347.794) [-349.778] (-346.493) (-347.798) * (-345.531) (-349.625) (-347.968) [-344.806] -- 0:00:47
214500 -- (-347.543) (-346.994) [-345.004] (-345.514) * (-350.030) (-345.351) [-344.993] (-347.460) -- 0:00:47
215000 -- (-345.305) (-344.913) (-352.067) [-345.354] * (-348.039) (-346.666) (-347.480) [-348.090] -- 0:00:47
Average standard deviation of split frequencies: 0.014932
215500 -- (-344.936) (-345.710) (-349.966) [-346.635] * (-346.258) [-346.077] (-345.732) (-347.764) -- 0:00:47
216000 -- [-346.626] (-347.347) (-346.660) (-348.274) * [-346.518] (-345.546) (-345.387) (-346.303) -- 0:00:47
216500 -- (-346.532) [-345.578] (-346.018) (-348.635) * (-347.249) (-344.779) (-345.233) [-346.492] -- 0:00:47
217000 -- (-344.571) (-347.386) [-345.384] (-347.418) * (-349.001) (-344.616) [-345.450] (-347.339) -- 0:00:46
217500 -- (-346.972) (-347.841) (-346.004) [-346.258] * (-347.345) [-344.582] (-346.231) (-354.926) -- 0:00:50
218000 -- (-346.255) [-347.664] (-348.961) (-345.660) * (-346.763) (-345.136) (-345.295) [-349.361] -- 0:00:50
218500 -- [-345.626] (-344.622) (-346.327) (-347.456) * [-345.668] (-347.091) (-345.326) (-349.309) -- 0:00:50
219000 -- [-346.667] (-347.812) (-347.685) (-347.490) * (-350.528) [-347.295] (-344.830) (-346.066) -- 0:00:49
219500 -- (-350.680) (-345.933) [-346.082] (-348.327) * (-351.167) (-347.749) [-345.385] (-347.826) -- 0:00:49
220000 -- (-347.026) (-345.652) (-349.875) [-348.346] * (-345.286) (-345.211) [-345.975] (-345.378) -- 0:00:49
Average standard deviation of split frequencies: 0.013830
220500 -- (-345.664) [-347.880] (-349.814) (-348.213) * (-347.697) (-347.590) [-348.397] (-346.353) -- 0:00:49
221000 -- (-345.718) [-348.739] (-346.488) (-345.966) * (-345.201) [-346.729] (-345.086) (-344.619) -- 0:00:49
221500 -- [-345.741] (-347.634) (-345.184) (-345.940) * (-345.327) [-345.917] (-346.852) (-346.861) -- 0:00:49
222000 -- (-344.921) [-348.665] (-346.097) (-347.229) * [-344.999] (-347.075) (-347.776) (-346.923) -- 0:00:49
222500 -- [-344.942] (-347.851) (-345.467) (-350.897) * [-346.920] (-348.110) (-346.991) (-347.446) -- 0:00:48
223000 -- (-347.950) (-345.631) [-347.115] (-347.228) * [-347.192] (-348.789) (-348.503) (-347.970) -- 0:00:48
223500 -- (-345.265) (-346.532) (-349.097) [-346.981] * [-345.562] (-344.668) (-347.939) (-348.097) -- 0:00:48
224000 -- (-349.966) (-348.731) [-349.835] (-347.360) * (-346.281) [-345.323] (-345.490) (-347.848) -- 0:00:48
224500 -- [-347.435] (-347.411) (-347.943) (-346.329) * (-348.798) (-350.447) (-345.269) [-345.549] -- 0:00:48
225000 -- (-349.892) [-346.196] (-350.531) (-347.263) * (-346.484) [-346.494] (-348.675) (-345.548) -- 0:00:48
Average standard deviation of split frequencies: 0.013454
225500 -- [-345.357] (-345.146) (-348.628) (-347.870) * (-348.222) (-347.089) (-345.242) [-346.702] -- 0:00:48
226000 -- (-346.330) (-346.091) [-346.134] (-347.462) * (-347.107) (-346.388) [-346.045] (-345.806) -- 0:00:47
226500 -- (-345.535) [-346.881] (-344.780) (-346.052) * (-347.115) (-346.891) (-348.820) [-348.326] -- 0:00:47
227000 -- (-349.502) [-345.034] (-348.170) (-345.988) * (-346.288) [-346.802] (-346.276) (-347.792) -- 0:00:47
227500 -- [-347.121] (-345.996) (-344.956) (-346.429) * [-346.299] (-348.374) (-347.152) (-346.544) -- 0:00:47
228000 -- (-347.978) [-348.992] (-346.869) (-346.278) * [-346.385] (-347.065) (-346.826) (-345.878) -- 0:00:47
228500 -- (-345.876) [-346.514] (-346.024) (-347.489) * [-344.742] (-347.942) (-347.973) (-345.468) -- 0:00:47
229000 -- (-345.622) (-347.638) (-346.970) [-344.856] * [-345.730] (-347.869) (-349.953) (-345.337) -- 0:00:47
229500 -- (-347.618) (-345.671) [-347.513] (-345.512) * (-345.876) [-345.925] (-349.680) (-345.848) -- 0:00:47
230000 -- (-345.700) (-346.644) [-346.748] (-348.549) * (-348.786) (-348.838) (-346.662) [-344.974] -- 0:00:46
Average standard deviation of split frequencies: 0.013553
230500 -- (-347.629) [-348.543] (-350.076) (-353.853) * (-344.937) (-345.430) [-345.981] (-345.396) -- 0:00:46
231000 -- [-345.655] (-347.588) (-347.298) (-345.775) * (-345.771) [-345.189] (-346.438) (-354.874) -- 0:00:46
231500 -- (-348.140) (-352.472) (-346.248) [-347.050] * (-345.008) [-349.094] (-347.406) (-348.096) -- 0:00:46
232000 -- [-345.042] (-349.946) (-345.737) (-345.474) * (-345.750) [-348.557] (-345.154) (-346.730) -- 0:00:46
232500 -- (-348.625) [-345.847] (-345.156) (-345.922) * (-344.905) [-345.791] (-345.194) (-345.762) -- 0:00:46
233000 -- (-348.198) (-346.138) (-346.094) [-346.445] * (-347.009) (-346.210) (-345.365) [-347.548] -- 0:00:46
233500 -- (-347.210) (-346.502) (-346.938) [-349.946] * (-344.922) (-344.540) (-350.548) [-346.942] -- 0:00:45
234000 -- (-345.657) [-346.978] (-346.103) (-348.977) * (-346.989) (-347.768) [-344.604] (-346.175) -- 0:00:45
234500 -- [-346.148] (-345.579) (-345.620) (-345.165) * [-347.832] (-346.008) (-346.661) (-345.045) -- 0:00:48
235000 -- (-349.339) [-345.191] (-345.116) (-346.300) * (-347.776) (-346.668) (-350.860) [-347.280] -- 0:00:48
Average standard deviation of split frequencies: 0.013427
235500 -- (-346.476) [-344.532] (-347.949) (-349.796) * (-349.481) (-348.966) (-346.280) [-349.436] -- 0:00:48
236000 -- [-347.415] (-345.987) (-350.018) (-347.053) * (-347.229) (-347.257) (-344.896) [-348.250] -- 0:00:48
236500 -- (-345.836) [-344.505] (-347.486) (-351.794) * (-348.039) [-346.650] (-347.276) (-345.024) -- 0:00:48
237000 -- (-347.069) (-346.695) [-349.109] (-347.721) * (-346.529) [-347.113] (-345.667) (-348.405) -- 0:00:48
237500 -- (-345.557) (-344.740) [-347.600] (-346.840) * (-346.113) (-346.059) [-345.782] (-349.186) -- 0:00:48
238000 -- (-345.106) [-345.436] (-351.486) (-351.155) * (-345.858) (-346.394) (-344.995) [-344.962] -- 0:00:48
238500 -- (-350.141) [-346.869] (-349.157) (-345.213) * [-345.858] (-346.230) (-347.246) (-346.679) -- 0:00:47
239000 -- (-346.763) [-350.112] (-345.813) (-349.956) * (-346.497) (-350.559) (-348.175) [-345.387] -- 0:00:47
239500 -- (-345.977) (-350.820) [-347.290] (-352.207) * [-347.303] (-350.583) (-346.867) (-348.174) -- 0:00:47
240000 -- [-344.763] (-347.880) (-345.706) (-348.900) * (-345.883) (-344.552) [-346.493] (-345.563) -- 0:00:47
Average standard deviation of split frequencies: 0.015235
240500 -- (-344.585) (-344.543) (-345.573) [-348.427] * (-347.971) [-346.236] (-347.454) (-346.423) -- 0:00:47
241000 -- (-349.095) (-347.205) (-349.476) [-346.982] * [-346.292] (-346.023) (-348.604) (-346.483) -- 0:00:47
241500 -- [-347.898] (-347.086) (-345.267) (-345.049) * (-348.652) (-346.578) [-345.258] (-347.587) -- 0:00:47
242000 -- [-344.912] (-348.190) (-345.512) (-348.854) * [-348.109] (-348.928) (-344.995) (-346.945) -- 0:00:46
242500 -- (-345.903) (-350.822) [-345.062] (-348.371) * (-348.640) (-346.782) [-346.910] (-347.815) -- 0:00:46
243000 -- [-347.652] (-346.227) (-346.720) (-353.957) * (-348.967) (-345.034) (-348.709) [-347.374] -- 0:00:46
243500 -- (-348.837) (-345.311) [-346.238] (-348.126) * (-350.274) [-346.873] (-347.626) (-346.771) -- 0:00:46
244000 -- (-345.845) (-345.449) (-349.521) [-347.522] * [-344.777] (-345.213) (-346.933) (-347.681) -- 0:00:46
244500 -- (-346.440) [-345.221] (-348.090) (-345.575) * (-345.344) [-348.230] (-346.916) (-347.165) -- 0:00:46
245000 -- (-347.921) (-348.742) (-348.724) [-345.672] * [-345.296] (-348.396) (-346.474) (-345.325) -- 0:00:46
Average standard deviation of split frequencies: 0.013840
245500 -- (-345.713) (-346.661) [-345.933] (-348.512) * (-344.528) [-346.899] (-347.190) (-346.080) -- 0:00:46
246000 -- (-347.092) [-346.550] (-346.610) (-349.234) * [-345.037] (-348.688) (-346.266) (-351.821) -- 0:00:45
246500 -- (-344.633) (-348.090) (-345.846) [-346.472] * (-345.008) [-346.316] (-348.464) (-346.135) -- 0:00:45
247000 -- (-345.831) (-347.033) [-345.680] (-346.848) * (-347.013) (-346.850) [-345.634] (-345.484) -- 0:00:45
247500 -- (-353.350) [-346.928] (-345.965) (-346.805) * (-350.286) [-348.619] (-345.670) (-344.852) -- 0:00:45
248000 -- (-348.926) (-345.406) [-345.196] (-348.341) * [-344.860] (-346.729) (-348.836) (-345.896) -- 0:00:45
248500 -- [-349.451] (-347.329) (-346.317) (-348.367) * [-348.984] (-347.893) (-345.888) (-345.652) -- 0:00:45
249000 -- [-350.900] (-350.846) (-347.426) (-346.601) * (-346.429) (-347.334) (-345.738) [-345.166] -- 0:00:45
249500 -- (-348.748) (-347.613) (-345.171) [-347.265] * (-345.545) (-352.651) [-347.375] (-351.747) -- 0:00:45
250000 -- [-347.565] (-345.430) (-346.707) (-347.184) * (-345.802) (-348.316) [-346.546] (-347.777) -- 0:00:45
Average standard deviation of split frequencies: 0.012642
250500 -- (-351.331) (-347.339) (-344.445) [-344.869] * (-345.115) (-345.931) (-345.851) [-348.442] -- 0:00:44
251000 -- (-346.591) (-345.465) [-348.729] (-345.950) * (-349.137) (-346.950) (-346.704) [-351.075] -- 0:00:44
251500 -- (-347.045) [-347.886] (-350.009) (-346.918) * (-346.693) (-345.329) (-346.707) [-348.510] -- 0:00:47
252000 -- (-346.777) [-347.259] (-347.889) (-344.879) * (-348.246) [-347.805] (-346.929) (-346.108) -- 0:00:47
252500 -- (-345.852) (-347.364) (-345.782) [-344.820] * (-347.443) [-346.797] (-348.127) (-346.961) -- 0:00:47
253000 -- (-348.171) (-348.746) [-347.508] (-347.107) * (-347.815) (-347.666) (-345.926) [-344.588] -- 0:00:47
253500 -- [-345.484] (-348.065) (-348.278) (-347.215) * (-348.278) (-352.272) [-348.247] (-345.277) -- 0:00:47
254000 -- (-350.777) (-348.646) [-352.112] (-345.482) * (-346.271) (-349.018) (-346.166) [-345.469] -- 0:00:46
254500 -- (-347.119) [-345.816] (-347.500) (-347.525) * (-345.400) (-347.110) (-348.271) [-345.281] -- 0:00:46
255000 -- (-345.951) (-346.306) (-348.522) [-345.727] * (-345.347) (-345.309) (-353.775) [-346.135] -- 0:00:46
Average standard deviation of split frequencies: 0.011867
255500 -- (-347.563) [-346.111] (-348.290) (-346.209) * (-346.481) (-347.258) (-347.313) [-345.505] -- 0:00:46
256000 -- (-345.907) [-348.786] (-345.827) (-348.279) * (-345.494) [-345.581] (-347.154) (-346.823) -- 0:00:46
256500 -- (-344.883) (-345.000) (-347.354) [-347.670] * (-345.739) (-347.668) (-345.840) [-346.185] -- 0:00:46
257000 -- (-346.628) (-347.042) [-347.183] (-345.096) * [-346.059] (-346.629) (-345.254) (-351.822) -- 0:00:46
257500 -- [-346.892] (-347.036) (-345.764) (-347.743) * (-345.994) [-346.794] (-348.102) (-346.112) -- 0:00:46
258000 -- (-347.755) (-349.644) [-346.765] (-345.972) * (-349.093) [-350.037] (-349.151) (-346.888) -- 0:00:46
258500 -- (-346.769) (-345.314) (-347.492) [-346.327] * (-347.843) (-348.662) [-351.025] (-349.511) -- 0:00:45
259000 -- [-347.618] (-348.430) (-349.014) (-349.092) * (-345.626) (-346.773) [-347.994] (-353.051) -- 0:00:45
259500 -- [-347.407] (-347.898) (-348.719) (-345.027) * (-345.235) [-345.243] (-346.128) (-347.799) -- 0:00:45
260000 -- (-346.076) (-347.034) [-344.907] (-345.548) * (-350.650) [-349.051] (-345.376) (-347.215) -- 0:00:45
Average standard deviation of split frequencies: 0.012446
260500 -- (-353.232) (-348.358) [-349.551] (-346.827) * (-346.581) (-345.476) [-345.226] (-346.047) -- 0:00:45
261000 -- [-345.500] (-347.657) (-345.022) (-348.846) * (-347.913) (-348.503) [-345.845] (-347.017) -- 0:00:45
261500 -- (-346.428) [-348.248] (-346.191) (-348.149) * (-347.530) (-346.456) [-345.696] (-344.948) -- 0:00:45
262000 -- [-347.736] (-347.664) (-347.267) (-346.054) * (-345.452) (-346.105) [-347.038] (-347.278) -- 0:00:45
262500 -- [-345.777] (-349.058) (-346.611) (-345.451) * (-345.125) [-345.318] (-348.833) (-348.634) -- 0:00:44
263000 -- (-347.238) (-346.825) [-346.218] (-347.589) * (-346.247) (-348.099) [-348.566] (-348.949) -- 0:00:44
263500 -- [-345.979] (-346.349) (-346.429) (-346.578) * (-346.939) (-350.802) (-346.944) [-350.065] -- 0:00:44
264000 -- (-348.948) (-347.326) (-349.788) [-345.116] * [-344.537] (-346.291) (-348.795) (-348.600) -- 0:00:44
264500 -- (-346.508) (-346.444) (-348.953) [-345.087] * (-344.969) (-346.435) [-347.926] (-349.226) -- 0:00:44
265000 -- (-346.647) [-346.230] (-350.339) (-346.776) * (-345.495) (-346.542) [-344.802] (-346.235) -- 0:00:44
Average standard deviation of split frequencies: 0.012701
265500 -- (-348.421) (-350.225) [-347.886] (-345.279) * (-345.746) (-345.482) (-346.439) [-345.602] -- 0:00:44
266000 -- [-349.305] (-348.348) (-347.295) (-345.916) * (-347.931) [-347.324] (-349.110) (-346.710) -- 0:00:44
266500 -- (-347.994) [-348.655] (-350.010) (-347.757) * [-345.484] (-347.000) (-347.150) (-347.670) -- 0:00:44
267000 -- (-347.052) (-347.283) [-346.607] (-345.553) * (-345.140) (-349.393) (-345.601) [-348.685] -- 0:00:43
267500 -- (-346.453) [-346.409] (-347.027) (-347.707) * (-347.009) (-352.435) [-344.576] (-346.700) -- 0:00:43
268000 -- (-346.812) (-347.229) (-345.136) [-345.901] * (-346.980) (-351.199) [-349.527] (-348.014) -- 0:00:43
268500 -- (-345.009) (-347.401) [-345.334] (-346.071) * (-347.843) (-346.200) (-348.580) [-346.993] -- 0:00:46
269000 -- (-346.032) (-348.718) [-346.054] (-347.869) * [-348.338] (-344.747) (-345.803) (-349.335) -- 0:00:46
269500 -- (-346.730) (-345.987) (-349.997) [-348.371] * (-346.339) [-346.078] (-347.951) (-346.488) -- 0:00:46
270000 -- [-347.072] (-350.869) (-349.688) (-345.703) * (-345.164) [-345.490] (-344.577) (-349.406) -- 0:00:45
Average standard deviation of split frequencies: 0.012806
270500 -- (-351.348) (-345.728) (-345.816) [-344.690] * (-348.286) (-345.879) [-346.938] (-347.177) -- 0:00:45
271000 -- (-348.418) (-347.066) (-346.986) [-346.340] * [-346.221] (-348.261) (-344.683) (-346.566) -- 0:00:45
271500 -- (-351.174) (-358.432) [-346.468] (-344.746) * [-349.420] (-349.460) (-345.277) (-345.804) -- 0:00:45
272000 -- [-347.620] (-352.711) (-347.393) (-347.723) * [-348.715] (-345.881) (-344.942) (-345.032) -- 0:00:45
272500 -- (-347.652) (-347.251) [-347.074] (-347.291) * (-346.799) [-346.057] (-344.282) (-346.176) -- 0:00:45
273000 -- [-346.604] (-346.492) (-345.113) (-346.450) * (-346.586) (-348.039) [-344.804] (-348.157) -- 0:00:45
273500 -- [-346.087] (-349.955) (-347.121) (-346.393) * (-345.488) (-346.870) [-345.858] (-345.093) -- 0:00:45
274000 -- (-346.736) (-347.242) (-346.211) [-346.877] * (-346.037) (-345.001) [-344.996] (-345.223) -- 0:00:45
274500 -- [-345.845] (-353.200) (-347.347) (-345.478) * (-345.655) (-346.021) (-345.650) [-346.774] -- 0:00:44
275000 -- [-346.651] (-344.612) (-346.344) (-347.725) * (-344.684) [-345.830] (-346.648) (-345.686) -- 0:00:44
Average standard deviation of split frequencies: 0.012860
275500 -- (-345.926) (-346.915) [-345.024] (-345.998) * [-344.694] (-344.912) (-350.225) (-346.837) -- 0:00:44
276000 -- (-348.502) [-346.763] (-344.431) (-347.441) * (-347.459) [-352.030] (-349.276) (-346.391) -- 0:00:44
276500 -- (-348.551) (-346.075) [-345.085] (-349.133) * (-347.729) (-351.133) (-346.196) [-347.193] -- 0:00:44
277000 -- (-348.647) (-348.691) [-349.134] (-345.136) * (-345.984) [-345.202] (-345.607) (-346.385) -- 0:00:44
277500 -- [-347.932] (-348.792) (-349.050) (-347.155) * (-344.739) (-345.881) [-351.366] (-345.221) -- 0:00:44
278000 -- (-348.102) [-347.955] (-350.588) (-347.662) * (-344.866) (-348.248) (-349.676) [-348.147] -- 0:00:44
278500 -- [-347.599] (-350.134) (-345.891) (-344.604) * (-347.707) (-346.581) (-351.318) [-346.639] -- 0:00:44
279000 -- (-346.161) (-346.624) (-347.350) [-345.014] * [-346.333] (-347.145) (-345.733) (-347.522) -- 0:00:43
279500 -- (-346.868) [-346.366] (-344.379) (-345.001) * (-345.368) (-344.528) [-346.280] (-346.544) -- 0:00:43
280000 -- (-347.316) [-344.695] (-349.971) (-350.826) * (-347.850) (-353.099) [-347.424] (-346.396) -- 0:00:43
Average standard deviation of split frequencies: 0.013239
280500 -- (-345.932) [-346.646] (-347.463) (-356.649) * [-345.195] (-345.225) (-347.952) (-345.953) -- 0:00:43
281000 -- [-348.433] (-352.306) (-347.037) (-348.697) * [-346.007] (-348.487) (-348.152) (-347.925) -- 0:00:43
281500 -- (-344.724) (-348.509) [-345.823] (-347.439) * (-347.914) (-345.824) (-350.839) [-344.548] -- 0:00:43
282000 -- (-345.705) (-346.709) [-348.659] (-347.192) * (-346.786) (-347.509) (-347.460) [-346.986] -- 0:00:43
282500 -- (-345.156) (-347.985) (-347.571) [-346.820] * (-348.671) (-348.353) (-349.953) [-349.285] -- 0:00:43
283000 -- [-345.905] (-344.331) (-345.726) (-349.650) * (-347.071) (-345.968) [-347.571] (-349.232) -- 0:00:43
283500 -- (-347.218) (-345.572) (-351.068) [-344.689] * (-345.785) (-345.932) [-348.214] (-352.796) -- 0:00:42
284000 -- (-345.365) [-346.199] (-345.754) (-344.753) * [-344.728] (-347.184) (-351.003) (-346.318) -- 0:00:42
284500 -- (-346.153) (-345.129) (-344.750) [-350.129] * (-353.078) [-347.136] (-349.568) (-346.507) -- 0:00:42
285000 -- [-348.162] (-346.304) (-347.359) (-347.775) * (-347.434) [-347.640] (-345.977) (-345.615) -- 0:00:42
Average standard deviation of split frequencies: 0.014651
285500 -- (-349.401) (-346.950) [-345.786] (-347.733) * (-345.530) (-353.008) (-348.717) [-347.555] -- 0:00:45
286000 -- (-348.914) (-348.226) [-346.615] (-345.833) * (-347.247) [-348.213] (-347.318) (-346.611) -- 0:00:44
286500 -- [-348.155] (-348.144) (-346.251) (-345.671) * (-345.209) [-346.307] (-346.586) (-355.293) -- 0:00:44
287000 -- (-346.360) (-345.372) [-344.949] (-345.427) * [-345.934] (-346.700) (-346.076) (-346.770) -- 0:00:44
287500 -- [-346.679] (-347.240) (-346.342) (-347.740) * (-344.671) [-345.218] (-347.574) (-350.411) -- 0:00:44
288000 -- (-345.778) (-344.873) (-347.263) [-349.007] * (-346.428) [-344.793] (-344.889) (-348.358) -- 0:00:44
288500 -- (-349.686) (-346.375) [-349.968] (-351.056) * [-346.937] (-349.870) (-347.945) (-345.434) -- 0:00:44
289000 -- (-345.926) (-346.463) (-349.180) [-345.437] * [-347.921] (-349.896) (-345.497) (-346.819) -- 0:00:44
289500 -- (-346.024) (-347.119) (-345.401) [-345.246] * [-346.236] (-344.882) (-345.610) (-345.722) -- 0:00:44
290000 -- (-345.438) (-345.610) [-346.244] (-347.281) * [-348.277] (-346.722) (-347.638) (-347.078) -- 0:00:44
Average standard deviation of split frequencies: 0.013966
290500 -- (-346.701) [-346.229] (-349.801) (-346.913) * [-348.072] (-353.463) (-348.624) (-346.900) -- 0:00:43
291000 -- (-349.367) (-346.950) (-348.105) [-345.304] * (-348.837) (-345.500) [-346.375] (-349.845) -- 0:00:43
291500 -- [-351.358] (-345.768) (-348.986) (-347.948) * (-348.456) [-349.177] (-347.036) (-346.970) -- 0:00:43
292000 -- (-347.007) (-349.565) (-347.730) [-346.189] * (-345.100) [-345.161] (-349.148) (-345.879) -- 0:00:43
292500 -- (-353.896) (-346.710) [-344.528] (-347.548) * (-344.991) (-347.707) (-352.222) [-347.181] -- 0:00:43
293000 -- (-354.194) [-345.349] (-345.046) (-348.138) * (-345.915) (-345.241) [-350.251] (-347.067) -- 0:00:43
293500 -- (-352.492) (-350.963) [-346.778] (-345.680) * (-345.301) (-347.269) [-346.940] (-346.503) -- 0:00:43
294000 -- [-351.938] (-347.241) (-348.254) (-345.503) * (-345.419) (-345.176) [-346.930] (-346.021) -- 0:00:43
294500 -- (-344.956) [-346.105] (-346.812) (-345.737) * [-347.702] (-345.931) (-348.937) (-348.232) -- 0:00:43
295000 -- (-345.291) (-345.101) [-347.133] (-347.786) * (-350.466) (-346.528) [-348.640] (-348.986) -- 0:00:43
Average standard deviation of split frequencies: 0.014687
295500 -- (-346.729) (-350.384) (-348.711) [-346.509] * [-346.770] (-345.562) (-346.813) (-347.633) -- 0:00:42
296000 -- (-344.398) [-346.009] (-346.310) (-346.987) * (-345.838) (-345.741) [-348.345] (-345.765) -- 0:00:42
296500 -- (-347.344) (-347.912) [-346.549] (-352.334) * [-346.725] (-351.262) (-346.857) (-349.155) -- 0:00:42
297000 -- (-348.195) (-347.860) (-345.451) [-346.836] * (-346.659) (-347.176) [-347.259] (-346.960) -- 0:00:42
297500 -- [-345.896] (-345.158) (-344.793) (-345.452) * [-349.105] (-350.474) (-350.627) (-347.348) -- 0:00:42
298000 -- (-345.741) [-347.563] (-348.707) (-347.450) * (-347.965) (-349.428) (-347.540) [-349.338] -- 0:00:42
298500 -- [-346.543] (-346.990) (-353.475) (-346.513) * (-347.873) (-347.748) [-348.309] (-345.006) -- 0:00:42
299000 -- (-346.055) [-345.416] (-347.916) (-347.047) * [-346.631] (-346.316) (-345.377) (-346.890) -- 0:00:42
299500 -- (-346.897) (-348.140) (-347.618) [-346.474] * (-345.830) (-348.377) [-349.622] (-346.684) -- 0:00:42
300000 -- (-347.785) (-345.780) (-347.032) [-345.993] * (-346.553) (-346.407) (-344.804) [-346.352] -- 0:00:42
Average standard deviation of split frequencies: 0.014372
300500 -- (-347.411) (-345.200) (-344.959) [-347.995] * (-347.097) (-345.395) [-346.265] (-346.385) -- 0:00:41
301000 -- [-349.355] (-351.798) (-346.685) (-348.025) * (-346.910) (-346.835) (-346.536) [-345.927] -- 0:00:41
301500 -- (-346.106) [-346.704] (-348.465) (-348.114) * (-347.078) (-345.475) [-346.998] (-346.454) -- 0:00:41
302000 -- (-347.265) (-345.415) [-347.033] (-347.782) * (-349.184) [-347.792] (-350.755) (-346.681) -- 0:00:43
302500 -- [-346.254] (-348.388) (-346.006) (-347.388) * [-348.855] (-346.547) (-346.704) (-345.777) -- 0:00:43
303000 -- (-345.600) (-349.087) [-346.528] (-345.881) * (-348.770) (-351.560) (-349.496) [-346.163] -- 0:00:43
303500 -- (-345.038) (-347.203) [-350.099] (-348.138) * [-346.068] (-347.545) (-346.965) (-345.020) -- 0:00:43
304000 -- (-345.531) (-345.790) (-347.623) [-345.192] * [-349.877] (-348.992) (-345.491) (-349.988) -- 0:00:43
304500 -- (-345.021) (-347.156) [-345.855] (-345.673) * (-346.259) (-347.399) [-346.519] (-349.022) -- 0:00:43
305000 -- [-347.666] (-346.143) (-347.802) (-349.233) * [-345.793] (-346.638) (-345.240) (-353.901) -- 0:00:43
Average standard deviation of split frequencies: 0.014806
305500 -- [-349.216] (-346.308) (-351.664) (-346.167) * [-348.103] (-345.080) (-345.834) (-349.661) -- 0:00:43
306000 -- (-346.484) (-346.749) (-347.391) [-347.693] * (-349.717) (-345.049) (-346.006) [-348.658] -- 0:00:43
306500 -- (-346.408) [-347.646] (-345.835) (-346.118) * [-345.398] (-347.277) (-347.046) (-347.306) -- 0:00:42
307000 -- [-346.216] (-345.535) (-347.019) (-347.851) * (-345.038) (-349.409) (-347.217) [-345.846] -- 0:00:42
307500 -- (-345.541) [-348.343] (-346.480) (-348.093) * (-346.495) [-347.252] (-344.819) (-345.857) -- 0:00:42
308000 -- (-344.707) (-346.309) [-346.814] (-353.240) * (-353.304) [-346.392] (-347.575) (-347.316) -- 0:00:42
308500 -- [-346.746] (-346.283) (-345.929) (-350.245) * (-347.810) (-345.682) (-348.060) [-347.416] -- 0:00:42
309000 -- (-345.465) [-345.185] (-347.414) (-346.362) * (-346.716) [-346.637] (-347.495) (-346.001) -- 0:00:42
309500 -- (-347.840) (-345.794) [-345.123] (-345.825) * (-348.958) (-345.936) (-347.251) [-345.230] -- 0:00:42
310000 -- (-344.926) (-346.946) [-345.553] (-346.019) * [-346.035] (-347.989) (-350.578) (-346.221) -- 0:00:42
Average standard deviation of split frequencies: 0.015258
310500 -- (-346.419) (-346.805) (-345.679) [-348.712] * [-346.854] (-346.350) (-345.368) (-346.899) -- 0:00:42
311000 -- (-345.504) (-345.742) (-347.156) [-349.928] * (-344.981) (-345.218) [-345.077] (-346.831) -- 0:00:42
311500 -- (-347.701) (-344.664) (-347.790) [-349.293] * (-345.597) (-347.424) (-346.754) [-344.965] -- 0:00:41
312000 -- (-352.402) [-346.252] (-346.549) (-347.078) * (-349.306) [-345.910] (-347.933) (-351.390) -- 0:00:41
312500 -- (-346.696) (-347.660) (-346.151) [-348.763] * [-349.620] (-345.784) (-346.280) (-349.753) -- 0:00:41
313000 -- (-346.531) (-347.321) (-351.420) [-348.313] * [-349.002] (-346.440) (-348.707) (-347.506) -- 0:00:41
313500 -- (-344.381) [-351.441] (-352.814) (-346.502) * (-347.523) (-345.047) (-346.507) [-345.037] -- 0:00:41
314000 -- (-346.699) (-344.937) [-345.699] (-348.632) * (-345.486) [-346.115] (-347.626) (-346.236) -- 0:00:41
314500 -- (-349.990) (-353.836) [-346.420] (-345.324) * (-345.318) [-345.599] (-346.069) (-346.253) -- 0:00:41
315000 -- (-347.664) (-347.873) [-345.376] (-347.305) * [-345.811] (-346.209) (-350.656) (-348.108) -- 0:00:41
Average standard deviation of split frequencies: 0.015830
315500 -- (-345.206) (-350.076) [-346.763] (-349.336) * (-347.880) (-345.265) (-348.203) [-347.217] -- 0:00:41
316000 -- (-345.574) [-345.969] (-344.972) (-349.389) * (-348.875) [-346.404] (-350.214) (-347.909) -- 0:00:41
316500 -- [-347.221] (-345.681) (-345.568) (-348.083) * (-345.884) (-347.347) [-345.621] (-345.587) -- 0:00:41
317000 -- (-346.994) (-347.616) (-348.422) [-345.823] * (-345.123) (-348.298) (-347.812) [-345.801] -- 0:00:40
317500 -- (-344.841) [-347.660] (-345.092) (-344.400) * (-344.443) (-344.960) [-345.060] (-344.647) -- 0:00:40
318000 -- (-348.746) (-347.531) [-344.634] (-346.296) * (-346.206) [-347.589] (-346.041) (-344.330) -- 0:00:40
318500 -- (-346.189) (-348.396) (-347.069) [-344.624] * (-348.086) (-347.646) [-346.465] (-344.844) -- 0:00:40
319000 -- [-345.523] (-345.898) (-349.907) (-346.696) * (-345.821) (-345.796) [-344.983] (-346.045) -- 0:00:42
319500 -- (-349.550) (-344.739) [-345.830] (-344.937) * (-348.713) [-346.658] (-344.739) (-346.019) -- 0:00:42
320000 -- [-346.542] (-345.094) (-346.843) (-345.058) * (-346.825) (-347.617) (-346.484) [-350.845] -- 0:00:42
Average standard deviation of split frequencies: 0.015652
320500 -- [-346.285] (-345.445) (-348.728) (-348.299) * (-349.891) [-345.079] (-346.306) (-346.183) -- 0:00:42
321000 -- (-347.851) (-346.922) (-346.715) [-345.617] * (-346.959) [-345.100] (-344.428) (-345.015) -- 0:00:42
321500 -- (-349.005) [-346.234] (-346.980) (-345.456) * (-348.561) (-348.014) (-347.865) [-345.503] -- 0:00:42
322000 -- (-345.780) (-345.292) (-347.249) [-347.151] * (-348.156) (-346.505) (-345.575) [-345.392] -- 0:00:42
322500 -- (-346.708) (-346.622) [-346.589] (-347.053) * (-345.239) (-345.610) (-347.289) [-345.720] -- 0:00:42
323000 -- (-348.523) (-346.498) [-344.826] (-348.063) * (-347.302) [-347.611] (-344.803) (-346.529) -- 0:00:41
323500 -- (-346.265) (-345.788) [-344.742] (-345.257) * (-348.650) (-345.705) [-345.855] (-345.975) -- 0:00:41
324000 -- (-345.321) (-346.460) (-347.051) [-346.042] * (-345.978) [-346.147] (-346.109) (-347.798) -- 0:00:41
324500 -- (-345.708) (-346.589) (-347.466) [-349.562] * (-344.946) [-345.724] (-349.027) (-347.622) -- 0:00:41
325000 -- (-345.865) (-346.411) (-346.369) [-346.515] * (-348.139) [-345.455] (-347.170) (-344.905) -- 0:00:41
Average standard deviation of split frequencies: 0.014380
325500 -- (-346.809) (-346.364) (-347.029) [-344.947] * (-349.212) (-345.697) [-346.048] (-345.231) -- 0:00:41
326000 -- (-348.831) (-347.123) (-349.738) [-345.142] * (-345.307) [-346.676] (-346.132) (-346.170) -- 0:00:41
326500 -- (-346.129) (-345.967) (-348.870) [-346.049] * (-346.737) [-345.633] (-346.622) (-346.072) -- 0:00:41
327000 -- (-347.987) [-346.850] (-344.893) (-346.877) * (-346.616) [-344.787] (-348.979) (-350.600) -- 0:00:41
327500 -- (-347.246) (-349.970) (-351.927) [-347.953] * (-350.232) [-347.349] (-346.258) (-347.560) -- 0:00:41
328000 -- [-350.432] (-348.101) (-346.723) (-347.990) * (-350.037) (-348.013) (-347.545) [-346.422] -- 0:00:40
328500 -- (-346.439) [-344.726] (-351.533) (-345.990) * (-347.287) (-349.706) (-347.663) [-346.430] -- 0:00:40
329000 -- [-347.851] (-344.718) (-346.760) (-347.801) * (-346.684) [-346.103] (-349.135) (-346.271) -- 0:00:40
329500 -- (-351.523) [-346.449] (-347.193) (-346.502) * (-345.342) (-346.205) (-348.634) [-346.875] -- 0:00:40
330000 -- [-348.665] (-345.090) (-345.776) (-346.112) * (-349.803) [-346.140] (-348.498) (-349.292) -- 0:00:40
Average standard deviation of split frequencies: 0.014177
330500 -- [-349.361] (-347.540) (-345.126) (-348.700) * [-347.185] (-344.657) (-347.633) (-349.005) -- 0:00:40
331000 -- (-346.090) (-350.604) [-344.974] (-346.525) * (-347.123) (-344.450) (-346.866) [-348.300] -- 0:00:40
331500 -- (-350.193) [-347.271] (-346.284) (-345.428) * (-344.724) [-347.249] (-348.361) (-346.964) -- 0:00:40
332000 -- [-346.649] (-348.005) (-346.086) (-347.160) * (-350.139) [-347.223] (-346.755) (-347.041) -- 0:00:40
332500 -- (-349.003) (-349.611) (-348.885) [-345.162] * (-348.121) [-351.299] (-351.279) (-347.066) -- 0:00:40
333000 -- [-344.829] (-346.684) (-353.969) (-348.603) * (-349.861) (-347.208) (-348.925) [-349.052] -- 0:00:40
333500 -- (-345.781) (-352.566) (-345.455) [-346.953] * [-346.279] (-350.870) (-346.295) (-345.699) -- 0:00:39
334000 -- [-347.449] (-348.253) (-345.872) (-348.387) * (-346.980) (-349.792) [-344.977] (-353.506) -- 0:00:39
334500 -- (-346.863) (-345.397) (-344.754) [-344.827] * (-345.552) (-345.444) [-346.659] (-351.938) -- 0:00:39
335000 -- [-345.276] (-347.072) (-344.755) (-348.103) * (-346.018) (-345.184) [-346.613] (-350.619) -- 0:00:39
Average standard deviation of split frequencies: 0.014186
335500 -- (-348.933) (-346.370) (-345.958) [-345.603] * (-345.138) (-345.511) [-347.398] (-348.061) -- 0:00:39
336000 -- (-346.445) [-347.937] (-345.553) (-345.030) * (-348.921) [-344.725] (-345.886) (-347.615) -- 0:00:41
336500 -- (-345.834) (-348.136) (-345.943) [-346.295] * (-350.529) (-347.024) (-346.492) [-346.104] -- 0:00:41
337000 -- (-347.428) (-349.500) (-345.836) [-345.881] * (-347.336) [-351.293] (-349.202) (-347.748) -- 0:00:41
337500 -- (-346.468) (-346.569) (-347.563) [-349.646] * (-345.782) [-347.359] (-350.866) (-346.094) -- 0:00:41
338000 -- (-346.042) (-350.008) [-347.575] (-349.633) * (-346.397) (-347.075) (-348.563) [-348.224] -- 0:00:41
338500 -- [-345.126] (-346.358) (-349.365) (-351.875) * (-346.937) (-347.483) [-345.148] (-349.471) -- 0:00:41
339000 -- (-344.538) (-345.246) [-345.337] (-348.146) * (-349.351) [-346.466] (-345.176) (-347.045) -- 0:00:40
339500 -- (-345.929) [-347.064] (-346.822) (-345.790) * (-349.976) (-345.253) [-344.434] (-345.908) -- 0:00:40
340000 -- (-346.068) [-347.137] (-346.469) (-348.337) * (-353.386) [-349.372] (-344.488) (-351.003) -- 0:00:40
Average standard deviation of split frequencies: 0.013907
340500 -- (-346.123) (-345.394) (-346.547) [-345.794] * (-353.566) (-353.345) [-345.779] (-346.380) -- 0:00:40
341000 -- (-349.325) (-347.183) (-348.720) [-345.735] * (-347.730) [-346.751] (-349.048) (-348.116) -- 0:00:40
341500 -- [-353.419] (-345.401) (-350.884) (-347.592) * (-346.014) (-351.444) [-347.067] (-349.243) -- 0:00:40
342000 -- (-345.814) [-347.461] (-346.014) (-347.814) * (-344.889) (-349.965) [-344.979] (-345.576) -- 0:00:40
342500 -- (-345.266) (-347.140) (-346.141) [-350.187] * [-345.021] (-346.060) (-347.215) (-346.154) -- 0:00:40
343000 -- (-345.056) (-347.134) (-346.938) [-345.707] * [-346.229] (-346.460) (-345.322) (-345.819) -- 0:00:40
343500 -- (-346.606) (-346.293) (-348.238) [-345.446] * (-344.979) (-348.695) [-346.623] (-349.968) -- 0:00:40
344000 -- (-347.976) (-345.715) (-348.291) [-345.675] * (-346.694) (-346.699) [-347.192] (-347.980) -- 0:00:40
344500 -- (-347.340) [-347.098] (-347.312) (-346.302) * (-347.747) [-348.110] (-345.709) (-350.372) -- 0:00:39
345000 -- (-348.505) (-349.081) [-348.753] (-345.155) * (-345.797) [-346.639] (-346.368) (-350.563) -- 0:00:39
Average standard deviation of split frequencies: 0.013148
345500 -- [-346.662] (-345.703) (-346.988) (-345.913) * [-346.243] (-348.386) (-348.421) (-346.809) -- 0:00:39
346000 -- (-346.433) [-348.704] (-347.241) (-345.810) * (-350.617) [-345.586] (-350.738) (-346.658) -- 0:00:39
346500 -- (-346.352) (-348.935) (-345.920) [-349.002] * (-349.718) (-348.170) [-346.651] (-346.606) -- 0:00:39
347000 -- (-346.572) (-348.234) (-345.656) [-346.146] * (-348.965) (-347.707) (-347.028) [-347.843] -- 0:00:39
347500 -- [-344.635] (-348.166) (-346.259) (-348.165) * (-348.061) (-346.709) (-347.460) [-350.409] -- 0:00:39
348000 -- (-345.352) [-345.143] (-346.407) (-348.170) * (-349.133) (-347.449) [-345.226] (-344.535) -- 0:00:39
348500 -- [-346.568] (-346.544) (-346.210) (-347.852) * (-345.180) [-349.728] (-345.116) (-346.060) -- 0:00:39
349000 -- [-347.262] (-345.837) (-347.130) (-349.561) * [-346.711] (-349.251) (-345.141) (-346.227) -- 0:00:39
349500 -- [-346.193] (-348.389) (-347.698) (-349.047) * (-350.732) (-346.536) (-347.032) [-345.758] -- 0:00:39
350000 -- (-346.877) (-347.674) (-350.194) [-346.598] * (-346.477) [-345.759] (-346.557) (-347.101) -- 0:00:39
Average standard deviation of split frequencies: 0.014190
350500 -- (-346.916) (-345.945) [-346.755] (-347.128) * [-347.642] (-345.276) (-347.200) (-348.442) -- 0:00:38
351000 -- (-348.276) (-345.409) [-347.884] (-346.164) * (-347.290) (-345.225) [-348.040] (-347.798) -- 0:00:38
351500 -- (-347.038) [-347.045] (-345.703) (-345.110) * (-351.068) (-346.118) [-345.680] (-346.710) -- 0:00:38
352000 -- (-346.085) (-348.607) [-344.420] (-345.118) * [-345.313] (-346.887) (-349.530) (-351.049) -- 0:00:38
352500 -- (-345.183) [-344.516] (-347.168) (-352.526) * (-348.496) [-346.339] (-350.412) (-349.134) -- 0:00:40
353000 -- (-346.077) (-346.027) (-346.995) [-346.204] * (-345.292) (-346.916) [-348.293] (-345.724) -- 0:00:40
353500 -- [-349.918] (-346.589) (-345.913) (-346.275) * (-346.385) (-346.654) [-346.362] (-345.550) -- 0:00:40
354000 -- (-347.168) [-346.687] (-348.270) (-352.971) * (-346.000) (-345.807) (-348.219) [-346.064] -- 0:00:40
354500 -- [-345.576] (-346.834) (-349.009) (-346.450) * (-348.456) (-345.640) [-344.963] (-345.387) -- 0:00:40
355000 -- [-345.512] (-345.792) (-347.809) (-348.673) * (-346.306) (-349.872) (-345.986) [-346.184] -- 0:00:39
Average standard deviation of split frequencies: 0.014345
355500 -- (-344.945) (-348.730) [-346.109] (-349.300) * (-347.867) (-345.709) (-345.400) [-350.143] -- 0:00:39
356000 -- (-344.864) (-348.097) [-344.348] (-348.869) * (-349.759) (-349.259) (-348.932) [-346.327] -- 0:00:39
356500 -- (-346.454) (-349.627) (-344.829) [-344.842] * [-346.098] (-347.838) (-351.539) (-349.438) -- 0:00:39
357000 -- (-345.071) [-347.456] (-344.741) (-352.236) * (-349.746) [-347.121] (-350.237) (-348.878) -- 0:00:39
357500 -- [-351.265] (-349.873) (-347.639) (-349.799) * (-346.706) [-346.574] (-348.440) (-345.221) -- 0:00:39
358000 -- (-346.452) (-349.382) [-346.218] (-346.964) * (-350.078) [-348.737] (-346.749) (-348.615) -- 0:00:39
358500 -- (-345.594) [-348.134] (-345.999) (-347.175) * (-348.241) (-348.548) [-349.112] (-345.843) -- 0:00:39
359000 -- (-347.717) (-345.959) (-345.090) [-346.676] * (-350.154) (-346.109) [-345.327] (-351.736) -- 0:00:39
359500 -- (-346.536) (-350.221) [-347.536] (-349.606) * [-351.022] (-346.780) (-344.644) (-347.603) -- 0:00:39
360000 -- [-346.195] (-349.624) (-353.070) (-345.624) * (-355.656) (-347.391) [-350.786] (-345.649) -- 0:00:39
Average standard deviation of split frequencies: 0.014595
360500 -- [-345.933] (-346.266) (-347.042) (-347.422) * (-347.634) (-346.550) [-350.695] (-345.164) -- 0:00:39
361000 -- [-345.611] (-345.504) (-347.643) (-347.053) * (-346.454) [-345.178] (-348.197) (-346.525) -- 0:00:38
361500 -- [-347.156] (-346.443) (-349.676) (-346.017) * [-347.766] (-344.620) (-346.075) (-344.855) -- 0:00:38
362000 -- [-346.073] (-348.383) (-346.657) (-345.117) * (-346.309) [-345.807] (-347.801) (-345.160) -- 0:00:38
362500 -- (-345.423) (-348.094) (-349.761) [-345.781] * (-352.394) (-345.169) [-345.244] (-350.756) -- 0:00:38
363000 -- (-346.450) (-347.267) (-348.892) [-347.859] * (-346.146) (-348.056) [-346.584] (-347.301) -- 0:00:38
363500 -- [-349.501] (-347.576) (-350.960) (-346.317) * (-347.731) (-344.978) [-350.032] (-346.309) -- 0:00:38
364000 -- (-345.422) (-348.451) (-346.698) [-350.312] * [-345.138] (-346.433) (-351.819) (-349.696) -- 0:00:38
364500 -- (-346.777) (-345.150) [-347.618] (-346.273) * (-347.863) [-347.215] (-346.963) (-349.894) -- 0:00:38
365000 -- (-349.442) (-346.051) [-344.773] (-345.435) * (-346.149) (-347.006) [-346.139] (-350.683) -- 0:00:38
Average standard deviation of split frequencies: 0.015388
365500 -- (-346.782) [-346.046] (-347.677) (-346.997) * [-346.183] (-345.354) (-346.513) (-347.573) -- 0:00:38
366000 -- [-345.917] (-347.766) (-348.189) (-348.308) * (-346.407) [-346.529] (-345.270) (-348.354) -- 0:00:38
366500 -- (-344.582) [-346.700] (-347.885) (-348.145) * [-345.735] (-345.667) (-346.391) (-347.827) -- 0:00:38
367000 -- (-347.040) [-348.682] (-345.236) (-345.690) * [-345.342] (-348.204) (-348.964) (-346.775) -- 0:00:37
367500 -- (-346.069) [-345.144] (-352.832) (-348.163) * (-346.251) (-347.180) [-347.558] (-346.809) -- 0:00:37
368000 -- (-347.705) (-348.473) [-345.312] (-347.002) * (-346.266) (-347.153) [-346.287] (-346.411) -- 0:00:37
368500 -- (-347.587) (-347.139) (-346.475) [-349.353] * (-345.322) [-347.423] (-345.178) (-347.717) -- 0:00:37
369000 -- [-346.291] (-346.961) (-345.146) (-347.102) * [-345.800] (-347.433) (-348.298) (-348.197) -- 0:00:37
369500 -- (-345.976) [-350.141] (-344.844) (-348.788) * [-344.829] (-350.090) (-345.286) (-347.747) -- 0:00:39
370000 -- (-347.351) (-347.210) (-345.966) [-345.895] * (-345.672) [-347.448] (-345.750) (-345.354) -- 0:00:39
Average standard deviation of split frequencies: 0.013990
370500 -- [-347.005] (-345.736) (-348.671) (-345.317) * (-345.489) (-344.517) [-345.179] (-349.080) -- 0:00:39
371000 -- (-346.655) [-347.782] (-344.603) (-345.309) * (-353.249) (-352.166) [-346.802] (-345.522) -- 0:00:38
371500 -- (-346.130) [-350.509] (-345.010) (-345.701) * (-346.317) (-346.582) (-346.911) [-345.424] -- 0:00:38
372000 -- (-345.618) (-348.473) (-345.873) [-344.596] * (-348.159) (-345.743) [-346.610] (-345.355) -- 0:00:38
372500 -- (-345.359) (-347.528) (-346.057) [-346.345] * (-345.957) (-347.071) (-345.355) [-344.810] -- 0:00:38
373000 -- (-347.801) [-347.242] (-345.922) (-348.594) * [-345.894] (-346.898) (-345.630) (-346.479) -- 0:00:38
373500 -- (-347.322) [-348.165] (-346.953) (-349.114) * (-351.084) [-346.663] (-346.021) (-347.202) -- 0:00:38
374000 -- (-344.698) (-346.139) (-348.039) [-348.106] * (-352.548) (-346.502) [-347.430] (-346.952) -- 0:00:38
374500 -- (-348.155) (-346.441) [-346.558] (-345.111) * [-346.463] (-348.797) (-347.335) (-348.088) -- 0:00:38
375000 -- (-345.544) (-348.218) (-346.877) [-346.234] * (-345.991) (-344.966) [-346.160] (-346.755) -- 0:00:38
Average standard deviation of split frequencies: 0.013025
375500 -- (-345.324) [-346.463] (-344.889) (-346.644) * [-345.314] (-347.029) (-348.996) (-346.220) -- 0:00:38
376000 -- (-345.282) (-347.357) [-347.797] (-346.928) * (-350.152) (-350.630) [-347.757] (-349.166) -- 0:00:38
376500 -- (-346.729) (-346.936) [-346.789] (-348.294) * (-345.951) [-347.302] (-346.858) (-347.969) -- 0:00:38
377000 -- (-351.294) [-347.326] (-349.147) (-357.057) * [-346.501] (-346.141) (-347.091) (-350.057) -- 0:00:38
377500 -- (-348.271) (-352.232) [-344.551] (-351.293) * (-349.706) (-346.267) (-353.083) [-345.945] -- 0:00:37
378000 -- [-347.229] (-348.526) (-347.451) (-348.011) * (-345.114) [-347.185] (-348.516) (-351.841) -- 0:00:37
378500 -- (-345.425) (-346.005) [-346.330] (-350.285) * (-345.621) [-345.763] (-347.222) (-348.160) -- 0:00:37
379000 -- [-347.590] (-345.501) (-346.238) (-346.549) * (-346.198) (-345.339) [-347.351] (-346.296) -- 0:00:37
379500 -- (-345.716) (-349.162) [-347.248] (-349.406) * [-345.654] (-344.990) (-345.139) (-347.524) -- 0:00:37
380000 -- (-345.928) (-350.233) (-347.515) [-345.941] * [-347.329] (-345.097) (-347.437) (-349.033) -- 0:00:37
Average standard deviation of split frequencies: 0.013347
380500 -- [-344.697] (-346.729) (-347.385) (-345.845) * (-345.597) [-348.533] (-346.791) (-349.674) -- 0:00:37
381000 -- (-348.862) (-347.759) (-346.180) [-346.750] * (-345.594) [-346.555] (-345.611) (-349.026) -- 0:00:37
381500 -- (-350.599) (-346.678) [-345.626] (-346.775) * [-344.539] (-345.200) (-347.404) (-350.299) -- 0:00:37
382000 -- (-348.645) [-345.813] (-346.065) (-349.402) * [-348.131] (-345.275) (-347.367) (-351.579) -- 0:00:37
382500 -- (-345.564) (-344.990) (-347.741) [-347.385] * (-346.961) [-347.375] (-345.407) (-347.622) -- 0:00:37
383000 -- [-345.580] (-346.653) (-346.663) (-345.164) * (-347.555) (-347.674) [-344.486] (-345.513) -- 0:00:37
383500 -- [-346.554] (-348.841) (-345.359) (-348.525) * (-349.558) (-345.020) (-347.613) [-346.035] -- 0:00:36
384000 -- (-345.667) (-345.249) (-346.821) [-347.142] * (-348.239) (-346.780) [-347.933] (-346.966) -- 0:00:36
384500 -- (-346.640) [-347.219] (-347.277) (-345.996) * (-348.227) (-347.864) [-349.327] (-347.161) -- 0:00:36
385000 -- [-347.640] (-352.810) (-346.057) (-345.679) * (-347.794) (-346.319) (-346.872) [-345.227] -- 0:00:36
Average standard deviation of split frequencies: 0.013366
385500 -- [-351.293] (-346.148) (-346.975) (-345.069) * [-352.497] (-347.444) (-345.869) (-344.998) -- 0:00:36
386000 -- [-347.833] (-348.665) (-345.793) (-347.002) * (-345.600) (-348.425) [-345.086] (-345.884) -- 0:00:36
386500 -- (-345.812) (-351.267) (-346.878) [-344.867] * (-345.443) [-346.386] (-350.737) (-356.252) -- 0:00:38
387000 -- (-346.181) (-349.369) (-349.518) [-344.966] * (-352.702) (-345.020) [-348.373] (-347.395) -- 0:00:38
387500 -- (-351.970) (-347.749) [-346.524] (-346.174) * (-347.440) [-346.994] (-348.699) (-348.102) -- 0:00:37
388000 -- (-347.486) (-346.132) (-347.272) [-344.776] * [-348.707] (-345.728) (-346.662) (-346.010) -- 0:00:37
388500 -- (-347.514) (-345.951) (-345.572) [-346.427] * [-349.149] (-344.876) (-348.551) (-346.375) -- 0:00:37
389000 -- (-347.960) (-346.126) [-346.759] (-347.522) * (-347.560) [-347.391] (-348.631) (-348.238) -- 0:00:37
389500 -- (-346.812) (-344.525) [-344.944] (-345.143) * [-347.199] (-348.618) (-352.579) (-352.921) -- 0:00:37
390000 -- (-347.578) [-347.921] (-347.680) (-344.776) * (-348.193) [-347.101] (-348.916) (-347.065) -- 0:00:37
Average standard deviation of split frequencies: 0.013474
390500 -- (-347.898) [-346.914] (-345.990) (-344.580) * (-348.862) (-348.097) [-348.483] (-348.083) -- 0:00:37
391000 -- (-347.634) (-350.912) (-345.389) [-345.432] * (-345.194) [-344.696] (-346.283) (-346.754) -- 0:00:37
391500 -- [-346.018] (-345.689) (-346.224) (-348.497) * (-348.264) [-344.374] (-349.475) (-345.966) -- 0:00:37
392000 -- (-345.937) (-347.512) [-346.539] (-345.511) * [-347.638] (-344.787) (-346.047) (-346.099) -- 0:00:37
392500 -- (-348.238) (-347.771) [-349.280] (-345.370) * (-347.629) (-348.419) [-346.603] (-345.175) -- 0:00:37
393000 -- (-349.675) (-349.065) (-349.217) [-345.848] * [-347.048] (-350.017) (-344.605) (-350.540) -- 0:00:37
393500 -- (-348.798) (-346.084) [-348.345] (-347.680) * (-346.449) (-349.258) [-348.287] (-344.507) -- 0:00:36
394000 -- (-344.944) (-346.541) (-345.245) [-346.710] * (-346.478) [-346.430] (-348.689) (-345.599) -- 0:00:36
394500 -- (-348.052) (-347.705) [-345.419] (-347.999) * (-346.108) (-347.124) (-347.815) [-346.014] -- 0:00:36
395000 -- (-344.585) (-346.349) (-349.019) [-347.251] * (-345.465) [-347.245] (-345.264) (-346.913) -- 0:00:36
Average standard deviation of split frequencies: 0.012744
395500 -- (-348.250) (-345.776) [-345.289] (-346.556) * [-345.791] (-348.395) (-345.403) (-348.534) -- 0:00:36
396000 -- (-354.236) [-347.941] (-346.906) (-345.343) * [-345.766] (-344.950) (-348.811) (-346.267) -- 0:00:36
396500 -- [-350.047] (-347.870) (-346.953) (-346.275) * (-345.259) (-345.668) (-347.079) [-345.153] -- 0:00:36
397000 -- [-346.692] (-345.208) (-349.502) (-350.354) * (-351.119) (-348.729) [-347.058] (-346.900) -- 0:00:36
397500 -- (-345.092) (-349.306) [-348.391] (-346.590) * (-348.979) [-345.547] (-347.339) (-346.697) -- 0:00:36
398000 -- [-349.721] (-348.611) (-345.286) (-345.182) * (-347.735) (-348.862) [-346.111] (-351.881) -- 0:00:36
398500 -- (-346.454) (-347.532) [-348.421] (-344.887) * [-346.766] (-350.112) (-346.472) (-350.203) -- 0:00:36
399000 -- (-350.960) [-347.089] (-345.685) (-347.978) * [-346.396] (-347.392) (-346.382) (-348.319) -- 0:00:36
399500 -- (-346.776) (-347.100) (-347.159) [-345.106] * [-347.526] (-346.050) (-345.853) (-345.699) -- 0:00:36
400000 -- [-346.597] (-345.741) (-347.258) (-345.671) * [-348.912] (-347.131) (-345.533) (-345.915) -- 0:00:36
Average standard deviation of split frequencies: 0.012942
400500 -- (-345.047) (-349.002) (-345.613) [-348.261] * (-347.732) (-347.647) [-347.356] (-344.768) -- 0:00:35
401000 -- (-347.113) (-346.439) (-345.471) [-345.284] * (-346.490) (-347.238) [-347.364] (-345.246) -- 0:00:35
401500 -- (-345.265) (-349.301) [-345.323] (-348.111) * (-344.962) (-345.825) [-345.127] (-346.171) -- 0:00:35
402000 -- [-344.875] (-351.466) (-346.814) (-345.504) * (-346.365) (-345.898) [-347.876] (-345.030) -- 0:00:35
402500 -- [-345.431] (-349.480) (-348.963) (-347.046) * (-345.238) (-347.223) (-345.586) [-351.576] -- 0:00:35
403000 -- (-345.457) [-345.059] (-347.222) (-347.975) * (-346.486) (-347.330) (-344.384) [-346.934] -- 0:00:37
403500 -- (-345.453) [-350.762] (-347.331) (-348.832) * (-346.369) (-348.338) [-346.427] (-347.753) -- 0:00:36
404000 -- [-346.809] (-349.575) (-351.750) (-345.319) * (-347.254) (-344.394) [-345.269] (-346.066) -- 0:00:36
404500 -- (-347.661) (-354.584) (-348.052) [-348.324] * (-349.897) [-346.803] (-352.094) (-347.275) -- 0:00:36
405000 -- (-345.113) (-346.162) (-349.365) [-348.615] * [-349.329] (-347.861) (-346.780) (-344.729) -- 0:00:36
Average standard deviation of split frequencies: 0.012840
405500 -- (-346.284) [-344.288] (-349.835) (-348.161) * (-345.860) [-345.619] (-346.774) (-349.426) -- 0:00:36
406000 -- (-345.730) (-346.879) (-352.263) [-345.121] * [-345.600] (-347.744) (-346.655) (-347.347) -- 0:00:36
406500 -- (-347.134) (-345.782) (-346.091) [-344.899] * (-346.762) (-348.223) (-346.208) [-347.406] -- 0:00:36
407000 -- [-346.424] (-345.689) (-347.906) (-345.931) * [-346.657] (-345.466) (-344.970) (-346.424) -- 0:00:36
407500 -- (-345.579) (-346.962) [-346.686] (-345.319) * (-347.166) (-348.009) (-346.006) [-350.834] -- 0:00:36
408000 -- (-345.748) (-346.859) (-349.536) [-347.571] * (-345.603) (-346.864) [-346.542] (-347.790) -- 0:00:36
408500 -- (-348.290) (-345.575) [-345.756] (-344.838) * (-346.771) (-344.671) (-347.602) [-346.168] -- 0:00:36
409000 -- (-345.749) [-348.123] (-346.369) (-347.029) * [-346.568] (-345.778) (-347.552) (-347.863) -- 0:00:36
409500 -- (-347.779) (-347.608) (-344.801) [-344.879] * (-348.455) (-347.753) [-351.729] (-347.279) -- 0:00:36
410000 -- (-350.039) [-348.381] (-345.687) (-347.338) * (-346.702) (-347.102) [-347.032] (-347.691) -- 0:00:35
Average standard deviation of split frequencies: 0.014016
410500 -- (-349.104) (-346.649) (-349.360) [-345.231] * (-347.488) (-346.166) (-346.492) [-347.797] -- 0:00:35
411000 -- (-348.573) (-345.713) [-347.817] (-349.548) * (-345.407) (-347.430) (-346.117) [-347.423] -- 0:00:35
411500 -- (-345.614) [-349.437] (-344.679) (-345.028) * (-347.390) [-349.241] (-347.510) (-344.878) -- 0:00:35
412000 -- [-345.767] (-349.433) (-344.397) (-346.638) * (-348.430) (-345.578) (-346.013) [-345.236] -- 0:00:35
412500 -- (-345.368) (-347.269) (-347.218) [-346.754] * (-346.137) (-345.447) [-347.644] (-348.051) -- 0:00:35
413000 -- (-348.149) [-352.436] (-345.969) (-348.235) * (-347.217) (-346.409) (-348.105) [-346.553] -- 0:00:35
413500 -- (-347.608) (-349.933) [-349.130] (-346.350) * (-346.133) [-346.220] (-345.250) (-345.271) -- 0:00:35
414000 -- (-346.411) [-347.385] (-347.249) (-348.251) * [-355.782] (-345.093) (-345.282) (-350.268) -- 0:00:35
414500 -- (-346.831) (-347.559) [-346.420] (-347.669) * (-346.474) [-345.519] (-346.906) (-348.335) -- 0:00:35
415000 -- (-345.008) [-345.259] (-348.047) (-346.893) * [-345.813] (-346.821) (-347.286) (-345.567) -- 0:00:35
Average standard deviation of split frequencies: 0.014354
415500 -- (-346.153) (-347.035) (-346.431) [-345.962] * [-349.413] (-352.058) (-347.809) (-346.555) -- 0:00:35
416000 -- (-346.063) (-347.461) [-348.033] (-346.496) * (-348.012) (-352.051) (-352.852) [-345.696] -- 0:00:35
416500 -- (-352.886) (-346.577) [-349.374] (-346.690) * (-345.414) (-347.890) [-346.567] (-346.992) -- 0:00:35
417000 -- [-348.624] (-351.706) (-347.225) (-346.585) * (-349.362) (-347.832) [-345.363] (-348.527) -- 0:00:34
417500 -- (-346.381) (-346.096) [-346.344] (-344.831) * (-347.064) (-352.290) (-345.788) [-347.160] -- 0:00:34
418000 -- (-347.348) (-347.940) (-346.001) [-347.668] * [-346.158] (-345.394) (-350.772) (-351.147) -- 0:00:34
418500 -- (-350.791) [-347.422] (-345.840) (-346.807) * [-348.425] (-347.387) (-346.984) (-353.256) -- 0:00:36
419000 -- [-346.482] (-347.408) (-345.644) (-346.756) * (-345.876) (-346.425) (-348.015) [-346.426] -- 0:00:36
419500 -- (-351.972) (-351.096) [-345.232] (-347.297) * (-347.696) (-346.379) [-346.968] (-347.315) -- 0:00:35
420000 -- (-350.311) [-348.867] (-348.437) (-347.424) * [-348.992] (-346.004) (-346.113) (-345.495) -- 0:00:35
Average standard deviation of split frequencies: 0.013696
420500 -- (-345.725) [-346.136] (-346.127) (-345.520) * [-346.636] (-344.532) (-346.698) (-347.257) -- 0:00:35
421000 -- (-345.172) (-346.020) [-346.953] (-347.917) * [-347.073] (-346.374) (-345.146) (-344.971) -- 0:00:35
421500 -- (-347.931) (-346.489) [-348.674] (-347.833) * (-346.200) (-349.153) [-347.458] (-344.472) -- 0:00:35
422000 -- (-348.072) [-346.767] (-350.032) (-350.344) * [-344.967] (-345.905) (-347.414) (-345.780) -- 0:00:35
422500 -- (-345.890) [-344.955] (-345.446) (-347.976) * (-347.320) (-346.802) (-346.288) [-347.505] -- 0:00:35
423000 -- (-345.815) (-344.991) (-347.184) [-349.465] * (-349.278) (-347.579) (-345.300) [-345.795] -- 0:00:35
423500 -- (-350.772) [-345.599] (-345.374) (-345.242) * [-347.419] (-347.029) (-348.936) (-345.348) -- 0:00:35
424000 -- (-346.408) (-346.785) [-347.672] (-345.579) * (-347.529) (-344.931) [-346.497] (-345.462) -- 0:00:35
424500 -- (-348.354) (-347.446) [-349.347] (-347.483) * (-344.967) [-345.783] (-347.281) (-345.335) -- 0:00:35
425000 -- (-345.968) [-347.114] (-348.492) (-345.256) * [-346.140] (-344.732) (-348.415) (-348.108) -- 0:00:35
Average standard deviation of split frequencies: 0.012972
425500 -- (-345.997) (-352.111) [-347.136] (-348.652) * (-345.965) (-345.549) (-346.991) [-347.190] -- 0:00:35
426000 -- [-345.653] (-346.303) (-346.913) (-350.344) * (-346.607) (-346.989) (-348.036) [-349.113] -- 0:00:35
426500 -- (-345.879) (-347.916) [-348.934] (-345.895) * [-346.191] (-347.773) (-348.648) (-347.753) -- 0:00:34
427000 -- (-346.460) (-349.853) (-349.611) [-344.944] * (-346.978) (-348.001) (-345.714) [-347.471] -- 0:00:34
427500 -- (-346.430) [-347.199] (-347.865) (-348.318) * [-345.614] (-347.969) (-348.437) (-346.280) -- 0:00:34
428000 -- (-347.936) (-346.149) (-349.116) [-345.979] * (-345.067) (-347.908) [-348.168] (-345.013) -- 0:00:34
428500 -- (-344.752) (-345.943) (-345.150) [-345.429] * (-346.624) (-349.325) (-346.334) [-346.949] -- 0:00:34
429000 -- [-346.061] (-346.383) (-345.343) (-354.819) * [-346.616] (-348.208) (-347.306) (-347.486) -- 0:00:34
429500 -- [-347.900] (-349.465) (-345.268) (-347.691) * (-346.493) (-344.976) [-346.433] (-346.718) -- 0:00:34
430000 -- (-348.611) [-348.580] (-346.563) (-348.457) * (-346.119) (-346.757) (-347.106) [-346.025] -- 0:00:34
Average standard deviation of split frequencies: 0.013196
430500 -- (-345.621) [-345.151] (-347.373) (-345.035) * (-348.582) (-346.668) (-348.910) [-346.594] -- 0:00:34
431000 -- (-347.488) [-345.079] (-348.003) (-350.986) * (-346.632) (-348.370) (-349.634) [-347.935] -- 0:00:34
431500 -- (-345.127) [-344.964] (-345.378) (-348.933) * (-346.177) (-347.959) [-344.672] (-356.524) -- 0:00:35
432000 -- [-346.949] (-346.949) (-345.409) (-345.490) * (-347.900) (-346.240) [-344.664] (-350.191) -- 0:00:35
432500 -- (-346.420) (-346.223) (-345.017) [-347.206] * [-348.769] (-347.775) (-345.780) (-346.356) -- 0:00:35
433000 -- [-347.418] (-348.020) (-344.520) (-346.633) * (-348.321) (-350.859) (-345.054) [-348.188] -- 0:00:35
433500 -- (-347.494) (-346.898) [-348.023] (-346.447) * (-346.084) (-349.354) (-346.401) [-345.387] -- 0:00:35
434000 -- [-346.743] (-347.956) (-347.346) (-350.375) * [-346.323] (-348.195) (-346.687) (-346.372) -- 0:00:35
434500 -- (-349.362) (-348.377) (-348.731) [-347.853] * (-348.509) (-353.717) [-352.893] (-346.398) -- 0:00:35
435000 -- [-345.022] (-347.196) (-350.079) (-347.931) * (-346.297) (-352.543) [-348.538] (-346.117) -- 0:00:35
Average standard deviation of split frequencies: 0.013215
435500 -- (-345.970) (-348.973) [-349.004] (-346.011) * (-347.237) (-349.666) [-346.096] (-346.948) -- 0:00:34
436000 -- (-345.951) (-346.658) [-345.652] (-345.180) * (-346.208) (-345.331) (-345.554) [-347.895] -- 0:00:34
436500 -- (-347.884) (-346.633) (-347.070) [-349.121] * [-346.728] (-344.527) (-349.721) (-345.526) -- 0:00:34
437000 -- (-346.376) (-346.229) (-344.951) [-350.317] * (-347.003) [-344.509] (-346.215) (-346.514) -- 0:00:34
437500 -- (-347.020) [-346.293] (-347.492) (-348.689) * [-345.768] (-345.777) (-344.819) (-347.598) -- 0:00:34
438000 -- (-346.843) (-350.253) [-345.457] (-347.756) * [-347.728] (-350.312) (-346.833) (-344.882) -- 0:00:34
438500 -- [-347.330] (-347.190) (-346.884) (-346.403) * (-346.572) (-346.415) (-346.501) [-349.241] -- 0:00:34
439000 -- (-345.621) (-346.751) (-346.872) [-346.682] * (-345.668) (-347.361) [-348.763] (-348.829) -- 0:00:34
439500 -- (-345.528) (-345.800) [-345.797] (-352.212) * (-345.333) (-345.837) (-347.081) [-346.477] -- 0:00:34
440000 -- (-346.449) (-346.094) (-347.903) [-348.363] * (-344.813) [-345.605] (-348.306) (-346.822) -- 0:00:34
Average standard deviation of split frequencies: 0.013194
440500 -- (-350.700) [-346.956] (-347.145) (-347.054) * (-344.636) (-351.718) (-350.127) [-344.584] -- 0:00:34
441000 -- (-346.919) (-348.989) [-348.726] (-346.076) * [-345.885] (-348.739) (-345.586) (-345.789) -- 0:00:34
441500 -- (-347.495) [-344.754] (-344.969) (-346.327) * (-348.866) [-347.513] (-346.220) (-345.259) -- 0:00:34
442000 -- (-348.222) (-346.609) (-346.624) [-349.757] * (-345.652) (-345.389) [-346.298] (-346.300) -- 0:00:34
442500 -- [-346.522] (-346.121) (-345.671) (-349.071) * [-345.855] (-348.720) (-347.412) (-347.564) -- 0:00:34
443000 -- (-346.222) (-347.907) (-344.318) [-349.244] * (-345.394) (-348.929) (-345.540) [-348.720] -- 0:00:33
443500 -- (-345.359) [-344.627] (-345.907) (-346.334) * (-346.381) (-348.172) (-348.873) [-347.178] -- 0:00:33
444000 -- [-349.153] (-347.568) (-345.685) (-348.241) * (-348.380) (-348.544) (-351.151) [-345.634] -- 0:00:33
444500 -- [-350.087] (-351.557) (-348.053) (-345.074) * (-345.143) (-345.819) (-345.360) [-345.211] -- 0:00:34
445000 -- [-349.172] (-349.916) (-345.611) (-345.761) * (-345.989) (-345.903) [-351.340] (-345.574) -- 0:00:34
Average standard deviation of split frequencies: 0.013564
445500 -- (-346.008) (-350.295) (-345.271) [-345.675] * (-348.545) [-347.105] (-351.459) (-347.071) -- 0:00:34
446000 -- [-345.770] (-349.986) (-346.851) (-346.229) * (-350.757) [-345.414] (-347.350) (-346.304) -- 0:00:34
446500 -- (-347.938) (-346.081) [-346.685] (-349.032) * (-348.471) (-345.469) (-345.437) [-347.441] -- 0:00:34
447000 -- (-345.480) [-351.315] (-346.063) (-347.633) * (-348.004) [-347.407] (-346.711) (-345.409) -- 0:00:34
447500 -- (-345.594) (-349.014) [-345.486] (-345.041) * (-346.859) [-345.702] (-345.953) (-346.246) -- 0:00:34
448000 -- (-344.887) [-347.135] (-346.743) (-346.450) * (-352.107) (-347.002) [-349.320] (-347.452) -- 0:00:34
448500 -- [-345.178] (-346.879) (-347.021) (-347.451) * (-349.219) (-346.648) [-347.356] (-348.203) -- 0:00:34
449000 -- (-344.997) (-346.922) [-347.504] (-348.060) * (-346.874) (-346.872) [-345.829] (-346.659) -- 0:00:34
449500 -- [-345.585] (-347.717) (-349.085) (-348.161) * [-346.576] (-346.729) (-348.022) (-346.814) -- 0:00:34
450000 -- (-346.978) (-348.351) (-345.907) [-345.969] * (-345.218) (-349.028) [-346.332] (-346.380) -- 0:00:34
Average standard deviation of split frequencies: 0.013947
450500 -- (-347.895) (-353.588) [-345.922] (-347.147) * [-345.209] (-346.900) (-345.851) (-349.908) -- 0:00:34
451000 -- (-348.744) [-345.770] (-345.262) (-349.955) * [-347.989] (-352.192) (-347.098) (-346.895) -- 0:00:34
451500 -- (-345.596) (-345.730) (-344.799) [-346.141] * [-346.394] (-350.074) (-346.729) (-346.817) -- 0:00:34
452000 -- [-345.754] (-346.849) (-346.325) (-349.125) * (-345.463) (-348.941) [-346.934] (-347.483) -- 0:00:33
452500 -- (-347.760) (-348.046) [-347.756] (-349.119) * (-345.199) [-346.089] (-348.578) (-345.118) -- 0:00:33
453000 -- (-347.216) [-350.064] (-346.750) (-345.459) * [-344.837] (-347.137) (-349.062) (-344.698) -- 0:00:33
453500 -- [-347.275] (-348.227) (-346.095) (-347.587) * (-346.511) [-346.098] (-346.527) (-346.760) -- 0:00:33
454000 -- (-345.548) (-349.956) (-345.984) [-345.862] * [-345.115] (-346.261) (-347.217) (-344.805) -- 0:00:33
454500 -- (-348.644) (-345.034) (-350.117) [-346.861] * (-348.683) (-345.582) [-346.048] (-347.687) -- 0:00:33
455000 -- (-345.449) (-345.371) (-347.992) [-349.634] * (-346.103) (-346.676) [-345.189] (-345.049) -- 0:00:33
Average standard deviation of split frequencies: 0.013784
455500 -- (-349.289) [-345.161] (-345.641) (-349.448) * (-348.057) [-348.061] (-345.103) (-346.078) -- 0:00:33
456000 -- [-346.340] (-346.605) (-344.321) (-349.010) * (-345.920) [-345.837] (-346.950) (-345.840) -- 0:00:33
456500 -- (-348.209) (-344.799) (-345.209) [-348.057] * (-345.749) [-344.921] (-348.498) (-345.702) -- 0:00:33
457000 -- (-345.343) (-346.778) (-346.592) [-345.889] * (-345.883) (-344.803) [-345.715] (-346.013) -- 0:00:34
457500 -- (-349.389) (-349.885) [-346.285] (-347.722) * (-346.659) (-347.131) (-348.767) [-347.566] -- 0:00:34
458000 -- [-346.770] (-346.061) (-345.093) (-348.058) * (-345.897) (-350.160) [-346.907] (-347.574) -- 0:00:34
458500 -- (-346.148) (-346.857) (-351.666) [-346.254] * (-345.518) [-346.889] (-347.147) (-346.126) -- 0:00:34
459000 -- (-349.525) (-346.398) (-347.207) [-344.729] * (-346.098) [-346.806] (-350.563) (-345.414) -- 0:00:34
459500 -- (-344.880) (-349.424) (-345.247) [-345.483] * (-345.661) (-348.806) [-345.336] (-347.455) -- 0:00:34
460000 -- (-346.034) [-345.744] (-347.267) (-350.169) * [-345.724] (-352.527) (-344.778) (-349.209) -- 0:00:34
Average standard deviation of split frequencies: 0.013530
460500 -- [-346.796] (-347.485) (-347.897) (-346.679) * (-348.745) [-351.790] (-347.076) (-346.488) -- 0:00:33
461000 -- [-349.053] (-348.056) (-346.542) (-347.470) * [-347.582] (-347.607) (-346.454) (-345.631) -- 0:00:33
461500 -- (-346.073) (-346.323) [-346.766] (-346.666) * (-350.537) (-350.341) [-347.882] (-344.903) -- 0:00:33
462000 -- (-346.527) (-346.904) (-346.086) [-346.677] * (-347.378) (-352.641) [-345.565] (-347.886) -- 0:00:33
462500 -- [-347.408] (-349.469) (-347.628) (-349.175) * (-346.105) [-346.928] (-344.916) (-344.479) -- 0:00:33
463000 -- [-346.749] (-349.684) (-348.390) (-348.592) * [-345.670] (-347.680) (-352.769) (-346.306) -- 0:00:33
463500 -- (-349.908) (-347.021) (-347.760) [-346.579] * (-346.489) (-347.302) (-349.487) [-345.107] -- 0:00:33
464000 -- [-347.590] (-349.459) (-347.516) (-345.152) * (-349.580) (-351.518) (-344.850) [-346.545] -- 0:00:33
464500 -- (-344.559) (-349.439) [-351.449] (-346.757) * (-351.430) (-350.720) [-348.287] (-346.224) -- 0:00:33
465000 -- [-347.188] (-348.804) (-345.485) (-348.076) * (-351.010) (-349.643) (-347.311) [-349.057] -- 0:00:33
Average standard deviation of split frequencies: 0.013657
465500 -- (-345.658) [-345.325] (-351.530) (-345.535) * (-346.079) (-345.972) (-347.057) [-346.241] -- 0:00:33
466000 -- [-344.730] (-345.868) (-345.754) (-348.210) * (-347.712) (-346.221) [-346.776] (-346.045) -- 0:00:33
466500 -- [-345.265] (-349.528) (-352.270) (-347.149) * (-347.125) (-347.381) (-345.696) [-346.411] -- 0:00:33
467000 -- [-345.383] (-347.770) (-350.389) (-347.347) * (-346.273) (-347.415) (-345.358) [-345.807] -- 0:00:33
467500 -- [-346.770] (-348.052) (-349.545) (-351.572) * [-348.282] (-345.612) (-346.758) (-347.679) -- 0:00:33
468000 -- (-347.085) (-345.291) [-347.129] (-353.383) * (-346.767) (-348.658) (-347.111) [-346.252] -- 0:00:32
468500 -- (-347.608) [-346.810] (-344.956) (-348.250) * [-344.899] (-346.236) (-346.079) (-350.058) -- 0:00:32
469000 -- (-345.115) (-345.044) [-346.573] (-345.091) * (-346.097) (-346.679) (-347.809) [-347.740] -- 0:00:32
469500 -- (-348.682) (-345.091) [-346.424] (-347.958) * [-345.018] (-349.443) (-348.222) (-345.466) -- 0:00:32
470000 -- [-349.922] (-346.764) (-350.596) (-345.098) * (-348.118) [-344.636] (-345.673) (-345.374) -- 0:00:32
Average standard deviation of split frequencies: 0.013132
470500 -- (-346.615) [-345.278] (-346.246) (-346.419) * (-356.170) [-344.758] (-346.721) (-351.005) -- 0:00:33
471000 -- (-345.335) (-345.319) [-347.434] (-345.361) * (-354.460) (-346.050) [-345.323] (-346.746) -- 0:00:33
471500 -- (-349.007) (-345.747) (-350.791) [-345.401] * (-350.665) (-345.245) [-345.582] (-350.132) -- 0:00:33
472000 -- (-350.031) (-345.572) [-354.047] (-345.296) * [-350.053] (-344.900) (-347.533) (-346.259) -- 0:00:33
472500 -- [-346.073] (-358.220) (-349.119) (-344.803) * (-345.775) (-345.101) [-344.655] (-346.808) -- 0:00:33
473000 -- [-346.035] (-351.775) (-348.437) (-348.284) * (-345.332) [-348.525] (-349.405) (-349.956) -- 0:00:33
473500 -- [-346.414] (-346.004) (-349.600) (-349.703) * (-345.048) [-345.998] (-344.853) (-345.066) -- 0:00:33
474000 -- (-345.605) (-347.014) [-346.005] (-346.901) * [-346.845] (-345.845) (-345.687) (-349.422) -- 0:00:33
474500 -- (-345.094) (-346.346) [-349.743] (-348.159) * (-345.160) (-346.828) [-345.876] (-349.003) -- 0:00:33
475000 -- (-348.116) [-350.782] (-345.720) (-348.620) * (-350.509) [-347.501] (-349.290) (-346.873) -- 0:00:33
Average standard deviation of split frequencies: 0.013150
475500 -- (-347.581) (-348.573) [-346.220] (-346.057) * (-345.997) [-349.845] (-346.890) (-346.560) -- 0:00:33
476000 -- (-349.160) [-348.002] (-346.133) (-346.336) * (-348.721) (-351.036) (-344.557) [-346.282] -- 0:00:33
476500 -- (-346.215) (-348.376) [-349.755] (-347.463) * (-348.495) (-348.210) (-345.115) [-345.719] -- 0:00:32
477000 -- (-346.415) (-345.180) [-346.034] (-349.407) * (-345.392) (-350.285) [-347.588] (-349.412) -- 0:00:32
477500 -- (-347.278) (-345.046) [-346.760] (-346.077) * [-346.244] (-345.732) (-347.425) (-345.168) -- 0:00:32
478000 -- (-347.857) (-348.618) (-345.192) [-345.773] * (-345.273) (-345.549) [-346.662] (-349.033) -- 0:00:32
478500 -- (-347.043) (-346.636) [-346.063] (-348.156) * [-346.380] (-346.521) (-346.977) (-349.369) -- 0:00:32
479000 -- (-345.479) (-345.292) [-347.289] (-345.527) * (-345.415) [-347.424] (-350.022) (-348.591) -- 0:00:32
479500 -- (-348.462) (-346.751) [-348.699] (-345.782) * [-347.537] (-347.538) (-347.240) (-350.110) -- 0:00:32
480000 -- [-347.099] (-347.146) (-346.134) (-344.803) * (-347.808) (-346.253) (-345.521) [-347.891] -- 0:00:32
Average standard deviation of split frequencies: 0.012586
480500 -- (-346.160) (-348.745) (-350.000) [-344.769] * (-345.911) [-348.339] (-349.590) (-348.179) -- 0:00:32
481000 -- (-345.872) (-349.551) [-344.877] (-344.527) * (-344.990) (-352.353) (-352.737) [-346.311] -- 0:00:32
481500 -- [-345.990] (-350.122) (-344.849) (-346.214) * (-345.174) [-346.390] (-347.224) (-349.196) -- 0:00:32
482000 -- (-345.819) [-345.515] (-350.109) (-346.064) * (-348.187) [-345.980] (-345.263) (-346.664) -- 0:00:32
482500 -- [-346.271] (-347.283) (-350.315) (-350.416) * (-345.501) (-347.613) [-347.204] (-351.957) -- 0:00:32
483000 -- (-349.455) (-351.770) (-347.264) [-346.989] * (-346.362) [-347.342] (-346.533) (-344.666) -- 0:00:32
483500 -- [-344.846] (-352.733) (-347.026) (-345.694) * (-348.514) [-347.057] (-344.708) (-345.337) -- 0:00:33
484000 -- (-347.761) [-348.464] (-351.254) (-345.781) * (-347.796) (-349.675) [-345.129] (-348.409) -- 0:00:33
484500 -- [-348.287] (-348.487) (-348.217) (-348.320) * (-350.676) (-349.331) [-344.574] (-347.635) -- 0:00:32
485000 -- (-353.236) [-347.784] (-345.108) (-346.002) * (-346.858) [-345.709] (-345.726) (-347.368) -- 0:00:32
Average standard deviation of split frequencies: 0.012771
485500 -- (-345.206) (-346.827) (-345.282) [-345.958] * (-347.892) [-348.196] (-345.868) (-346.360) -- 0:00:32
486000 -- (-348.281) (-345.617) (-346.504) [-348.569] * [-345.549] (-348.293) (-346.127) (-346.932) -- 0:00:32
486500 -- [-347.464] (-346.337) (-345.660) (-345.239) * (-345.731) (-347.110) (-344.869) [-346.436] -- 0:00:32
487000 -- [-345.263] (-346.219) (-349.019) (-346.830) * (-346.504) (-348.201) [-345.673] (-345.747) -- 0:00:32
487500 -- (-348.974) (-345.850) (-349.504) [-344.764] * [-347.231] (-350.605) (-348.507) (-345.132) -- 0:00:32
488000 -- [-346.309] (-347.361) (-352.176) (-344.992) * (-345.621) (-345.827) [-347.672] (-344.815) -- 0:00:32
488500 -- (-346.299) (-347.124) [-345.243] (-346.214) * (-347.725) [-344.933] (-346.080) (-345.454) -- 0:00:32
489000 -- [-347.427] (-348.693) (-345.156) (-345.296) * (-347.423) [-345.980] (-346.111) (-346.107) -- 0:00:32
489500 -- (-345.118) [-347.410] (-346.455) (-349.558) * (-347.379) [-345.081] (-346.417) (-347.460) -- 0:00:32
490000 -- (-347.008) (-345.097) [-345.424] (-350.169) * (-350.990) (-345.689) (-347.886) [-344.736] -- 0:00:32
Average standard deviation of split frequencies: 0.013931
490500 -- (-348.835) [-345.625] (-350.956) (-348.094) * [-346.631] (-349.973) (-347.652) (-346.244) -- 0:00:32
491000 -- (-346.093) (-346.816) [-348.490] (-345.454) * [-346.096] (-346.048) (-349.802) (-345.668) -- 0:00:32
491500 -- (-347.690) (-346.681) (-354.691) [-346.748] * (-346.745) (-345.876) [-347.463] (-346.221) -- 0:00:32
492000 -- (-346.656) (-348.060) (-349.620) [-347.847] * (-348.631) [-346.192] (-348.914) (-344.561) -- 0:00:32
492500 -- (-347.706) (-347.973) [-347.511] (-348.314) * (-345.934) (-346.012) [-350.281] (-346.983) -- 0:00:31
493000 -- (-352.496) [-349.015] (-347.596) (-345.769) * (-345.490) (-344.944) [-346.052] (-347.634) -- 0:00:31
493500 -- [-351.174] (-348.248) (-346.591) (-347.452) * (-346.893) (-348.189) [-352.088] (-345.915) -- 0:00:31
494000 -- (-347.353) (-346.147) [-345.132] (-349.174) * (-348.801) (-346.674) (-347.551) [-346.791] -- 0:00:31
494500 -- (-344.584) (-345.674) [-345.333] (-346.189) * (-345.411) (-347.799) [-346.872] (-346.417) -- 0:00:31
495000 -- (-346.361) (-348.214) [-345.773] (-347.623) * (-350.837) (-347.297) (-347.629) [-345.397] -- 0:00:31
Average standard deviation of split frequencies: 0.013418
495500 -- (-345.195) (-350.564) (-346.403) [-346.630] * (-346.922) (-345.445) (-347.621) [-345.231] -- 0:00:31
496000 -- (-345.722) (-346.582) (-348.590) [-347.256] * [-346.822] (-345.624) (-349.252) (-347.227) -- 0:00:31
496500 -- (-348.009) [-348.417] (-349.439) (-346.997) * [-345.031] (-347.256) (-347.760) (-346.527) -- 0:00:31
497000 -- (-347.138) (-350.416) (-350.370) [-346.955] * (-346.805) (-345.606) [-348.339] (-344.788) -- 0:00:31
497500 -- (-347.906) (-348.257) [-346.248] (-348.106) * [-345.576] (-348.471) (-345.701) (-346.478) -- 0:00:32
498000 -- (-347.360) [-346.787] (-345.525) (-347.038) * (-349.637) (-346.326) [-350.322] (-347.241) -- 0:00:32
498500 -- (-345.945) (-345.176) [-345.353] (-347.124) * (-345.230) [-346.368] (-348.162) (-348.023) -- 0:00:32
499000 -- (-346.336) [-345.581] (-347.345) (-349.440) * (-347.950) [-346.083] (-350.004) (-345.404) -- 0:00:32
499500 -- (-350.648) (-349.153) (-346.231) [-346.991] * (-348.120) [-346.701] (-348.870) (-347.011) -- 0:00:32
500000 -- [-345.021] (-349.522) (-344.938) (-346.637) * [-347.666] (-346.704) (-346.536) (-346.445) -- 0:00:32
Average standard deviation of split frequencies: 0.013182
500500 -- (-345.002) (-348.773) [-346.244] (-348.365) * (-348.447) (-350.878) (-345.642) [-345.583] -- 0:00:31
501000 -- (-346.312) (-347.568) [-345.635] (-345.734) * (-348.403) (-350.417) (-346.301) [-345.250] -- 0:00:31
501500 -- (-346.908) (-348.706) (-348.865) [-344.932] * (-350.793) [-345.375] (-347.845) (-347.787) -- 0:00:31
502000 -- (-347.141) [-346.119] (-347.108) (-347.955) * (-346.852) [-344.802] (-345.932) (-347.826) -- 0:00:31
502500 -- (-346.095) (-347.718) [-349.489] (-345.519) * (-345.553) [-346.369] (-347.317) (-347.160) -- 0:00:31
503000 -- (-346.431) [-345.564] (-345.665) (-347.717) * [-348.163] (-351.054) (-350.894) (-350.003) -- 0:00:31
503500 -- (-352.374) [-345.706] (-347.666) (-346.832) * [-344.811] (-345.436) (-348.152) (-344.560) -- 0:00:31
504000 -- (-346.463) (-348.607) (-346.700) [-346.023] * [-349.260] (-346.917) (-345.621) (-346.794) -- 0:00:31
504500 -- (-350.097) [-347.444] (-349.826) (-345.602) * (-348.600) [-345.684] (-345.917) (-348.733) -- 0:00:31
505000 -- (-346.216) [-345.836] (-347.715) (-345.506) * [-345.820] (-351.052) (-346.684) (-345.892) -- 0:00:31
Average standard deviation of split frequencies: 0.012330
505500 -- (-345.819) [-347.877] (-347.299) (-346.165) * (-345.427) (-346.069) [-346.629] (-346.745) -- 0:00:31
506000 -- (-346.222) (-346.556) [-348.440] (-348.982) * [-346.476] (-345.289) (-346.983) (-347.456) -- 0:00:31
506500 -- (-345.068) (-345.055) (-347.749) [-350.812] * [-347.569] (-345.247) (-345.766) (-346.518) -- 0:00:31
507000 -- (-346.231) (-354.087) (-345.504) [-346.992] * [-347.513] (-345.564) (-346.313) (-345.742) -- 0:00:31
507500 -- (-347.779) (-346.952) [-347.885] (-345.396) * (-349.152) (-344.641) [-346.895] (-350.808) -- 0:00:31
508000 -- (-347.458) (-347.033) (-355.258) [-346.711] * (-345.439) (-345.489) (-349.643) [-347.109] -- 0:00:30
508500 -- (-345.974) [-345.432] (-349.086) (-347.120) * (-347.633) (-346.774) [-346.617] (-346.902) -- 0:00:30
509000 -- [-347.519] (-345.977) (-346.621) (-346.155) * [-348.282] (-345.242) (-345.814) (-349.784) -- 0:00:30
509500 -- [-348.055] (-347.657) (-344.721) (-345.941) * [-348.951] (-348.388) (-346.007) (-353.785) -- 0:00:30
510000 -- (-346.766) (-345.530) [-346.938] (-350.089) * (-344.626) (-346.137) (-348.843) [-351.955] -- 0:00:30
Average standard deviation of split frequencies: 0.013501
510500 -- (-348.055) (-346.505) [-346.543] (-346.620) * (-347.021) [-344.827] (-345.282) (-347.893) -- 0:00:30
511000 -- (-351.652) (-346.901) [-345.733] (-346.117) * (-347.479) [-345.879] (-347.070) (-347.003) -- 0:00:30
511500 -- (-349.260) (-348.322) [-350.154] (-346.921) * (-348.339) [-346.890] (-347.497) (-345.657) -- 0:00:30
512000 -- (-344.738) (-345.092) (-345.796) [-349.709] * (-346.731) (-346.645) (-348.625) [-346.255] -- 0:00:30
512500 -- [-346.079] (-348.985) (-345.618) (-346.414) * (-347.587) [-347.430] (-346.366) (-348.140) -- 0:00:30
513000 -- (-349.745) (-351.769) (-346.665) [-347.344] * (-347.696) [-348.533] (-344.586) (-346.368) -- 0:00:30
513500 -- (-347.325) (-348.107) [-347.754] (-345.512) * (-345.432) (-351.685) (-346.677) [-346.064] -- 0:00:30
514000 -- (-346.790) (-348.593) (-349.428) [-345.265] * [-345.303] (-346.418) (-345.139) (-346.068) -- 0:00:30
514500 -- (-347.853) (-347.022) [-349.018] (-345.675) * [-347.186] (-347.543) (-345.395) (-347.769) -- 0:00:31
515000 -- [-346.355] (-346.897) (-347.450) (-346.957) * (-349.825) [-346.624] (-347.209) (-346.236) -- 0:00:31
Average standard deviation of split frequencies: 0.013589
515500 -- (-345.346) [-345.857] (-344.815) (-348.304) * (-345.040) (-345.223) (-350.202) [-348.614] -- 0:00:31
516000 -- (-346.090) [-348.582] (-348.984) (-347.467) * [-345.095] (-345.182) (-348.330) (-347.822) -- 0:00:30
516500 -- (-345.351) (-344.933) [-346.281] (-346.219) * (-346.658) (-347.548) (-347.458) [-345.496] -- 0:00:30
517000 -- (-345.192) (-345.213) (-345.293) [-346.933] * (-345.407) (-345.113) [-347.112] (-346.839) -- 0:00:30
517500 -- (-349.106) [-346.938] (-346.640) (-346.137) * (-347.949) [-348.994] (-349.506) (-345.454) -- 0:00:30
518000 -- [-348.164] (-346.315) (-350.310) (-344.913) * (-348.764) (-345.925) (-346.705) [-345.255] -- 0:00:30
518500 -- (-348.336) [-346.664] (-354.097) (-352.881) * (-347.004) (-346.062) (-347.929) [-347.575] -- 0:00:30
519000 -- [-346.795] (-346.253) (-346.028) (-350.170) * (-344.993) [-346.559] (-347.001) (-348.105) -- 0:00:30
519500 -- (-346.784) [-345.962] (-344.791) (-345.484) * (-345.612) (-345.790) (-346.839) [-351.171] -- 0:00:30
520000 -- [-347.332] (-346.905) (-347.204) (-347.942) * (-346.452) (-347.899) [-347.201] (-346.651) -- 0:00:30
Average standard deviation of split frequencies: 0.013694
520500 -- (-347.909) (-348.256) (-344.945) [-345.216] * (-346.908) (-348.506) (-345.069) [-349.254] -- 0:00:30
521000 -- (-346.119) (-346.102) [-348.901] (-348.486) * (-348.834) [-346.537] (-345.018) (-349.663) -- 0:00:30
521500 -- (-349.663) [-345.613] (-351.138) (-346.210) * (-349.669) (-346.135) [-346.061] (-345.308) -- 0:00:30
522000 -- [-347.146] (-350.341) (-350.737) (-348.311) * (-351.446) [-346.864] (-347.784) (-344.431) -- 0:00:30
522500 -- (-345.253) (-344.904) (-350.506) [-347.445] * (-349.734) [-347.227] (-347.716) (-352.421) -- 0:00:30
523000 -- (-345.908) [-346.650] (-347.343) (-349.410) * (-349.289) (-345.738) [-350.067] (-345.427) -- 0:00:30
523500 -- [-346.773] (-345.020) (-346.637) (-347.931) * (-345.248) (-347.183) [-346.457] (-347.443) -- 0:00:30
524000 -- (-347.160) [-346.826] (-346.512) (-346.905) * (-350.281) (-351.871) (-344.941) [-346.386] -- 0:00:29
524500 -- [-347.701] (-349.594) (-352.039) (-346.022) * (-346.654) (-351.150) (-346.201) [-345.690] -- 0:00:29
525000 -- [-347.639] (-347.151) (-347.369) (-346.212) * (-348.139) [-347.981] (-348.110) (-350.421) -- 0:00:29
Average standard deviation of split frequencies: 0.013891
525500 -- [-344.980] (-348.140) (-345.351) (-347.232) * [-346.547] (-347.469) (-346.597) (-351.749) -- 0:00:29
526000 -- (-346.803) (-345.086) [-348.970] (-346.751) * [-347.417] (-347.977) (-346.773) (-346.486) -- 0:00:29
526500 -- (-347.130) [-345.858] (-346.385) (-345.302) * (-346.982) (-350.611) (-347.612) [-345.721] -- 0:00:29
527000 -- (-345.680) [-345.749] (-346.653) (-347.999) * [-345.532] (-346.403) (-346.102) (-348.988) -- 0:00:29
527500 -- [-347.698] (-345.002) (-346.770) (-347.789) * [-345.112] (-345.713) (-345.131) (-346.726) -- 0:00:29
528000 -- (-345.639) (-346.550) [-345.517] (-347.607) * (-345.383) (-347.795) [-345.959] (-349.100) -- 0:00:29
528500 -- (-345.923) (-345.477) (-344.727) [-348.943] * (-344.650) (-348.152) (-347.175) [-344.884] -- 0:00:29
529000 -- (-353.711) (-346.924) (-347.641) [-347.256] * [-347.512] (-346.268) (-346.260) (-346.749) -- 0:00:29
529500 -- (-345.194) (-348.067) (-347.613) [-347.224] * (-345.974) (-351.341) [-346.947] (-347.225) -- 0:00:29
530000 -- (-346.581) (-344.931) (-348.635) [-348.555] * (-347.761) [-350.495] (-347.874) (-348.285) -- 0:00:29
Average standard deviation of split frequencies: 0.014491
530500 -- [-347.411] (-345.705) (-348.440) (-346.792) * (-349.332) [-350.052] (-349.371) (-351.864) -- 0:00:29
531000 -- (-350.790) (-346.267) (-346.614) [-345.974] * [-347.779] (-347.339) (-347.779) (-346.959) -- 0:00:29
531500 -- (-345.455) (-345.612) (-348.563) [-349.833] * (-346.330) (-350.705) (-348.667) [-347.129] -- 0:00:29
532000 -- (-348.648) [-347.317] (-348.554) (-348.400) * (-344.648) (-348.239) [-345.818] (-345.397) -- 0:00:29
532500 -- [-345.838] (-345.739) (-347.353) (-346.419) * (-344.641) (-345.099) (-345.673) [-344.619] -- 0:00:29
533000 -- [-346.953] (-346.668) (-345.486) (-345.948) * [-345.750] (-347.782) (-346.745) (-347.656) -- 0:00:29
533500 -- (-347.414) [-346.381] (-347.011) (-347.932) * (-348.854) (-349.946) (-349.144) [-346.867] -- 0:00:29
534000 -- (-348.205) (-346.280) (-347.229) [-349.424] * (-346.941) [-351.474] (-346.853) (-346.069) -- 0:00:29
534500 -- (-348.325) [-349.119] (-347.500) (-346.740) * (-345.666) (-346.731) (-349.569) [-345.482] -- 0:00:29
535000 -- (-349.537) (-346.493) (-345.779) [-345.599] * [-345.577] (-346.122) (-348.226) (-348.223) -- 0:00:29
Average standard deviation of split frequencies: 0.014951
535500 -- (-347.130) (-348.948) (-346.673) [-345.461] * (-345.249) [-346.406] (-345.515) (-345.392) -- 0:00:29
536000 -- (-345.571) (-347.439) [-348.019] (-347.160) * (-349.618) (-348.530) (-345.175) [-345.102] -- 0:00:29
536500 -- (-346.525) (-345.582) [-346.514] (-346.197) * (-347.019) (-351.102) (-347.280) [-347.125] -- 0:00:29
537000 -- (-349.054) [-344.973] (-348.193) (-344.737) * [-348.129] (-349.165) (-348.005) (-347.204) -- 0:00:29
537500 -- (-347.309) [-345.294] (-346.455) (-345.366) * [-346.080] (-349.419) (-350.654) (-349.162) -- 0:00:29
538000 -- [-346.349] (-345.782) (-347.942) (-345.979) * (-348.792) (-345.821) (-346.605) [-346.809] -- 0:00:29
538500 -- [-346.875] (-346.830) (-348.087) (-345.224) * (-345.314) [-345.275] (-351.124) (-347.392) -- 0:00:29
539000 -- [-344.516] (-345.079) (-347.936) (-345.507) * [-345.063] (-350.024) (-351.576) (-347.867) -- 0:00:29
539500 -- [-347.112] (-346.371) (-348.226) (-344.514) * (-348.866) [-349.206] (-344.739) (-345.283) -- 0:00:29
540000 -- (-346.053) (-346.097) [-346.638] (-345.900) * (-348.400) [-344.948] (-344.804) (-347.797) -- 0:00:28
Average standard deviation of split frequencies: 0.014822
540500 -- (-346.688) (-346.859) [-346.546] (-347.710) * (-350.700) (-347.377) (-347.208) [-346.463] -- 0:00:28
541000 -- (-349.131) [-345.511] (-349.325) (-351.090) * (-347.182) (-346.728) [-345.292] (-346.594) -- 0:00:28
541500 -- (-345.157) [-346.953] (-348.151) (-346.962) * [-345.501] (-352.428) (-346.710) (-346.347) -- 0:00:28
542000 -- (-345.523) (-345.545) [-346.771] (-344.701) * (-344.409) (-350.330) [-347.065] (-344.636) -- 0:00:28
542500 -- (-346.351) (-352.495) [-345.311] (-344.664) * (-346.625) (-347.705) (-346.343) [-344.668] -- 0:00:28
543000 -- (-350.991) (-357.293) [-347.447] (-345.394) * (-347.170) (-347.299) (-349.656) [-349.303] -- 0:00:28
543500 -- (-348.771) (-346.188) (-345.023) [-346.586] * (-346.384) [-347.411] (-349.198) (-348.406) -- 0:00:28
544000 -- (-347.505) (-346.850) (-349.418) [-344.529] * [-347.003] (-349.948) (-347.642) (-346.854) -- 0:00:28
544500 -- (-346.380) [-345.595] (-348.966) (-346.337) * (-346.550) (-347.010) [-345.721] (-347.746) -- 0:00:28
545000 -- (-345.891) (-346.316) (-345.874) [-346.945] * (-346.675) (-345.427) [-346.390] (-347.365) -- 0:00:28
Average standard deviation of split frequencies: 0.014300
545500 -- (-348.569) (-346.633) [-347.049] (-346.977) * (-351.902) (-345.030) [-346.523] (-345.479) -- 0:00:28
546000 -- (-347.170) (-347.440) [-346.631] (-348.344) * (-345.483) [-346.859] (-346.085) (-347.632) -- 0:00:28
546500 -- [-347.862] (-346.078) (-346.156) (-345.182) * (-344.626) [-347.212] (-346.522) (-344.927) -- 0:00:28
547000 -- [-346.980] (-346.371) (-345.124) (-344.594) * [-344.781] (-347.130) (-348.134) (-347.829) -- 0:00:28
547500 -- (-349.209) [-346.557] (-346.070) (-352.000) * (-349.038) (-347.266) [-344.651] (-345.015) -- 0:00:28
548000 -- (-347.748) [-345.326] (-350.957) (-346.991) * (-349.753) (-347.416) (-347.801) [-346.466] -- 0:00:28
548500 -- (-346.291) [-347.210] (-346.669) (-346.756) * (-345.594) (-345.126) (-344.675) [-349.089] -- 0:00:27
549000 -- (-345.203) [-349.363] (-345.291) (-348.427) * (-345.639) (-349.253) (-345.732) [-348.693] -- 0:00:28
549500 -- (-346.063) (-347.029) [-346.786] (-345.957) * (-346.626) [-346.440] (-345.520) (-350.221) -- 0:00:28
550000 -- (-346.718) (-347.962) (-348.035) [-345.289] * (-348.571) [-348.960] (-346.303) (-346.099) -- 0:00:28
Average standard deviation of split frequencies: 0.013857
550500 -- [-345.111] (-347.229) (-346.791) (-355.440) * (-345.942) [-346.925] (-345.367) (-345.624) -- 0:00:28
551000 -- (-349.036) [-346.598] (-345.922) (-345.833) * (-347.367) (-345.543) [-345.799] (-346.524) -- 0:00:28
551500 -- (-346.914) (-349.822) (-346.972) [-346.006] * [-348.609] (-346.080) (-345.878) (-345.705) -- 0:00:28
552000 -- [-345.203] (-353.938) (-346.759) (-345.987) * (-348.791) (-345.024) [-346.995] (-345.492) -- 0:00:28
552500 -- (-346.694) (-352.298) (-346.974) [-344.922] * (-349.906) (-349.373) [-345.274] (-346.658) -- 0:00:28
553000 -- (-345.260) [-345.769] (-344.706) (-349.543) * (-352.243) (-345.992) [-349.642] (-346.432) -- 0:00:28
553500 -- (-347.581) [-346.897] (-348.900) (-352.605) * (-350.502) (-345.128) (-345.758) [-345.810] -- 0:00:28
554000 -- (-347.220) [-347.722] (-346.495) (-345.558) * (-348.220) [-345.302] (-346.177) (-347.203) -- 0:00:28
554500 -- [-345.694] (-346.927) (-347.452) (-345.896) * (-346.645) [-346.744] (-346.796) (-352.778) -- 0:00:28
555000 -- (-346.808) (-346.574) (-350.432) [-348.103] * (-346.331) (-348.245) (-347.724) [-347.243] -- 0:00:28
Average standard deviation of split frequencies: 0.013142
555500 -- [-346.939] (-345.430) (-350.005) (-348.162) * (-348.656) [-347.806] (-348.945) (-349.861) -- 0:00:28
556000 -- [-347.154] (-348.555) (-348.276) (-349.811) * (-348.060) (-347.701) (-345.709) [-348.632] -- 0:00:27
556500 -- (-345.489) (-352.081) (-351.054) [-348.237] * [-348.258] (-347.578) (-345.833) (-345.766) -- 0:00:27
557000 -- (-346.828) [-347.989] (-348.216) (-348.899) * (-346.080) (-346.218) [-346.572] (-353.863) -- 0:00:27
557500 -- [-345.490] (-346.242) (-344.938) (-345.705) * [-345.221] (-345.593) (-347.623) (-350.285) -- 0:00:27
558000 -- [-345.895] (-347.516) (-350.418) (-346.699) * [-346.804] (-346.638) (-348.799) (-347.600) -- 0:00:27
558500 -- (-347.075) (-347.154) (-346.716) [-348.664] * (-346.450) [-345.840] (-351.566) (-347.314) -- 0:00:27
559000 -- [-347.746] (-345.677) (-347.262) (-347.985) * [-347.766] (-347.372) (-348.482) (-346.436) -- 0:00:27
559500 -- [-350.946] (-344.726) (-348.387) (-347.393) * [-348.986] (-347.529) (-344.807) (-345.344) -- 0:00:27
560000 -- (-354.293) [-344.753] (-346.529) (-344.896) * (-352.655) (-345.095) (-345.027) [-346.453] -- 0:00:27
Average standard deviation of split frequencies: 0.013116
560500 -- (-348.120) (-347.084) [-345.996] (-347.444) * (-348.300) (-350.598) [-347.620] (-346.964) -- 0:00:27
561000 -- (-352.728) (-347.072) [-346.943] (-349.970) * (-346.734) [-348.797] (-346.747) (-346.231) -- 0:00:27
561500 -- [-346.524] (-346.584) (-344.905) (-351.642) * (-353.495) (-348.245) (-345.880) [-344.757] -- 0:00:27
562000 -- (-347.747) [-345.322] (-349.309) (-352.874) * (-345.408) (-348.808) (-345.543) [-345.856] -- 0:00:27
562500 -- (-344.441) (-345.379) [-347.287] (-347.548) * (-346.028) (-349.278) (-345.381) [-345.209] -- 0:00:27
563000 -- (-346.100) [-345.172] (-346.955) (-347.814) * (-348.920) (-346.872) [-346.536] (-345.592) -- 0:00:27
563500 -- (-348.490) [-347.946] (-347.543) (-349.255) * (-347.412) (-347.526) [-347.178] (-347.762) -- 0:00:27
564000 -- (-345.598) [-346.228] (-345.919) (-345.567) * (-345.096) [-352.523] (-346.963) (-347.287) -- 0:00:27
564500 -- (-346.456) (-348.019) (-345.829) [-352.664] * (-345.635) (-348.545) (-345.211) [-347.899] -- 0:00:27
565000 -- (-348.124) (-347.641) [-346.154] (-351.305) * (-347.896) (-349.155) [-345.309] (-347.212) -- 0:00:26
Average standard deviation of split frequencies: 0.011920
565500 -- [-347.418] (-346.597) (-347.797) (-346.562) * (-348.878) [-348.107] (-344.873) (-347.566) -- 0:00:26
566000 -- [-346.231] (-346.136) (-347.963) (-345.104) * (-346.335) (-346.419) [-344.734] (-346.056) -- 0:00:27
566500 -- [-347.772] (-347.003) (-348.067) (-345.571) * (-347.527) (-349.882) (-346.943) [-347.343] -- 0:00:27
567000 -- (-346.451) [-346.313] (-347.615) (-346.044) * (-346.171) [-345.043] (-347.119) (-348.917) -- 0:00:27
567500 -- [-345.295] (-346.785) (-347.155) (-345.683) * (-347.868) [-345.321] (-345.755) (-351.044) -- 0:00:27
568000 -- [-346.116] (-344.880) (-351.433) (-348.462) * (-345.217) (-347.108) [-345.052] (-346.292) -- 0:00:27
568500 -- [-344.640] (-345.970) (-350.771) (-346.516) * (-349.649) (-346.193) [-345.786] (-347.504) -- 0:00:27
569000 -- (-346.262) (-347.312) (-347.612) [-348.239] * (-346.111) (-346.113) (-346.654) [-346.342] -- 0:00:27
569500 -- (-345.881) [-348.877] (-349.528) (-345.726) * [-346.018] (-349.275) (-347.769) (-346.427) -- 0:00:27
570000 -- (-346.351) (-345.832) (-345.465) [-347.053] * [-344.979] (-345.231) (-347.837) (-350.687) -- 0:00:27
Average standard deviation of split frequencies: 0.011289
570500 -- (-345.780) (-344.633) (-345.771) [-347.313] * (-345.236) (-346.763) (-345.284) [-346.046] -- 0:00:27
571000 -- (-346.785) [-344.534] (-344.449) (-345.076) * [-345.818] (-346.221) (-345.324) (-345.605) -- 0:00:27
571500 -- (-345.003) (-344.503) (-345.297) [-347.773] * (-344.681) (-346.687) (-347.963) [-345.263] -- 0:00:26
572000 -- [-344.906] (-350.133) (-347.663) (-346.390) * (-345.633) (-346.413) (-345.116) [-345.806] -- 0:00:26
572500 -- (-346.636) (-345.950) (-346.231) [-346.808] * (-345.076) [-348.925] (-345.288) (-350.913) -- 0:00:26
573000 -- (-348.725) [-348.065] (-346.873) (-347.453) * (-345.024) (-346.711) [-346.129] (-349.201) -- 0:00:26
573500 -- (-355.335) (-346.103) [-346.297] (-347.346) * (-346.866) [-349.260] (-348.578) (-346.358) -- 0:00:26
574000 -- [-346.850] (-345.616) (-348.986) (-347.029) * (-346.840) (-347.956) (-348.093) [-344.944] -- 0:00:26
574500 -- (-347.578) (-345.729) (-345.403) [-348.011] * (-345.378) (-346.181) [-345.817] (-346.078) -- 0:00:26
575000 -- (-348.048) (-347.030) [-349.116] (-348.809) * [-346.752] (-346.998) (-348.487) (-345.863) -- 0:00:26
Average standard deviation of split frequencies: 0.010967
575500 -- (-348.393) (-345.992) (-346.998) [-345.252] * (-348.822) (-347.593) [-345.935] (-345.738) -- 0:00:26
576000 -- (-348.657) (-346.031) [-351.114] (-344.608) * (-347.990) (-346.722) (-344.839) [-345.113] -- 0:00:26
576500 -- (-345.916) [-348.494] (-346.255) (-346.425) * (-347.936) [-347.149] (-348.178) (-344.764) -- 0:00:26
577000 -- (-348.053) (-347.244) [-346.028] (-348.467) * [-348.712] (-345.995) (-346.208) (-344.702) -- 0:00:26
577500 -- (-346.639) (-346.196) [-346.031] (-350.647) * (-348.005) [-346.497] (-348.389) (-345.394) -- 0:00:26
578000 -- (-347.087) (-345.234) (-347.343) [-345.556] * [-347.930] (-350.422) (-346.930) (-346.967) -- 0:00:26
578500 -- (-345.220) [-346.972] (-347.556) (-345.376) * [-345.947] (-346.445) (-345.984) (-347.912) -- 0:00:26
579000 -- [-348.757] (-345.699) (-347.503) (-346.272) * [-348.808] (-346.284) (-347.318) (-346.321) -- 0:00:26
579500 -- (-344.886) (-345.589) (-346.105) [-345.780] * (-347.252) [-351.202] (-346.185) (-347.240) -- 0:00:26
580000 -- (-350.177) (-345.840) (-346.696) [-346.058] * (-348.509) (-347.316) [-345.778] (-344.692) -- 0:00:26
Average standard deviation of split frequencies: 0.011420
580500 -- (-347.729) [-346.314] (-344.939) (-345.920) * [-345.760] (-345.211) (-346.315) (-344.690) -- 0:00:26
581000 -- (-349.484) (-347.121) [-346.062] (-349.303) * (-350.989) (-346.434) (-348.266) [-344.857] -- 0:00:25
581500 -- (-348.188) [-345.448] (-351.140) (-346.825) * (-349.473) (-344.650) (-345.823) [-345.504] -- 0:00:25
582000 -- [-346.644] (-347.263) (-345.653) (-347.214) * (-347.470) (-345.704) (-348.340) [-348.799] -- 0:00:25
582500 -- (-346.676) (-344.890) (-347.157) [-345.784] * (-346.914) (-348.911) [-346.898] (-347.076) -- 0:00:25
583000 -- [-346.534] (-346.669) (-347.133) (-344.828) * (-344.687) (-347.906) (-347.634) [-347.183] -- 0:00:25
583500 -- [-344.991] (-348.263) (-347.759) (-345.696) * (-344.393) (-345.535) [-348.305] (-344.863) -- 0:00:26
584000 -- (-347.241) (-350.675) [-346.074] (-345.849) * (-346.030) (-351.204) [-345.528] (-348.935) -- 0:00:26
584500 -- (-346.124) (-345.553) (-345.915) [-344.618] * (-348.788) (-349.046) (-345.473) [-344.859] -- 0:00:26
585000 -- (-347.418) [-345.417] (-348.201) (-344.437) * [-344.635] (-346.826) (-345.913) (-346.791) -- 0:00:26
Average standard deviation of split frequencies: 0.010887
585500 -- [-346.208] (-344.606) (-346.482) (-347.641) * (-346.624) (-346.552) (-346.433) [-346.587] -- 0:00:26
586000 -- (-345.411) (-346.260) (-345.803) [-346.348] * (-346.658) [-344.865] (-347.205) (-344.662) -- 0:00:26
586500 -- (-345.927) [-346.488] (-349.351) (-347.018) * (-345.291) (-348.220) [-349.798] (-356.519) -- 0:00:26
587000 -- (-345.403) (-350.181) (-347.140) [-344.935] * (-344.602) (-348.833) [-345.385] (-347.020) -- 0:00:26
587500 -- [-344.838] (-345.834) (-346.249) (-344.828) * (-344.990) (-348.449) (-345.211) [-346.902] -- 0:00:25
588000 -- [-344.772] (-348.023) (-347.649) (-345.461) * [-349.060] (-354.287) (-346.460) (-345.243) -- 0:00:25
588500 -- (-345.517) (-347.076) [-346.184] (-345.518) * [-346.351] (-349.424) (-345.614) (-351.131) -- 0:00:25
589000 -- (-346.886) (-345.219) (-346.664) [-345.027] * (-345.654) (-348.634) [-346.171] (-346.491) -- 0:00:25
589500 -- (-344.962) [-347.076] (-345.905) (-351.725) * (-345.611) (-350.568) [-346.000] (-345.663) -- 0:00:25
590000 -- [-348.542] (-347.570) (-345.959) (-349.801) * (-347.695) [-345.773] (-348.756) (-346.927) -- 0:00:25
Average standard deviation of split frequencies: 0.010375
590500 -- (-348.613) (-348.691) [-346.979] (-345.663) * (-345.991) (-347.637) [-346.402] (-345.478) -- 0:00:25
591000 -- (-348.320) (-351.969) [-346.394] (-348.286) * (-344.571) (-348.487) [-346.788] (-345.738) -- 0:00:25
591500 -- (-348.221) (-346.466) [-346.398] (-346.313) * (-344.822) [-348.451] (-347.456) (-345.941) -- 0:00:25
592000 -- (-345.952) [-346.591] (-346.062) (-347.346) * [-345.400] (-345.662) (-345.526) (-346.535) -- 0:00:25
592500 -- [-346.717] (-344.627) (-346.904) (-347.004) * (-347.274) (-346.040) [-346.787] (-346.939) -- 0:00:25
593000 -- [-344.924] (-345.818) (-345.772) (-345.723) * (-351.518) [-345.353] (-347.587) (-346.347) -- 0:00:25
593500 -- [-345.859] (-346.568) (-347.039) (-346.759) * [-347.267] (-345.653) (-347.308) (-345.353) -- 0:00:25
594000 -- (-344.582) (-347.411) [-347.435] (-348.236) * (-346.103) [-347.030] (-348.024) (-345.083) -- 0:00:25
594500 -- (-345.921) (-350.993) (-345.904) [-346.216] * (-345.689) (-350.603) [-346.416] (-345.754) -- 0:00:25
595000 -- [-345.453] (-347.264) (-348.582) (-349.075) * (-346.284) (-346.767) [-345.235] (-354.762) -- 0:00:25
Average standard deviation of split frequencies: 0.010493
595500 -- [-346.500] (-347.685) (-347.097) (-347.326) * (-352.653) [-349.578] (-346.421) (-349.622) -- 0:00:25
596000 -- (-345.620) (-347.130) [-344.791] (-349.497) * (-345.388) (-346.476) (-345.166) [-347.752] -- 0:00:25
596500 -- [-349.780] (-345.833) (-345.405) (-348.723) * (-345.116) (-347.706) [-346.591] (-348.715) -- 0:00:25
597000 -- (-345.154) (-347.349) [-345.833] (-347.395) * (-345.571) (-348.539) [-347.735] (-347.775) -- 0:00:24
597500 -- [-344.715] (-348.007) (-347.082) (-347.834) * [-345.600] (-349.409) (-349.097) (-345.637) -- 0:00:24
598000 -- [-344.973] (-345.706) (-346.624) (-345.692) * (-345.637) (-348.165) (-350.075) [-345.576] -- 0:00:24
598500 -- [-347.290] (-349.551) (-345.777) (-345.510) * (-349.108) [-345.258] (-347.803) (-345.019) -- 0:00:24
599000 -- (-344.275) (-348.837) (-345.695) [-345.156] * (-346.338) (-345.067) [-344.865] (-349.845) -- 0:00:24
599500 -- [-348.578] (-350.182) (-345.799) (-344.748) * [-347.261] (-345.737) (-347.048) (-347.146) -- 0:00:24
600000 -- (-345.935) (-349.316) [-347.081] (-346.057) * (-346.326) (-345.971) [-347.969] (-346.607) -- 0:00:24
Average standard deviation of split frequencies: 0.009836
600500 -- (-345.408) (-346.581) (-345.196) [-344.564] * [-345.937] (-344.611) (-345.687) (-345.201) -- 0:00:25
601000 -- (-345.956) (-347.647) (-347.394) [-345.806] * (-346.339) (-347.096) (-345.359) [-349.575] -- 0:00:25
601500 -- (-346.578) (-353.125) (-346.103) [-345.260] * (-346.481) (-345.451) (-352.438) [-348.230] -- 0:00:25
602000 -- (-349.153) (-348.555) (-345.680) [-346.783] * [-347.763] (-345.789) (-347.650) (-351.223) -- 0:00:25
602500 -- [-346.285] (-347.010) (-345.325) (-345.001) * [-346.205] (-345.730) (-347.420) (-346.035) -- 0:00:25
603000 -- (-346.377) (-347.373) (-346.399) [-344.436] * [-347.028] (-345.989) (-347.861) (-347.300) -- 0:00:25
603500 -- [-350.802] (-346.686) (-345.735) (-346.145) * [-346.247] (-344.869) (-346.746) (-345.215) -- 0:00:24
604000 -- (-345.891) (-349.418) [-346.239] (-347.385) * (-349.160) [-347.351] (-345.083) (-349.753) -- 0:00:24
604500 -- (-346.971) (-344.888) (-347.524) [-345.112] * (-345.877) (-348.710) [-344.755] (-348.671) -- 0:00:24
605000 -- [-345.709] (-348.039) (-346.681) (-346.791) * (-348.253) [-344.942] (-347.905) (-345.492) -- 0:00:24
Average standard deviation of split frequencies: 0.010372
605500 -- (-346.452) (-347.926) [-346.157] (-347.917) * (-345.981) (-345.938) (-347.104) [-347.233] -- 0:00:24
606000 -- (-344.734) [-345.643] (-346.984) (-346.161) * (-348.469) (-347.627) [-354.105] (-344.668) -- 0:00:24
606500 -- [-345.106] (-347.607) (-351.321) (-346.988) * [-347.555] (-346.100) (-350.778) (-346.653) -- 0:00:24
607000 -- (-345.453) [-345.116] (-350.153) (-345.210) * (-347.902) [-346.884] (-350.913) (-347.162) -- 0:00:24
607500 -- (-349.678) (-347.637) (-349.338) [-349.196] * [-344.955] (-344.640) (-351.603) (-344.915) -- 0:00:24
608000 -- (-347.973) (-347.966) [-347.779] (-345.726) * [-344.324] (-345.843) (-346.174) (-347.838) -- 0:00:24
608500 -- (-350.560) (-349.243) [-344.941] (-345.056) * (-347.281) (-346.380) (-351.008) [-346.826] -- 0:00:24
609000 -- (-346.194) (-346.317) (-348.339) [-348.700] * (-346.730) [-345.494] (-347.540) (-344.516) -- 0:00:24
609500 -- (-347.841) [-345.841] (-345.934) (-345.471) * (-347.043) (-347.515) [-347.101] (-355.521) -- 0:00:24
610000 -- (-349.960) (-344.966) [-346.178] (-348.083) * [-346.907] (-351.682) (-346.364) (-348.270) -- 0:00:24
Average standard deviation of split frequencies: 0.009984
610500 -- (-349.702) [-348.864] (-345.049) (-349.925) * [-347.309] (-348.100) (-347.591) (-348.606) -- 0:00:24
611000 -- (-346.162) [-348.879] (-348.393) (-348.187) * [-347.003] (-346.370) (-346.916) (-349.416) -- 0:00:24
611500 -- (-349.231) [-349.253] (-351.001) (-344.993) * (-346.990) (-347.576) [-346.504] (-346.289) -- 0:00:24
612000 -- (-345.682) [-347.513] (-361.097) (-346.206) * (-349.982) [-344.819] (-348.040) (-348.672) -- 0:00:24
612500 -- (-349.633) [-347.848] (-349.054) (-346.070) * (-348.300) (-345.260) [-346.349] (-349.838) -- 0:00:24
613000 -- [-345.826] (-347.174) (-345.505) (-347.901) * [-345.813] (-349.082) (-347.349) (-344.960) -- 0:00:23
613500 -- [-345.353] (-348.979) (-346.941) (-347.954) * (-346.400) (-351.957) [-345.606] (-346.409) -- 0:00:23
614000 -- (-351.789) (-349.889) (-345.004) [-349.635] * (-346.618) (-348.112) (-348.428) [-346.495] -- 0:00:23
614500 -- (-350.991) [-346.700] (-346.223) (-346.811) * (-345.863) [-348.150] (-350.647) (-345.074) -- 0:00:23
615000 -- [-346.714] (-347.671) (-346.833) (-345.464) * (-348.410) [-345.996] (-348.736) (-345.310) -- 0:00:23
Average standard deviation of split frequencies: 0.009897
615500 -- (-344.998) [-347.569] (-347.426) (-345.583) * (-346.498) [-347.316] (-347.446) (-346.155) -- 0:00:23
616000 -- (-349.445) (-345.738) (-348.572) [-345.986] * [-344.801] (-355.403) (-344.464) (-345.752) -- 0:00:23
616500 -- (-346.489) (-346.192) [-347.027] (-348.354) * (-347.353) (-348.009) [-347.827] (-345.798) -- 0:00:23
617000 -- [-348.958] (-346.403) (-345.907) (-347.322) * (-348.416) (-347.044) [-347.140] (-345.416) -- 0:00:23
617500 -- (-348.334) (-351.552) [-345.913] (-346.702) * (-346.013) [-344.709] (-346.527) (-350.243) -- 0:00:24
618000 -- (-347.780) (-347.436) (-345.270) [-346.431] * [-344.652] (-346.832) (-344.817) (-348.375) -- 0:00:24
618500 -- [-346.868] (-346.419) (-345.457) (-351.833) * (-347.997) (-346.006) (-348.131) [-348.884] -- 0:00:24
619000 -- (-347.145) (-348.715) [-344.972] (-348.434) * (-345.964) [-347.518] (-347.977) (-347.304) -- 0:00:24
619500 -- [-347.883] (-345.230) (-345.825) (-349.182) * (-350.247) (-349.155) (-348.605) [-346.934] -- 0:00:23
620000 -- (-349.104) (-351.656) (-347.069) [-345.438] * [-345.698] (-346.299) (-347.470) (-351.920) -- 0:00:23
Average standard deviation of split frequencies: 0.009823
620500 -- [-344.842] (-347.979) (-345.837) (-344.889) * (-347.398) (-346.481) (-349.638) [-346.477] -- 0:00:23
621000 -- [-344.863] (-350.929) (-350.418) (-344.759) * (-346.258) (-348.558) (-347.003) [-345.026] -- 0:00:23
621500 -- (-348.549) [-345.681] (-347.569) (-344.731) * [-346.215] (-347.843) (-348.362) (-346.241) -- 0:00:23
622000 -- (-346.591) (-356.063) (-346.612) [-345.789] * [-346.215] (-347.152) (-346.438) (-346.983) -- 0:00:23
622500 -- (-345.595) [-346.397] (-349.727) (-346.183) * [-344.859] (-345.118) (-346.418) (-346.845) -- 0:00:23
623000 -- (-345.218) [-347.833] (-346.952) (-346.899) * (-346.770) [-346.467] (-348.265) (-345.381) -- 0:00:23
623500 -- [-345.101] (-347.354) (-348.079) (-345.420) * (-347.194) (-345.202) [-347.087] (-345.621) -- 0:00:23
624000 -- (-348.141) [-345.530] (-351.508) (-347.721) * (-348.235) [-346.564] (-349.060) (-347.019) -- 0:00:23
624500 -- [-351.394] (-344.759) (-354.101) (-346.554) * (-348.989) (-347.344) (-346.189) [-346.292] -- 0:00:23
625000 -- (-347.040) [-347.595] (-350.868) (-349.500) * [-347.062] (-347.134) (-346.235) (-345.344) -- 0:00:23
Average standard deviation of split frequencies: 0.009790
625500 -- [-345.210] (-346.121) (-347.215) (-348.207) * (-346.003) [-348.508] (-345.451) (-346.397) -- 0:00:23
626000 -- (-349.198) [-346.670] (-346.170) (-346.155) * [-345.266] (-353.057) (-345.814) (-348.483) -- 0:00:23
626500 -- [-348.194] (-345.116) (-354.091) (-350.275) * (-345.082) (-346.838) [-345.048] (-352.706) -- 0:00:23
627000 -- (-348.741) (-344.875) (-346.976) [-344.586] * (-344.819) (-346.159) [-345.569] (-346.273) -- 0:00:23
627500 -- (-349.155) (-345.594) [-346.844] (-348.762) * [-345.094] (-347.175) (-348.621) (-346.684) -- 0:00:23
628000 -- [-344.835] (-345.665) (-354.154) (-345.410) * (-347.127) (-346.489) [-346.204] (-348.420) -- 0:00:23
628500 -- [-346.088] (-349.793) (-345.712) (-345.607) * [-347.887] (-346.482) (-346.481) (-347.071) -- 0:00:23
629000 -- (-345.809) [-344.638] (-348.539) (-346.216) * (-346.358) (-346.195) (-347.379) [-345.063] -- 0:00:23
629500 -- [-347.119] (-347.472) (-345.812) (-344.725) * (-346.269) [-347.462] (-344.794) (-345.345) -- 0:00:22
630000 -- (-345.230) (-346.553) [-346.107] (-344.680) * [-348.585] (-347.389) (-347.387) (-346.525) -- 0:00:22
Average standard deviation of split frequencies: 0.009518
630500 -- (-345.388) (-346.947) (-346.709) [-347.243] * (-345.240) (-346.494) (-351.544) [-344.822] -- 0:00:22
631000 -- (-346.823) [-346.534] (-350.344) (-348.896) * (-347.790) (-348.633) [-350.007] (-346.665) -- 0:00:22
631500 -- (-349.267) [-347.011] (-347.753) (-347.477) * (-347.839) (-346.102) [-345.923] (-347.821) -- 0:00:22
632000 -- (-346.343) (-345.393) [-345.092] (-346.504) * (-346.639) [-346.211] (-347.277) (-346.385) -- 0:00:22
632500 -- (-346.139) (-346.096) (-345.821) [-347.940] * (-348.164) (-345.690) [-352.245] (-345.682) -- 0:00:22
633000 -- [-345.767] (-344.763) (-345.540) (-345.076) * [-348.242] (-346.783) (-347.928) (-346.232) -- 0:00:22
633500 -- (-349.496) [-347.342] (-345.641) (-345.556) * (-351.551) [-347.684] (-347.446) (-346.713) -- 0:00:22
634000 -- (-346.627) (-346.149) (-344.702) [-349.224] * [-347.814] (-346.375) (-345.961) (-347.856) -- 0:00:22
634500 -- [-347.385] (-347.107) (-348.063) (-349.320) * (-348.539) [-345.724] (-345.551) (-349.708) -- 0:00:23
635000 -- (-347.676) (-347.721) (-346.799) [-346.007] * (-347.478) (-346.068) [-346.293] (-346.159) -- 0:00:22
Average standard deviation of split frequencies: 0.009487
635500 -- [-349.451] (-346.954) (-346.863) (-348.715) * (-346.594) (-346.443) [-346.115] (-348.154) -- 0:00:22
636000 -- (-347.154) (-345.688) (-346.576) [-348.309] * (-344.545) (-348.561) (-347.059) [-347.421] -- 0:00:22
636500 -- (-347.465) (-344.632) (-346.291) [-348.307] * (-347.531) (-350.100) (-349.030) [-346.072] -- 0:00:22
637000 -- [-349.073] (-345.462) (-346.305) (-345.429) * (-349.392) (-346.105) (-344.761) [-346.997] -- 0:00:22
637500 -- (-347.714) (-345.966) [-347.950] (-344.885) * (-345.552) (-346.689) (-345.959) [-347.199] -- 0:00:22
638000 -- [-348.865] (-349.164) (-345.274) (-346.795) * (-348.460) [-346.876] (-348.778) (-346.001) -- 0:00:22
638500 -- (-344.723) [-347.018] (-347.665) (-346.911) * [-348.279] (-344.717) (-346.845) (-347.394) -- 0:00:22
639000 -- (-345.460) (-347.972) [-346.925] (-349.368) * (-348.233) (-345.314) [-346.068] (-347.198) -- 0:00:22
639500 -- [-346.456] (-345.353) (-346.522) (-345.690) * (-344.811) [-345.114] (-347.345) (-345.289) -- 0:00:22
640000 -- (-348.667) [-348.799] (-347.126) (-347.212) * (-346.523) (-348.584) [-347.631] (-348.411) -- 0:00:22
Average standard deviation of split frequencies: 0.009762
640500 -- (-346.598) [-348.090] (-355.594) (-347.977) * (-345.643) (-346.187) [-350.941] (-351.593) -- 0:00:22
641000 -- (-350.477) [-348.396] (-351.092) (-352.438) * [-344.939] (-347.353) (-347.065) (-347.716) -- 0:00:22
641500 -- (-347.331) [-347.343] (-345.845) (-348.946) * (-346.665) (-345.232) [-346.249] (-344.964) -- 0:00:22
642000 -- (-346.532) (-357.740) [-347.165] (-346.258) * (-351.557) [-345.498] (-347.368) (-346.734) -- 0:00:22
642500 -- [-345.516] (-350.771) (-347.252) (-347.126) * (-345.957) (-346.276) (-346.925) [-346.642] -- 0:00:22
643000 -- (-345.630) (-346.108) (-347.993) [-348.704] * (-346.572) [-346.216] (-349.418) (-347.013) -- 0:00:22
643500 -- (-346.292) (-347.736) (-345.078) [-346.180] * (-344.808) (-345.856) [-348.460] (-344.949) -- 0:00:22
644000 -- (-347.147) [-346.433] (-344.686) (-351.350) * [-345.309] (-344.758) (-346.638) (-345.611) -- 0:00:22
644500 -- (-346.637) (-350.275) [-344.532] (-346.218) * (-344.866) (-345.959) (-348.613) [-346.809] -- 0:00:22
645000 -- (-345.635) [-345.921] (-349.136) (-348.686) * (-344.858) (-345.829) [-346.376] (-345.834) -- 0:00:22
Average standard deviation of split frequencies: 0.009973
645500 -- (-345.676) [-346.180] (-346.184) (-351.733) * (-347.370) (-346.902) (-345.395) [-344.837] -- 0:00:21
646000 -- [-346.131] (-348.373) (-345.982) (-355.846) * [-345.773] (-345.821) (-346.381) (-344.871) -- 0:00:21
646500 -- [-348.023] (-346.046) (-346.455) (-350.992) * [-346.003] (-345.012) (-346.726) (-348.455) -- 0:00:21
647000 -- (-349.770) [-347.156] (-344.824) (-345.953) * (-345.062) (-349.458) (-347.181) [-345.631] -- 0:00:21
647500 -- (-346.637) (-348.017) (-344.744) [-349.497] * (-348.073) (-348.167) [-351.346] (-345.727) -- 0:00:21
648000 -- (-347.004) (-346.070) [-347.166] (-348.624) * (-348.385) (-345.739) (-347.271) [-348.050] -- 0:00:21
648500 -- (-346.471) [-346.671] (-345.915) (-346.691) * (-348.797) [-345.597] (-346.045) (-348.494) -- 0:00:21
649000 -- (-345.555) (-346.185) (-345.775) [-347.765] * (-351.072) (-346.399) [-346.245] (-347.166) -- 0:00:21
649500 -- (-349.168) [-347.299] (-345.975) (-350.602) * (-349.755) (-345.606) (-345.381) [-344.942] -- 0:00:21
650000 -- (-347.772) (-346.375) (-348.146) [-346.685] * (-347.698) [-347.655] (-345.441) (-345.904) -- 0:00:21
Average standard deviation of split frequencies: 0.010336
650500 -- (-344.701) [-346.902] (-345.574) (-347.584) * (-346.358) [-348.406] (-346.198) (-345.510) -- 0:00:21
651000 -- (-345.929) (-345.889) (-347.371) [-346.877] * (-345.621) (-347.580) (-347.179) [-345.876] -- 0:00:21
651500 -- (-348.053) (-345.604) [-347.748] (-347.137) * (-345.294) (-347.596) [-345.456] (-345.741) -- 0:00:21
652000 -- (-349.889) (-346.337) [-346.463] (-350.575) * (-344.854) (-345.798) [-348.095] (-347.819) -- 0:00:21
652500 -- (-345.802) (-348.613) [-349.235] (-347.682) * (-346.990) (-349.621) [-346.129] (-348.316) -- 0:00:21
653000 -- (-349.910) [-348.214] (-348.433) (-346.316) * (-348.941) [-346.423] (-347.943) (-346.706) -- 0:00:21
653500 -- [-350.417] (-348.363) (-348.034) (-348.100) * (-346.231) (-345.965) (-348.328) [-345.409] -- 0:00:21
654000 -- (-346.975) (-349.991) (-346.621) [-345.599] * (-348.201) [-346.043] (-347.752) (-345.301) -- 0:00:21
654500 -- [-349.708] (-346.846) (-346.878) (-345.594) * (-351.396) (-350.145) (-347.412) [-346.348] -- 0:00:21
655000 -- (-351.348) [-345.656] (-345.677) (-348.123) * (-346.303) [-350.616] (-345.878) (-348.120) -- 0:00:21
Average standard deviation of split frequencies: 0.009965
655500 -- (-346.116) [-346.454] (-348.715) (-347.820) * [-348.861] (-346.045) (-347.347) (-347.533) -- 0:00:21
656000 -- [-344.826] (-347.501) (-345.963) (-349.099) * (-344.689) (-346.688) [-347.319] (-344.683) -- 0:00:21
656500 -- (-347.734) (-350.233) (-346.934) [-347.455] * (-344.910) (-345.293) [-348.275] (-346.191) -- 0:00:21
657000 -- [-346.806] (-346.683) (-347.422) (-346.906) * (-345.995) (-346.040) [-347.396] (-346.156) -- 0:00:21
657500 -- (-346.298) (-354.214) (-346.611) [-344.910] * (-345.263) [-346.447] (-347.555) (-346.803) -- 0:00:21
658000 -- (-350.740) [-347.690] (-345.547) (-344.823) * (-346.582) [-345.380] (-344.993) (-349.325) -- 0:00:21
658500 -- (-348.010) (-346.034) [-345.945] (-346.921) * (-345.372) [-348.078] (-347.266) (-344.508) -- 0:00:21
659000 -- [-345.661] (-346.154) (-347.729) (-347.268) * (-345.275) (-346.536) (-347.531) [-346.104] -- 0:00:21
659500 -- (-345.818) (-347.881) (-349.107) [-345.329] * (-346.355) (-346.171) (-345.949) [-346.064] -- 0:00:21
660000 -- (-345.250) (-350.358) (-346.157) [-347.224] * (-347.777) (-346.857) [-348.376] (-348.589) -- 0:00:21
Average standard deviation of split frequencies: 0.009752
660500 -- (-346.499) (-348.412) (-346.159) [-344.681] * (-346.876) [-347.502] (-352.182) (-347.982) -- 0:00:21
661000 -- (-345.578) [-345.940] (-348.267) (-345.364) * (-348.743) (-344.920) [-345.406] (-346.918) -- 0:00:21
661500 -- (-348.818) (-347.848) [-346.440] (-349.567) * (-345.252) (-349.670) [-345.581] (-345.776) -- 0:00:20
662000 -- [-347.232] (-347.559) (-345.705) (-351.225) * (-347.383) [-348.661] (-344.696) (-346.815) -- 0:00:20
662500 -- (-345.119) (-345.485) [-346.689] (-350.144) * (-352.762) (-345.580) [-346.501] (-345.801) -- 0:00:20
663000 -- [-349.255] (-348.462) (-347.498) (-347.363) * (-345.229) [-346.402] (-345.256) (-350.001) -- 0:00:20
663500 -- (-347.350) (-348.198) [-345.912] (-346.277) * (-346.312) [-345.969] (-345.395) (-348.629) -- 0:00:20
664000 -- [-350.774] (-345.120) (-347.751) (-353.141) * [-349.394] (-352.064) (-347.948) (-345.931) -- 0:00:20
664500 -- (-352.428) [-349.413] (-345.625) (-347.323) * [-346.698] (-348.526) (-345.077) (-347.833) -- 0:00:20
665000 -- [-345.369] (-347.075) (-345.401) (-347.387) * (-346.329) (-347.643) [-345.065] (-347.793) -- 0:00:20
Average standard deviation of split frequencies: 0.009025
665500 -- (-345.720) [-345.233] (-346.489) (-348.850) * (-345.912) (-345.621) [-346.176] (-346.390) -- 0:00:20
666000 -- (-345.841) (-344.556) [-345.579] (-351.494) * (-346.812) (-349.389) [-345.632] (-347.764) -- 0:00:20
666500 -- (-346.156) (-349.080) (-347.818) [-348.706] * (-346.787) (-347.561) [-347.366] (-347.463) -- 0:00:20
667000 -- (-344.358) (-345.692) [-347.076] (-346.974) * (-345.838) [-346.229] (-348.861) (-346.058) -- 0:00:20
667500 -- (-346.686) (-346.206) [-346.893] (-349.456) * (-347.051) (-346.876) [-346.634] (-347.852) -- 0:00:20
668000 -- [-345.522] (-345.906) (-345.497) (-345.655) * (-347.162) (-345.655) [-348.267] (-347.792) -- 0:00:20
668500 -- (-346.953) (-344.924) [-346.111] (-344.847) * [-346.903] (-345.376) (-346.066) (-348.695) -- 0:00:20
669000 -- (-348.239) (-345.507) [-345.694] (-348.513) * (-345.685) (-345.322) [-345.829] (-346.969) -- 0:00:20
669500 -- (-345.039) (-348.950) (-346.110) [-348.159] * [-346.378] (-344.852) (-345.006) (-347.288) -- 0:00:20
670000 -- (-347.859) [-348.590] (-345.153) (-349.407) * (-346.832) (-347.406) (-345.483) [-345.235] -- 0:00:20
Average standard deviation of split frequencies: 0.008918
670500 -- (-346.562) (-345.840) (-347.663) [-345.553] * (-349.463) (-348.620) [-348.260] (-344.813) -- 0:00:20
671000 -- (-346.079) (-351.035) (-348.582) [-348.915] * [-348.484] (-348.391) (-346.562) (-346.219) -- 0:00:20
671500 -- (-346.928) [-349.356] (-348.200) (-348.215) * (-346.445) (-344.754) [-347.511] (-345.909) -- 0:00:20
672000 -- [-345.004] (-345.917) (-346.129) (-345.675) * (-346.482) (-344.962) [-344.387] (-346.860) -- 0:00:20
672500 -- [-345.931] (-345.735) (-347.489) (-345.659) * (-346.150) (-344.735) (-349.335) [-345.020] -- 0:00:20
673000 -- [-344.595] (-347.188) (-347.908) (-346.204) * (-347.069) [-345.077] (-350.291) (-346.617) -- 0:00:20
673500 -- (-344.618) [-348.643] (-351.722) (-345.660) * (-347.707) (-345.161) (-349.552) [-350.190] -- 0:00:20
674000 -- (-346.965) (-345.936) [-350.271] (-349.270) * (-346.217) (-345.317) (-350.144) [-346.015] -- 0:00:20
674500 -- (-346.732) [-346.745] (-346.723) (-345.777) * (-345.586) (-347.461) (-348.966) [-345.827] -- 0:00:20
675000 -- (-345.138) (-345.115) [-344.997] (-346.130) * (-348.568) (-348.372) [-346.003] (-350.454) -- 0:00:20
Average standard deviation of split frequencies: 0.009632
675500 -- (-346.457) [-345.956] (-345.513) (-348.052) * (-346.551) (-349.284) [-347.469] (-347.080) -- 0:00:20
676000 -- [-347.895] (-351.029) (-346.785) (-347.793) * (-348.250) [-346.376] (-344.494) (-351.288) -- 0:00:20
676500 -- (-349.123) (-345.318) (-348.447) [-345.239] * (-346.349) (-347.415) [-348.564] (-347.900) -- 0:00:20
677000 -- (-349.656) (-347.082) [-350.465] (-344.788) * (-345.140) [-344.817] (-346.767) (-346.121) -- 0:00:20
677500 -- (-347.406) (-347.033) (-349.462) [-347.317] * [-348.152] (-345.523) (-345.594) (-346.298) -- 0:00:19
678000 -- (-346.711) [-347.815] (-352.549) (-346.236) * (-344.927) [-346.026] (-347.180) (-347.559) -- 0:00:19
678500 -- (-346.319) (-346.515) (-351.079) [-345.274] * [-345.878] (-345.672) (-345.607) (-346.493) -- 0:00:19
679000 -- (-344.871) (-347.874) (-345.893) [-345.816] * [-347.056] (-348.053) (-348.794) (-345.460) -- 0:00:19
679500 -- [-345.455] (-349.287) (-345.413) (-347.757) * (-345.550) [-345.779] (-347.686) (-347.726) -- 0:00:19
680000 -- (-346.995) [-352.261] (-344.625) (-346.831) * (-345.965) [-344.860] (-352.798) (-348.803) -- 0:00:19
Average standard deviation of split frequencies: 0.009176
680500 -- [-348.334] (-346.515) (-345.837) (-347.019) * (-345.340) (-347.890) (-347.738) [-348.192] -- 0:00:19
681000 -- (-345.078) (-347.348) (-345.675) [-350.296] * [-346.624] (-344.660) (-356.746) (-347.885) -- 0:00:19
681500 -- [-344.721] (-346.133) (-346.202) (-349.970) * (-348.708) (-347.605) (-344.962) [-348.243] -- 0:00:19
682000 -- [-344.682] (-346.566) (-346.316) (-346.895) * (-347.323) (-351.809) [-345.737] (-349.424) -- 0:00:19
682500 -- (-345.154) [-345.569] (-348.894) (-345.905) * (-348.699) [-346.502] (-349.856) (-349.607) -- 0:00:19
683000 -- [-347.335] (-350.723) (-346.553) (-345.287) * (-346.080) [-346.157] (-346.458) (-347.216) -- 0:00:19
683500 -- (-349.456) (-345.162) [-344.820] (-346.420) * (-347.016) (-345.964) [-351.362] (-346.572) -- 0:00:19
684000 -- [-345.413] (-345.456) (-345.625) (-346.506) * (-345.544) (-346.683) (-350.956) [-345.957] -- 0:00:19
684500 -- (-345.140) [-347.035] (-347.857) (-345.800) * (-345.783) [-348.322] (-345.663) (-345.771) -- 0:00:19
685000 -- (-346.105) (-350.104) [-346.726] (-346.850) * (-346.526) [-346.624] (-346.387) (-347.623) -- 0:00:19
Average standard deviation of split frequencies: 0.009406
685500 -- (-347.447) (-346.272) [-348.415] (-349.036) * (-349.562) (-346.929) [-345.716] (-345.521) -- 0:00:19
686000 -- (-345.792) (-347.540) [-347.843] (-352.266) * [-345.111] (-346.953) (-345.284) (-346.597) -- 0:00:19
686500 -- [-348.481] (-345.738) (-349.780) (-348.997) * (-345.557) (-345.303) [-348.360] (-348.024) -- 0:00:19
687000 -- (-346.171) (-345.927) (-346.621) [-347.015] * (-346.783) (-345.445) (-347.176) [-351.270] -- 0:00:19
687500 -- (-350.166) (-344.977) [-344.975] (-350.757) * (-345.170) (-345.433) [-346.274] (-349.988) -- 0:00:19
688000 -- [-346.948] (-345.892) (-347.658) (-346.604) * [-352.572] (-345.772) (-346.257) (-344.889) -- 0:00:19
688500 -- (-352.315) (-348.699) [-345.858] (-346.975) * [-347.421] (-347.757) (-346.068) (-345.474) -- 0:00:19
689000 -- (-345.650) (-347.235) (-348.997) [-347.813] * (-346.201) (-348.428) (-346.879) [-345.873] -- 0:00:19
689500 -- (-350.322) (-349.258) [-349.544] (-348.357) * (-345.866) (-348.174) [-346.463] (-345.194) -- 0:00:19
690000 -- (-346.398) (-347.373) (-349.977) [-348.106] * (-347.166) (-347.582) (-349.217) [-345.456] -- 0:00:19
Average standard deviation of split frequencies: 0.009641
690500 -- (-345.759) (-346.397) [-350.422] (-348.132) * [-347.378] (-346.956) (-352.706) (-344.987) -- 0:00:19
691000 -- [-344.898] (-346.393) (-347.606) (-347.299) * [-347.056] (-346.258) (-351.265) (-346.127) -- 0:00:19
691500 -- (-345.081) (-344.991) (-346.205) [-345.578] * (-345.236) (-347.051) [-349.707] (-344.841) -- 0:00:19
692000 -- (-345.625) [-349.746] (-345.941) (-345.897) * [-345.749] (-349.570) (-348.351) (-347.854) -- 0:00:19
692500 -- (-346.998) (-346.140) (-345.959) [-345.150] * (-349.253) (-346.068) (-349.734) [-349.150] -- 0:00:19
693000 -- (-349.054) (-344.913) (-346.917) [-344.898] * (-347.402) (-351.238) [-348.512] (-346.713) -- 0:00:19
693500 -- (-348.831) (-347.259) (-345.869) [-348.789] * (-344.432) (-346.529) [-348.725] (-345.984) -- 0:00:19
694000 -- (-350.102) (-346.717) (-346.300) [-348.952] * [-347.819] (-345.238) (-347.116) (-348.476) -- 0:00:18
694500 -- (-346.608) (-348.636) (-346.259) [-347.157] * [-349.784] (-351.637) (-352.959) (-346.679) -- 0:00:18
695000 -- (-345.419) [-348.364] (-344.427) (-348.735) * (-348.505) (-351.484) [-347.688] (-348.742) -- 0:00:18
Average standard deviation of split frequencies: 0.009525
695500 -- (-346.825) (-350.441) [-346.612] (-347.348) * (-347.522) [-348.654] (-345.824) (-348.564) -- 0:00:18
696000 -- (-347.441) (-346.007) (-344.648) [-349.080] * (-344.492) (-349.100) [-346.491] (-346.127) -- 0:00:18
696500 -- (-346.315) (-346.528) [-345.131] (-346.290) * [-344.483] (-345.329) (-345.641) (-349.141) -- 0:00:18
697000 -- (-346.670) (-348.276) [-345.611] (-346.514) * (-344.685) (-346.909) [-346.294] (-347.318) -- 0:00:18
697500 -- (-345.140) [-345.573] (-347.374) (-350.831) * [-344.675] (-348.773) (-345.735) (-345.548) -- 0:00:18
698000 -- (-347.482) (-345.523) (-352.952) [-349.787] * [-344.595] (-346.292) (-345.356) (-347.269) -- 0:00:18
698500 -- [-346.678] (-345.424) (-348.394) (-349.999) * (-346.188) (-349.769) (-345.901) [-346.091] -- 0:00:18
699000 -- (-350.956) [-345.161] (-349.386) (-347.287) * (-345.498) (-345.363) [-345.039] (-348.138) -- 0:00:18
699500 -- (-347.635) [-346.030] (-349.300) (-354.240) * [-347.928] (-347.668) (-352.431) (-348.790) -- 0:00:18
700000 -- (-346.886) (-348.500) [-349.774] (-350.990) * (-347.220) (-345.421) (-352.077) [-347.059] -- 0:00:18
Average standard deviation of split frequencies: 0.009756
700500 -- (-346.955) (-347.288) [-355.629] (-349.368) * (-346.539) [-346.758] (-347.891) (-347.211) -- 0:00:18
701000 -- (-345.418) (-346.215) (-352.366) [-344.812] * (-349.370) (-345.084) (-347.784) [-345.262] -- 0:00:18
701500 -- [-347.841] (-344.868) (-348.512) (-347.777) * [-347.759] (-345.131) (-350.785) (-346.467) -- 0:00:18
702000 -- (-344.659) (-348.051) (-346.171) [-344.877] * (-349.083) (-346.042) [-344.798] (-345.488) -- 0:00:18
702500 -- (-347.130) (-346.222) (-345.767) [-345.903] * (-349.518) [-349.120] (-346.670) (-345.857) -- 0:00:18
703000 -- (-345.355) (-345.783) [-345.196] (-345.542) * (-347.414) (-345.773) [-345.429] (-346.954) -- 0:00:18
703500 -- (-345.399) [-346.911] (-346.707) (-351.267) * (-348.201) (-347.814) (-344.798) [-347.719] -- 0:00:18
704000 -- [-346.170] (-346.992) (-346.212) (-351.757) * (-344.591) (-349.164) [-349.087] (-346.393) -- 0:00:18
704500 -- [-346.651] (-347.043) (-348.043) (-350.037) * (-345.359) (-349.860) (-346.051) [-348.095] -- 0:00:18
705000 -- [-347.795] (-347.564) (-345.351) (-349.078) * (-348.026) [-345.712] (-344.784) (-346.057) -- 0:00:18
Average standard deviation of split frequencies: 0.009974
705500 -- (-347.501) (-347.929) [-346.588] (-346.255) * (-349.899) (-345.344) (-345.087) [-346.446] -- 0:00:18
706000 -- (-352.158) [-346.677] (-347.373) (-352.569) * (-346.889) (-346.398) [-346.684] (-346.951) -- 0:00:18
706500 -- (-346.848) (-346.754) [-345.792] (-350.177) * (-345.748) (-345.726) [-347.061] (-346.936) -- 0:00:18
707000 -- (-347.121) (-347.919) (-346.275) [-348.416] * [-345.739] (-345.845) (-348.280) (-346.158) -- 0:00:18
707500 -- [-345.516] (-345.748) (-347.261) (-346.487) * (-346.179) (-345.808) [-352.280] (-346.590) -- 0:00:18
708000 -- [-344.971] (-345.341) (-345.442) (-347.014) * (-345.497) [-346.055] (-347.459) (-346.092) -- 0:00:18
708500 -- [-344.345] (-346.832) (-347.174) (-346.015) * (-347.284) (-346.580) (-347.573) [-344.979] -- 0:00:18
709000 -- (-347.269) (-346.064) (-355.064) [-348.070] * (-345.929) [-345.943] (-346.314) (-345.385) -- 0:00:18
709500 -- (-345.236) (-346.708) (-350.860) [-345.965] * [-346.161] (-347.717) (-348.456) (-344.608) -- 0:00:18
710000 -- (-346.528) (-347.870) [-345.392] (-345.396) * [-346.842] (-346.964) (-346.516) (-345.153) -- 0:00:17
Average standard deviation of split frequencies: 0.009596
710500 -- (-346.503) (-346.312) [-347.014] (-346.079) * (-348.138) [-345.479] (-347.834) (-345.885) -- 0:00:17
711000 -- (-345.600) (-346.628) (-345.961) [-344.418] * (-346.296) (-346.143) (-350.956) [-351.011] -- 0:00:17
711500 -- (-346.977) (-349.063) [-345.796] (-346.108) * (-345.667) (-346.628) (-346.058) [-345.484] -- 0:00:17
712000 -- (-349.465) (-346.758) (-344.568) [-347.273] * [-346.465] (-346.505) (-348.170) (-346.460) -- 0:00:17
712500 -- (-347.628) (-346.600) [-346.396] (-348.612) * (-346.767) (-346.029) (-348.239) [-346.324] -- 0:00:17
713000 -- [-346.625] (-345.422) (-348.345) (-348.759) * (-347.397) (-347.351) [-345.176] (-345.993) -- 0:00:17
713500 -- (-346.727) (-346.100) (-346.621) [-348.187] * (-350.394) [-345.490] (-344.802) (-345.614) -- 0:00:17
714000 -- [-344.811] (-345.822) (-346.033) (-346.938) * (-346.381) (-349.323) (-348.285) [-344.575] -- 0:00:17
714500 -- (-344.811) [-347.613] (-346.417) (-345.933) * (-345.598) (-346.015) (-345.339) [-346.464] -- 0:00:17
715000 -- (-345.284) [-348.191] (-346.850) (-346.721) * [-346.099] (-345.430) (-345.220) (-346.571) -- 0:00:17
Average standard deviation of split frequencies: 0.009832
715500 -- (-346.202) (-348.174) (-346.051) [-346.268] * (-344.690) [-348.315] (-346.801) (-347.310) -- 0:00:17
716000 -- [-347.386] (-347.028) (-347.002) (-346.829) * (-346.207) (-348.060) (-347.681) [-347.727] -- 0:00:17
716500 -- (-346.327) (-346.056) (-346.975) [-346.910] * (-346.736) (-346.111) [-347.565] (-345.793) -- 0:00:17
717000 -- (-345.595) (-347.997) (-345.155) [-345.877] * [-345.571] (-347.250) (-345.291) (-344.451) -- 0:00:17
717500 -- [-347.984] (-345.887) (-348.942) (-347.609) * (-346.662) [-346.808] (-348.367) (-348.251) -- 0:00:17
718000 -- (-347.441) (-349.838) [-347.120] (-346.631) * (-345.892) (-347.670) [-347.514] (-345.400) -- 0:00:17
718500 -- (-347.372) (-347.878) [-345.109] (-345.746) * (-346.187) [-347.070] (-349.316) (-345.521) -- 0:00:17
719000 -- (-347.250) (-351.092) (-348.077) [-344.469] * [-347.677] (-351.100) (-346.394) (-347.235) -- 0:00:17
719500 -- (-345.686) (-347.287) [-345.855] (-346.525) * (-347.680) (-346.200) (-347.675) [-348.251] -- 0:00:17
720000 -- (-346.848) (-347.021) [-345.658] (-346.706) * (-349.460) (-350.972) (-347.667) [-345.721] -- 0:00:17
Average standard deviation of split frequencies: 0.009550
720500 -- (-346.690) (-346.742) (-345.528) [-346.170] * [-346.214] (-349.189) (-346.826) (-348.498) -- 0:00:17
721000 -- (-346.159) (-347.617) (-345.297) [-346.692] * [-350.375] (-347.214) (-346.096) (-350.258) -- 0:00:17
721500 -- (-345.047) (-346.863) [-349.885] (-345.894) * (-346.920) [-347.376] (-347.479) (-346.857) -- 0:00:17
722000 -- (-346.939) [-344.823] (-344.917) (-346.077) * [-346.466] (-347.575) (-345.088) (-349.964) -- 0:00:17
722500 -- (-346.633) (-348.839) (-347.087) [-344.868] * (-345.234) (-347.483) (-347.974) [-346.109] -- 0:00:17
723000 -- (-348.877) (-346.917) [-346.043] (-345.380) * (-348.123) (-348.508) (-345.486) [-346.807] -- 0:00:17
723500 -- (-347.360) [-352.017] (-346.909) (-348.543) * (-345.239) (-350.536) [-345.956] (-346.675) -- 0:00:17
724000 -- (-346.018) [-346.626] (-347.925) (-349.196) * (-345.045) (-345.480) (-345.957) [-345.816] -- 0:00:17
724500 -- (-346.287) (-346.808) [-348.883] (-351.464) * (-349.571) (-345.299) (-347.030) [-347.731] -- 0:00:17
725000 -- (-346.295) (-348.772) [-345.875] (-352.312) * (-345.713) (-347.030) (-348.171) [-344.745] -- 0:00:17
Average standard deviation of split frequencies: 0.010105
725500 -- (-345.171) (-347.978) [-345.273] (-346.850) * (-348.300) (-348.216) (-347.626) [-344.860] -- 0:00:17
726000 -- (-344.687) (-347.274) [-345.727] (-345.024) * (-346.764) [-351.051] (-346.475) (-347.942) -- 0:00:16
726500 -- [-347.585] (-349.293) (-345.573) (-348.390) * [-345.549] (-346.537) (-346.415) (-346.077) -- 0:00:16
727000 -- (-347.166) (-344.794) [-346.701] (-351.583) * (-350.233) [-349.247] (-347.750) (-350.276) -- 0:00:16
727500 -- (-350.804) (-344.747) (-347.338) [-347.097] * [-345.395] (-345.610) (-348.249) (-349.224) -- 0:00:16
728000 -- (-346.685) [-346.492] (-345.698) (-353.614) * (-346.218) (-347.392) [-348.336] (-347.243) -- 0:00:16
728500 -- [-347.597] (-349.300) (-346.233) (-349.762) * (-347.807) [-345.603] (-347.235) (-345.604) -- 0:00:16
729000 -- [-345.306] (-350.407) (-351.433) (-346.608) * [-350.633] (-344.892) (-348.616) (-344.705) -- 0:00:16
729500 -- [-349.461] (-344.939) (-350.268) (-345.028) * (-348.169) [-346.015] (-346.277) (-345.065) -- 0:00:16
730000 -- (-347.255) (-348.995) (-345.714) [-346.176] * (-351.631) (-349.525) (-347.259) [-345.836] -- 0:00:16
Average standard deviation of split frequencies: 0.010403
730500 -- [-350.856] (-349.027) (-345.511) (-349.537) * (-352.296) (-346.457) (-353.242) [-345.787] -- 0:00:16
731000 -- (-349.044) (-347.721) [-345.133] (-349.318) * (-349.304) [-345.374] (-349.537) (-348.917) -- 0:00:16
731500 -- (-348.207) (-347.270) (-346.044) [-347.660] * [-346.282] (-345.419) (-346.444) (-348.458) -- 0:00:16
732000 -- (-347.206) [-349.389] (-351.170) (-347.153) * (-348.371) (-345.957) (-348.995) [-346.663] -- 0:00:16
732500 -- (-345.660) (-348.186) (-348.107) [-346.152] * (-345.750) (-345.523) (-346.929) [-347.602] -- 0:00:16
733000 -- (-345.358) (-345.804) [-345.647] (-346.364) * (-348.339) (-345.328) [-346.805] (-349.495) -- 0:00:16
733500 -- [-344.690] (-349.319) (-345.734) (-345.056) * (-348.290) (-345.634) [-346.320] (-348.637) -- 0:00:16
734000 -- (-344.819) (-347.583) [-345.990] (-346.718) * (-349.105) (-347.646) (-345.878) [-349.034] -- 0:00:16
734500 -- (-345.447) [-345.055] (-345.575) (-349.623) * (-352.600) (-345.261) (-345.131) [-348.172] -- 0:00:16
735000 -- (-346.568) (-347.123) (-350.047) [-347.549] * (-347.361) [-347.459] (-344.582) (-345.934) -- 0:00:16
Average standard deviation of split frequencies: 0.010128
735500 -- (-345.131) [-346.253] (-345.241) (-345.296) * [-344.977] (-346.263) (-345.271) (-344.990) -- 0:00:16
736000 -- (-348.573) (-347.844) [-344.606] (-345.756) * [-346.449] (-346.598) (-346.177) (-350.001) -- 0:00:16
736500 -- (-344.615) (-349.231) (-349.566) [-351.603] * [-346.855] (-345.413) (-346.134) (-346.954) -- 0:00:16
737000 -- [-345.144] (-349.965) (-344.782) (-349.996) * (-345.975) [-347.949] (-346.409) (-347.937) -- 0:00:16
737500 -- (-347.441) (-348.926) [-344.881] (-345.463) * (-345.722) [-347.414] (-347.627) (-348.420) -- 0:00:16
738000 -- [-345.653] (-349.780) (-349.630) (-348.317) * (-347.538) (-350.540) (-347.874) [-345.455] -- 0:00:16
738500 -- (-350.086) [-346.910] (-345.410) (-345.002) * [-344.908] (-346.412) (-346.293) (-353.869) -- 0:00:16
739000 -- [-347.797] (-347.563) (-347.509) (-346.783) * (-347.220) [-348.026] (-348.292) (-349.672) -- 0:00:16
739500 -- (-347.436) (-345.648) [-345.584] (-349.330) * (-345.455) [-347.906] (-345.431) (-351.182) -- 0:00:16
740000 -- (-346.874) (-346.270) [-344.932] (-346.899) * [-344.641] (-347.737) (-348.719) (-350.803) -- 0:00:16
Average standard deviation of split frequencies: 0.010064
740500 -- (-349.431) (-345.109) (-345.792) [-346.772] * (-344.951) (-347.336) [-350.104] (-345.755) -- 0:00:16
741000 -- [-350.184] (-349.898) (-344.970) (-346.231) * (-345.880) (-347.459) (-352.500) [-351.206] -- 0:00:16
741500 -- (-348.476) (-345.915) [-344.966] (-351.671) * (-348.639) (-346.258) [-345.361] (-348.325) -- 0:00:16
742000 -- [-345.320] (-344.993) (-348.475) (-350.191) * (-347.369) (-346.517) (-347.818) [-347.259] -- 0:00:15
742500 -- (-347.632) [-344.656] (-345.269) (-346.555) * [-346.564] (-348.522) (-346.859) (-345.676) -- 0:00:15
743000 -- (-346.348) (-347.893) (-346.639) [-345.846] * (-352.208) (-346.117) [-347.994] (-345.887) -- 0:00:15
743500 -- (-346.350) (-346.325) (-346.272) [-348.423] * [-345.733] (-346.553) (-348.711) (-346.286) -- 0:00:15
744000 -- (-345.449) (-349.402) (-346.840) [-345.966] * (-346.497) (-347.623) [-346.442] (-347.406) -- 0:00:15
744500 -- (-345.651) (-345.809) [-346.040] (-344.719) * (-350.928) [-348.072] (-346.623) (-346.021) -- 0:00:15
745000 -- (-349.977) [-345.385] (-345.643) (-346.703) * [-350.019] (-347.782) (-351.292) (-349.838) -- 0:00:15
Average standard deviation of split frequencies: 0.010584
745500 -- [-347.571] (-344.831) (-348.160) (-348.921) * [-347.789] (-345.912) (-346.477) (-351.112) -- 0:00:15
746000 -- (-346.972) [-348.378] (-347.248) (-348.561) * (-345.066) (-349.485) [-347.422] (-351.999) -- 0:00:15
746500 -- (-348.243) [-346.696] (-346.201) (-346.164) * (-344.457) (-351.785) (-346.608) [-346.704] -- 0:00:15
747000 -- (-345.370) [-346.086] (-346.416) (-346.113) * (-347.068) [-350.496] (-346.100) (-351.837) -- 0:00:15
747500 -- (-346.749) [-345.587] (-345.817) (-348.408) * (-346.627) (-352.906) [-347.080] (-347.451) -- 0:00:15
748000 -- [-348.921] (-345.802) (-352.434) (-348.176) * (-347.660) (-351.859) (-345.973) [-346.189] -- 0:00:15
748500 -- (-348.070) [-345.902] (-345.782) (-347.335) * (-347.204) (-353.638) (-346.788) [-346.916] -- 0:00:15
749000 -- (-345.157) (-344.993) (-346.728) [-345.532] * (-349.334) (-349.749) [-347.378] (-345.747) -- 0:00:15
749500 -- (-347.115) (-348.101) [-345.335] (-346.327) * (-348.015) [-345.201] (-345.976) (-344.636) -- 0:00:15
750000 -- [-345.334] (-346.846) (-347.423) (-345.391) * (-345.964) (-345.914) [-347.647] (-346.060) -- 0:00:15
Average standard deviation of split frequencies: 0.010754
750500 -- (-349.166) (-348.361) (-348.655) [-347.932] * (-348.277) (-348.781) (-352.473) [-349.715] -- 0:00:15
751000 -- (-346.211) (-346.974) [-345.357] (-347.234) * (-350.068) [-346.978] (-348.038) (-345.742) -- 0:00:15
751500 -- (-345.036) (-348.449) (-346.124) [-346.134] * [-344.864] (-347.065) (-346.537) (-346.526) -- 0:00:15
752000 -- (-345.350) (-350.954) [-347.006] (-352.842) * (-344.461) (-345.840) (-348.037) [-347.412] -- 0:00:15
752500 -- [-347.541] (-349.035) (-351.844) (-349.623) * (-346.819) [-347.891] (-344.858) (-348.407) -- 0:00:15
753000 -- (-345.584) (-346.845) (-346.264) [-347.227] * (-349.250) (-349.187) (-351.457) [-349.053] -- 0:00:15
753500 -- (-348.366) (-348.072) (-347.219) [-348.320] * [-347.313] (-347.249) (-349.857) (-349.559) -- 0:00:15
754000 -- (-346.709) (-345.875) (-349.910) [-346.296] * (-351.818) [-346.044] (-346.360) (-346.909) -- 0:00:15
754500 -- [-345.539] (-348.722) (-346.459) (-348.470) * (-351.815) (-345.870) [-346.116] (-345.672) -- 0:00:15
755000 -- (-345.545) [-346.876] (-346.387) (-345.613) * (-349.362) (-347.061) [-348.655] (-345.183) -- 0:00:15
Average standard deviation of split frequencies: 0.010483
755500 -- (-346.382) [-347.123] (-346.400) (-347.699) * (-348.444) (-346.323) (-345.530) [-346.183] -- 0:00:15
756000 -- [-346.344] (-347.545) (-345.967) (-348.220) * (-346.969) (-345.309) [-347.606] (-346.611) -- 0:00:15
756500 -- (-345.381) [-351.694] (-344.857) (-346.618) * (-347.613) [-345.629] (-345.855) (-347.423) -- 0:00:15
757000 -- (-346.573) [-346.779] (-351.454) (-346.510) * (-349.971) (-346.349) (-347.746) [-348.484] -- 0:00:15
757500 -- (-347.511) [-344.914] (-346.699) (-347.507) * (-346.817) (-348.532) [-347.078] (-348.166) -- 0:00:15
758000 -- (-345.585) (-350.400) [-347.243] (-345.613) * [-345.719] (-350.221) (-346.277) (-346.416) -- 0:00:15
758500 -- (-347.605) [-348.189] (-346.181) (-345.055) * (-349.759) (-346.407) [-347.254] (-347.182) -- 0:00:14
759000 -- (-346.474) (-351.195) [-345.603] (-348.584) * [-350.073] (-347.875) (-346.111) (-346.943) -- 0:00:14
759500 -- (-345.598) (-345.708) (-350.023) [-344.935] * [-347.111] (-346.923) (-349.940) (-345.121) -- 0:00:14
760000 -- (-345.019) (-350.106) (-351.630) [-344.716] * (-350.389) (-346.274) [-349.024] (-344.891) -- 0:00:14
Average standard deviation of split frequencies: 0.010458
760500 -- (-348.709) (-347.397) [-347.370] (-344.673) * [-344.540] (-345.186) (-345.094) (-344.399) -- 0:00:14
761000 -- [-347.731] (-349.139) (-346.613) (-344.688) * (-345.380) [-347.119] (-347.171) (-346.260) -- 0:00:14
761500 -- (-348.078) [-348.173] (-352.117) (-345.320) * (-352.231) (-346.765) [-347.276] (-345.856) -- 0:00:14
762000 -- (-345.027) (-350.012) (-347.289) [-345.092] * (-348.786) (-347.404) [-350.080] (-348.924) -- 0:00:14
762500 -- [-345.577] (-347.881) (-346.724) (-352.259) * (-349.885) (-344.807) (-348.041) [-348.002] -- 0:00:14
763000 -- (-347.734) [-351.888] (-345.567) (-345.461) * (-348.022) [-344.678] (-345.580) (-345.136) -- 0:00:14
763500 -- (-347.456) (-348.733) [-346.390] (-349.710) * (-345.044) [-348.945] (-348.509) (-347.059) -- 0:00:14
764000 -- [-346.043] (-349.231) (-345.246) (-348.629) * (-346.196) (-347.174) (-345.884) [-344.710] -- 0:00:14
764500 -- [-344.856] (-355.015) (-348.441) (-350.225) * (-345.356) (-345.952) [-347.485] (-349.381) -- 0:00:14
765000 -- (-346.538) [-349.295] (-347.323) (-346.120) * (-346.703) [-347.672] (-349.430) (-349.606) -- 0:00:14
Average standard deviation of split frequencies: 0.010424
765500 -- (-350.537) (-353.799) (-346.141) [-347.214] * (-348.313) (-346.261) (-349.552) [-348.921] -- 0:00:14
766000 -- (-349.738) (-346.960) (-344.892) [-349.977] * [-349.288] (-346.469) (-346.507) (-346.971) -- 0:00:14
766500 -- (-346.049) (-345.109) (-347.080) [-347.931] * [-346.659] (-345.855) (-346.033) (-346.957) -- 0:00:14
767000 -- (-346.572) (-348.279) [-346.038] (-345.472) * (-348.677) [-347.446] (-345.024) (-347.240) -- 0:00:14
767500 -- (-346.950) (-346.290) (-347.805) [-346.714] * (-347.863) (-348.856) (-346.465) [-349.260] -- 0:00:14
768000 -- (-347.141) [-347.258] (-347.080) (-352.299) * (-346.932) [-347.670] (-346.787) (-347.341) -- 0:00:14
768500 -- [-344.938] (-349.099) (-348.760) (-352.937) * (-351.582) [-352.658] (-346.116) (-349.516) -- 0:00:14
769000 -- [-345.171] (-349.004) (-349.928) (-346.852) * (-350.978) [-347.648] (-346.626) (-345.498) -- 0:00:14
769500 -- (-351.947) (-348.431) (-347.113) [-345.308] * (-347.908) (-347.429) [-346.124] (-345.333) -- 0:00:14
770000 -- (-350.065) (-345.765) (-348.239) [-345.205] * (-349.065) [-347.621] (-346.701) (-346.869) -- 0:00:14
Average standard deviation of split frequencies: 0.010255
770500 -- [-348.789] (-345.920) (-345.702) (-346.862) * [-346.536] (-345.157) (-349.400) (-347.042) -- 0:00:14
771000 -- [-348.499] (-344.982) (-346.379) (-347.025) * [-346.391] (-345.454) (-352.822) (-345.794) -- 0:00:14
771500 -- (-345.749) [-347.273] (-345.249) (-347.079) * [-346.243] (-349.067) (-349.172) (-348.856) -- 0:00:14
772000 -- (-348.445) (-346.956) [-348.153] (-347.381) * (-346.695) [-344.789] (-353.543) (-347.559) -- 0:00:14
772500 -- (-346.376) (-348.215) (-345.212) [-347.212] * (-347.724) (-346.314) [-349.063] (-346.720) -- 0:00:14
773000 -- (-346.308) (-347.947) (-345.616) [-347.564] * (-349.024) (-346.020) [-344.522] (-347.321) -- 0:00:14
773500 -- (-344.730) (-349.535) (-346.124) [-346.258] * (-352.410) (-345.671) (-345.776) [-345.024] -- 0:00:14
774000 -- (-347.596) (-344.842) [-345.914] (-346.709) * (-347.439) [-345.684] (-347.028) (-347.746) -- 0:00:14
774500 -- (-345.940) (-345.467) [-345.276] (-348.090) * [-346.456] (-349.592) (-345.372) (-348.997) -- 0:00:13
775000 -- (-346.095) [-347.041] (-346.025) (-348.572) * (-346.403) (-346.245) (-346.948) [-345.302] -- 0:00:13
Average standard deviation of split frequencies: 0.010649
775500 -- (-349.339) (-346.069) (-345.042) [-346.016] * (-346.503) (-352.501) (-348.937) [-346.960] -- 0:00:13
776000 -- (-345.806) (-347.043) (-345.909) [-347.531] * [-347.405] (-348.218) (-349.865) (-345.397) -- 0:00:13
776500 -- [-345.278] (-346.992) (-349.490) (-345.459) * (-347.142) (-348.662) [-347.623] (-346.797) -- 0:00:13
777000 -- (-346.827) [-347.963] (-348.083) (-345.618) * (-347.486) (-346.147) [-345.892] (-346.143) -- 0:00:13
777500 -- (-344.871) (-346.967) [-346.476] (-345.245) * (-345.989) [-350.191] (-347.736) (-351.949) -- 0:00:13
778000 -- (-348.142) [-346.710] (-344.667) (-347.088) * (-347.672) (-347.311) [-350.052] (-351.808) -- 0:00:13
778500 -- [-346.443] (-348.356) (-346.581) (-350.761) * (-351.825) [-348.246] (-356.520) (-351.422) -- 0:00:13
779000 -- (-348.230) (-346.939) (-348.290) [-345.644] * (-349.244) (-347.043) [-346.315] (-347.458) -- 0:00:13
779500 -- (-353.634) (-345.349) (-347.033) [-348.323] * [-345.094] (-346.763) (-348.120) (-346.343) -- 0:00:13
780000 -- (-348.837) (-346.848) [-345.543] (-346.479) * (-347.300) [-347.858] (-349.356) (-349.756) -- 0:00:13
Average standard deviation of split frequencies: 0.010945
780500 -- (-351.416) [-348.748] (-345.841) (-344.503) * (-353.513) [-346.945] (-348.014) (-346.774) -- 0:00:13
781000 -- (-348.407) [-353.386] (-346.784) (-346.349) * (-352.271) (-346.892) [-347.484] (-350.338) -- 0:00:13
781500 -- (-347.721) (-348.579) (-346.471) [-347.502] * [-350.599] (-347.111) (-345.463) (-347.902) -- 0:00:13
782000 -- [-345.937] (-347.819) (-349.337) (-351.400) * (-347.174) (-347.010) [-346.526] (-350.308) -- 0:00:13
782500 -- (-348.696) [-345.324] (-349.290) (-347.337) * [-349.246] (-347.985) (-350.181) (-349.799) -- 0:00:13
783000 -- (-346.218) [-345.287] (-351.604) (-348.813) * (-347.054) (-348.018) (-351.169) [-349.741] -- 0:00:13
783500 -- [-346.932] (-346.558) (-348.553) (-345.934) * [-346.687] (-346.147) (-347.423) (-346.982) -- 0:00:13
784000 -- (-345.296) [-345.058] (-346.385) (-345.245) * (-347.734) [-347.341] (-347.153) (-348.106) -- 0:00:13
784500 -- [-347.050] (-348.524) (-349.238) (-344.797) * (-348.151) (-347.661) (-347.023) [-345.352] -- 0:00:13
785000 -- [-346.635] (-345.535) (-348.073) (-345.233) * (-347.102) (-351.327) (-345.824) [-350.027] -- 0:00:13
Average standard deviation of split frequencies: 0.010758
785500 -- [-347.323] (-347.540) (-347.039) (-346.242) * (-349.068) (-349.382) (-344.331) [-346.028] -- 0:00:13
786000 -- (-345.281) (-346.829) (-347.960) [-346.831] * [-345.200] (-352.801) (-345.276) (-344.435) -- 0:00:1 