--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 17:59:40 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0556/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0556/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0556/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0556/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2058.84 -2061.40 2 -2058.87 -2062.13 -------------------------------------- TOTAL -2058.85 -2061.83 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0556/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0556/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0556/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.895976 0.090008 0.388243 1.502427 0.864469 1458.38 1479.69 1.000 r(A<->C){all} 0.162826 0.018384 0.000050 0.432843 0.130917 128.09 207.01 1.013 r(A<->G){all} 0.168098 0.019049 0.000019 0.436399 0.133858 235.51 277.67 1.000 r(A<->T){all} 0.155940 0.019579 0.000006 0.458521 0.114737 138.30 206.73 1.002 r(C<->G){all} 0.168635 0.019183 0.000097 0.443454 0.135023 307.60 311.94 1.001 r(C<->T){all} 0.178717 0.019885 0.000019 0.458536 0.146674 190.16 193.58 1.001 r(G<->T){all} 0.165785 0.019397 0.000244 0.444248 0.130415 226.96 262.42 1.000 pi(A){all} 0.165144 0.000093 0.146030 0.183578 0.165045 1127.87 1314.44 1.000 pi(C){all} 0.301724 0.000136 0.279656 0.324575 0.301348 1290.95 1357.41 1.000 pi(G){all} 0.332529 0.000145 0.311287 0.357917 0.332298 1256.42 1297.82 1.000 pi(T){all} 0.200603 0.000103 0.180769 0.220592 0.200466 1240.56 1272.60 1.000 alpha{1,2} 0.420318 0.243349 0.000297 1.382250 0.248673 946.69 1079.82 1.000 alpha{3} 0.495770 0.273857 0.000527 1.548992 0.331810 1405.65 1410.38 1.000 pinvar{all} 0.999034 0.000001 0.996828 0.999999 0.999388 1102.25 1184.91 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1947.913716 Model 2: PositiveSelection -1947.913716 Model 0: one-ratio -1947.914293 Model 7: beta -1947.913716 Model 8: beta&w>1 -1947.913716 Model 0 vs 1 0.0011540000000422879 Model 2 vs 1 0.0 Model 8 vs 7 0.0
>C1 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C2 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C3 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C4 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C5 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C6 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=509 C1 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C2 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C3 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C4 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C5 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C6 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT ************************************************** C1 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C2 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C3 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C4 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C5 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C6 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF ************************************************** C1 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C2 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C3 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C4 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C5 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C6 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL ************************************************** C1 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C2 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C3 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C4 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C5 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C6 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL ************************************************** C1 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C2 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C3 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C4 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C5 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C6 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA ************************************************** C1 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C2 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C3 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C4 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C5 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C6 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG ************************************************** C1 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C2 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C3 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C4 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C5 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C6 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG ************************************************** C1 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C2 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C3 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C4 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C5 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C6 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL ************************************************** C1 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C2 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C3 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C4 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C5 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C6 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP ************************************************** C1 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C2 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C3 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C4 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C5 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C6 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE ************************************************** C1 HASEPKVPE C2 HASEPKVPE C3 HASEPKVPE C4 HASEPKVPE C5 HASEPKVPE C6 HASEPKVPE ********* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 509 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 509 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15270] Library Relaxation: Multi_proc [96] Relaxation Summary: [15270]--->[15270] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.562 Mb, Max= 31.110 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C2 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C3 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C4 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C5 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT C6 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT ************************************************** C1 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C2 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C3 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C4 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C5 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF C6 WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF ************************************************** C1 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C2 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C3 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C4 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C5 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL C6 GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL ************************************************** C1 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C2 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C3 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C4 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C5 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL C6 GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL ************************************************** C1 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C2 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C3 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C4 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C5 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA C6 EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA ************************************************** C1 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C2 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C3 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C4 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C5 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG C6 FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG ************************************************** C1 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C2 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C3 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C4 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C5 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG C6 VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG ************************************************** C1 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C2 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C3 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C4 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C5 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL C6 YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL ************************************************** C1 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C2 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C3 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C4 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C5 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP C6 RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP ************************************************** C1 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C2 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C3 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C4 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C5 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE C6 PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE ************************************************** C1 HASEPKVPE C2 HASEPKVPE C3 HASEPKVPE C4 HASEPKVPE C5 HASEPKVPE C6 HASEPKVPE ********* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC C2 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC C3 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC C4 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC C5 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC C6 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC ************************************************** C1 AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG C2 AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG C3 AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG C4 AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG C5 AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG C6 AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG ************************************************** C1 ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC C2 ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC C3 ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC C4 ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC C5 ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC C6 ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC ************************************************** C1 TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT C2 TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT C3 TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT C4 TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT C5 TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT C6 TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT ************************************************** C1 GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT C2 GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT C3 GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT C4 GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT C5 GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT C6 GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT ************************************************** C1 TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT C2 TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT C3 TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT C4 TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT C5 TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT C6 TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT ************************************************** C1 GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG C2 GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG C3 GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG C4 GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG C5 GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG C6 GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG ************************************************** C1 CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC C2 CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC C3 CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC C4 CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC C5 CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC C6 CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC ************************************************** C1 AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC C2 AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC C3 AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC C4 AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC C5 AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC C6 AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC ************************************************** C1 GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG C2 GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG C3 GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG C4 GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG C5 GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG C6 GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG ************************************************** C1 CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA C2 CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA C3 CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA C4 CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA C5 CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA C6 CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA ************************************************** C1 TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG C2 TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG C3 TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG C4 TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG C5 TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG C6 TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG ************************************************** C1 GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT C2 GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT C3 GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT C4 GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT C5 GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT C6 GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT ************************************************** C1 GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC C2 GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC C3 GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC C4 GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC C5 GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC C6 GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC ************************************************** C1 CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA C2 CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA C3 CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA C4 CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA C5 CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA C6 CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA ************************************************** C1 TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG C2 TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG C3 TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG C4 TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG C5 TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG C6 TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG ************************************************** C1 TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG C2 TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG C3 TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG C4 TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG C5 TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG C6 TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG ************************************************** C1 GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC C2 GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC C3 GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC C4 GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC C5 GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC C6 GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC ************************************************** C1 GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT C2 GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT C3 GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT C4 GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT C5 GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT C6 GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT ************************************************** C1 GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG C2 GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG C3 GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG C4 GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG C5 GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG C6 GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG ************************************************** C1 CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC C2 CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC C3 CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC C4 CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC C5 CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC C6 CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC ************************************************** C1 TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG C2 TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG C3 TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG C4 TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG C5 TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG C6 TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG ************************************************** C1 CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG C2 CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG C3 CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG C4 CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG C5 CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG C6 CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG ************************************************** C1 CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG C2 CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG C3 CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG C4 CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG C5 CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG C6 CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG ************************************************** C1 CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT C2 CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT C3 CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT C4 CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT C5 CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT C6 CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT ************************************************** C1 CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG C2 CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG C3 CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG C4 CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG C5 CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG C6 CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG ************************************************** C1 GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG C2 GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG C3 GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG C4 GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG C5 GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG C6 GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG ************************************************** C1 CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA C2 CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA C3 CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA C4 CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA C5 CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA C6 CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA ************************************************** C1 ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG C2 ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG C3 ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG C4 ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG C5 ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG C6 ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG ************************************************** C1 TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA C2 TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA C3 TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA C4 TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA C5 TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA C6 TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA ************************************************** C1 CACGCGAGCGAGCCAAAAGTCCCCGAG C2 CACGCGAGCGAGCCAAAAGTCCCCGAG C3 CACGCGAGCGAGCCAAAAGTCCCCGAG C4 CACGCGAGCGAGCCAAAAGTCCCCGAG C5 CACGCGAGCGAGCCAAAAGTCCCCGAG C6 CACGCGAGCGAGCCAAAAGTCCCCGAG *************************** >C1 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA CACGCGAGCGAGCCAAAAGTCCCCGAG >C2 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA CACGCGAGCGAGCCAAAAGTCCCCGAG >C3 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA CACGCGAGCGAGCCAAAAGTCCCCGAG >C4 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA CACGCGAGCGAGCCAAAAGTCCCCGAG >C5 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA CACGCGAGCGAGCCAAAAGTCCCCGAG >C6 ATGAGCACGCGGGCGGGACGCCGAGTTGCGATCAGCGCCGGCAGCCTCGC AGTACTGCTGGGGGCTCTGGACACCTATGTCGTGGTCACCATCATGCGCG ACATCATGCACGACGTTGGCATCCCGGTAAACCAGATGCAGCGGATCACC TGGATCGTCACGATGTATCTGCTGGGCTACATCGCCGCAATGCCGCTGCT GAGCCGAGCTTCCGACCGATTTGGCCGCAAGTTGCTGTTGCAGGTCAGCT TGGCCGGATTCGCCATCGGGTCAGTGATGACCGCACTAGCCGGACAATTT GGCGACTTTCATATGCTGATCGCAGGCCGCACCATCCAGGGGGTCGCCAG CGGCGCGCTGCTACCGATCACCCTTGCACTGGGCGCCGACCTGTGGGCGC AGCGCAACCGCGCTGGCGTGCTCGGTGGCATTGGCGCCGCGCAGGAGCTC GGCAGTGTGCTGGGTCCGCTGTACGGCATCTTCATCGTTTGGCTATTCAG CGATTGGCGATACGTGTTCTGGATCAACATCCCGCTGACCGCGATCGCCA TGCTGATGATCCAAGTCAGCCTGTCAGCGCACGACCGCGGTGACGAGCTG GAAAAGGTCGACGTGGTCGGCGGTGTGCTGTTGGCCATCGCGCTGGGCCT GGTGGTCATCGGACTATACAATCCCCAACCCGACAGCAAACAGGTGCTGC CGAGCTATGGGGTGCCCGTACTGGTCGGGGGGATCGTCGCCACGGTGGCA TTCGCGGTCTGGGAGCGCTGCGCACGCACCCGGCTGATCGACCCTGCCGG TGTGCACATCCGACCGTTCCTGTCCGCACTGGGCGCATCGGTCGCTGCGG GCGCGGCGCTAATGGTGACACTGGTCAATGTGGAGCTGTTCGGCCAGGGC GTGTTGGGAATGGACCAAACCCAAGCAGCCGGGCTGCTGGTGTGGTTTCT GATCGCGCTGCCGATCGGGGCGGTGTTGGGCGGGTGGGGCGCCACCAAGG CTGGTGACCGCACGATGACCTTCGTCGGGCTGCTCATCACTGCGGGCGGC TATTGGCTGATCTCACATTGGCCAGTCGACTTGTTGAACTACCGGCGCAG CATCTTCGGGCTGTTCAGTGTGCCCACGATGTACGCCGACCTGTTGGTGG CCGGCCTGGGACTTGGCCTGGTGATCGGTCCACTGTCTTCGGCTACCCTG CGAGTTGTCCCGACGGCGCAGCACGGCATCGCCTCAGCGGCAGTGGTGGT CGCCAGGATGACCGGCATGTTGATCGGAGTAGCCGCACTGACCGCCTGGG GGTTGTACCGGTTCAACCAGATCCTTGCGGGGTTGTCTACGGCGGTCCCG CCCGATGCCACCCTGATTGAACGCGCGGCTGCGGTAGCCGACCAGGCCAA ACGTGCATACACGATGATGTACAGCGACATATTCATGATCACCGCCATCG TGTGTGTCATCGGAGCACTGCTGGGTCTGCTGATCAGCAGCCGCAAAGAA CACGCGAGCGAGCCAAAAGTCCCCGAG >C1 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C2 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C3 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C4 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C5 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE >C6 MSTRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMHDVGIPVNQMQRIT WIVTMYLLGYIAAMPLLSRASDRFGRKLLLQVSLAGFAIGSVMTALAGQF GDFHMLIAGRTIQGVASGALLPITLALGADLWAQRNRAGVLGGIGAAQEL GSVLGPLYGIFIVWLFSDWRYVFWINIPLTAIAMLMIQVSLSAHDRGDEL EKVDVVGGVLLAIALGLVVIGLYNPQPDSKQVLPSYGVPVLVGGIVATVA FAVWERCARTRLIDPAGVHIRPFLSALGASVAAGAALMVTLVNVELFGQG VLGMDQTQAAGLLVWFLIALPIGAVLGGWGATKAGDRTMTFVGLLITAGG YWLISHWPVDLLNYRRSIFGLFSVPTMYADLLVAGLGLGLVIGPLSSATL RVVPTAQHGIASAAVVVARMTGMLIGVAALTAWGLYRFNQILAGLSTAVP PDATLIERAAAVADQAKRAYTMMYSDIFMITAIVCVIGALLGLLISSRKE HASEPKVPE MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0556/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1527 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579802297 Setting output file names to "/data/4res/ML0556/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1253361612 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 1869457029 Seed = 1893197785 Swapseed = 1579802297 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3417.499201 -- -24.965149 Chain 2 -- -3417.499201 -- -24.965149 Chain 3 -- -3417.499003 -- -24.965149 Chain 4 -- -3417.499201 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3417.499201 -- -24.965149 Chain 2 -- -3417.499201 -- -24.965149 Chain 3 -- -3417.499003 -- -24.965149 Chain 4 -- -3417.499003 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3417.499] (-3417.499) (-3417.499) (-3417.499) * [-3417.499] (-3417.499) (-3417.499) (-3417.499) 500 -- (-2104.039) (-2066.798) (-2126.392) [-2080.253] * (-2090.172) [-2073.560] (-2073.064) (-2073.526) -- 0:00:00 1000 -- (-2079.536) [-2065.932] (-2125.919) (-2072.084) * (-2087.256) [-2076.585] (-2070.944) (-2072.184) -- 0:00:00 1500 -- (-2073.059) [-2067.850] (-2076.353) (-2066.156) * (-2074.521) [-2064.722] (-2068.181) (-2074.385) -- 0:00:00 2000 -- (-2073.329) [-2066.027] (-2072.426) (-2075.299) * (-2076.715) (-2069.109) [-2070.800] (-2072.962) -- 0:00:00 2500 -- (-2071.766) [-2066.953] (-2068.178) (-2067.836) * (-2068.471) (-2067.229) (-2068.527) [-2066.105] -- 0:00:00 3000 -- [-2063.185] (-2072.261) (-2071.162) (-2070.562) * (-2071.977) [-2068.932] (-2074.641) (-2070.872) -- 0:00:00 3500 -- (-2063.300) [-2074.721] (-2073.427) (-2074.928) * (-2067.247) (-2082.298) (-2070.287) [-2075.022] -- 0:00:00 4000 -- [-2072.745] (-2076.321) (-2070.752) (-2067.945) * (-2063.470) (-2078.560) [-2065.842] (-2067.455) -- 0:00:00 4500 -- (-2066.632) (-2069.214) (-2068.161) [-2067.975] * (-2072.057) (-2072.168) (-2069.645) [-2068.659] -- 0:00:00 5000 -- [-2066.743] (-2068.139) (-2066.862) (-2067.682) * (-2068.702) (-2070.709) [-2070.355] (-2072.215) -- 0:00:00 Average standard deviation of split frequencies: 0.081983 5500 -- (-2066.637) [-2068.262] (-2067.270) (-2071.399) * [-2065.903] (-2072.138) (-2074.762) (-2070.967) -- 0:00:00 6000 -- [-2067.719] (-2068.226) (-2072.338) (-2065.939) * (-2067.683) (-2076.466) (-2070.328) [-2070.467] -- 0:00:00 6500 -- [-2065.861] (-2072.491) (-2067.116) (-2067.261) * (-2065.520) (-2070.526) (-2067.950) [-2064.894] -- 0:00:00 7000 -- [-2066.817] (-2072.689) (-2067.266) (-2070.000) * [-2064.719] (-2069.292) (-2068.173) (-2085.079) -- 0:00:00 7500 -- (-2069.206) [-2069.231] (-2070.389) (-2071.833) * [-2063.344] (-2077.402) (-2067.668) (-2069.023) -- 0:00:00 8000 -- (-2069.606) [-2067.372] (-2069.805) (-2070.544) * (-2068.778) (-2073.433) (-2078.371) [-2070.846] -- 0:00:00 8500 -- [-2063.908] (-2067.976) (-2066.835) (-2076.605) * (-2072.614) (-2070.182) (-2067.246) [-2063.927] -- 0:00:00 9000 -- [-2072.963] (-2064.057) (-2074.786) (-2072.254) * [-2070.658] (-2066.720) (-2071.258) (-2079.504) -- 0:00:00 9500 -- (-2071.347) (-2067.959) (-2077.732) [-2070.048] * (-2077.765) (-2063.749) [-2067.690] (-2073.596) -- 0:00:00 10000 -- [-2066.629] (-2062.906) (-2071.794) (-2071.949) * [-2070.184] (-2065.053) (-2068.807) (-2074.415) -- 0:00:00 Average standard deviation of split frequencies: 0.061030 10500 -- (-2076.218) [-2068.183] (-2068.761) (-2066.244) * (-2065.847) (-2066.143) [-2065.042] (-2069.688) -- 0:00:00 11000 -- (-2065.649) (-2070.232) (-2069.035) [-2065.290] * (-2066.633) [-2061.498] (-2071.305) (-2073.482) -- 0:00:00 11500 -- [-2064.162] (-2066.242) (-2071.037) (-2069.007) * (-2070.474) (-2070.261) [-2072.896] (-2065.732) -- 0:00:00 12000 -- [-2064.930] (-2065.466) (-2073.848) (-2065.077) * (-2071.886) (-2066.049) (-2061.870) [-2071.369] -- 0:01:22 12500 -- (-2065.825) (-2079.551) (-2069.124) [-2066.099] * (-2070.532) [-2073.398] (-2071.671) (-2074.013) -- 0:01:19 13000 -- (-2072.427) [-2067.763] (-2061.325) (-2063.876) * (-2073.005) [-2067.261] (-2075.318) (-2070.092) -- 0:01:15 13500 -- [-2070.449] (-2069.381) (-2062.037) (-2074.987) * [-2073.200] (-2063.154) (-2075.233) (-2073.169) -- 0:01:13 14000 -- (-2067.069) [-2067.913] (-2061.172) (-2067.483) * (-2077.130) (-2071.347) (-2071.877) [-2072.877] -- 0:01:10 14500 -- (-2077.247) [-2065.105] (-2060.740) (-2067.619) * [-2061.223] (-2066.103) (-2076.736) (-2066.796) -- 0:01:07 15000 -- (-2066.395) (-2071.741) (-2064.272) [-2067.395] * [-2069.794] (-2068.496) (-2065.183) (-2064.936) -- 0:01:05 Average standard deviation of split frequencies: 0.076931 15500 -- (-2065.931) (-2070.723) (-2063.360) [-2067.810] * (-2072.128) (-2076.679) (-2068.446) [-2064.206] -- 0:01:03 16000 -- (-2061.153) [-2068.713] (-2060.643) (-2070.189) * [-2063.944] (-2065.455) (-2067.949) (-2067.043) -- 0:01:01 16500 -- (-2061.415) (-2065.072) [-2063.994] (-2071.199) * (-2067.667) [-2065.694] (-2077.138) (-2069.375) -- 0:00:59 17000 -- (-2060.203) [-2068.617] (-2061.153) (-2075.134) * [-2064.691] (-2078.642) (-2069.522) (-2070.098) -- 0:00:57 17500 -- (-2060.347) [-2069.531] (-2061.541) (-2071.403) * [-2065.047] (-2070.780) (-2070.071) (-2067.394) -- 0:00:56 18000 -- (-2059.537) [-2066.712] (-2062.583) (-2067.531) * (-2068.241) (-2072.493) (-2071.279) [-2067.124] -- 0:00:54 18500 -- [-2061.804] (-2075.681) (-2062.485) (-2066.940) * (-2072.387) (-2074.687) [-2068.312] (-2068.816) -- 0:00:53 19000 -- (-2062.962) (-2057.261) (-2058.031) [-2064.991] * (-2063.578) (-2070.879) (-2064.757) [-2065.301] -- 0:00:51 19500 -- (-2059.102) (-2057.260) (-2058.031) [-2062.360] * (-2067.846) (-2068.686) (-2074.356) [-2058.728] -- 0:00:50 20000 -- (-2059.302) (-2057.579) [-2058.246] (-2064.721) * (-2075.133) (-2074.098) [-2062.069] (-2060.295) -- 0:00:49 Average standard deviation of split frequencies: 0.068430 20500 -- (-2059.926) (-2057.842) [-2058.562] (-2072.763) * [-2066.405] (-2069.470) (-2065.012) (-2060.299) -- 0:00:47 21000 -- (-2059.457) (-2060.102) [-2057.994] (-2066.511) * (-2074.780) (-2067.889) [-2057.896] (-2060.077) -- 0:00:46 21500 -- [-2060.490] (-2061.164) (-2059.652) (-2075.876) * [-2065.398] (-2077.599) (-2058.232) (-2061.178) -- 0:00:45 22000 -- (-2059.284) (-2063.632) [-2060.749] (-2068.930) * (-2070.585) (-2076.567) (-2058.615) [-2063.402] -- 0:00:44 22500 -- (-2061.454) (-2063.001) [-2059.805] (-2077.974) * [-2064.412] (-2063.406) (-2058.527) (-2058.300) -- 0:00:43 23000 -- [-2058.724] (-2062.357) (-2058.025) (-2062.688) * [-2063.458] (-2069.744) (-2058.755) (-2058.867) -- 0:00:42 23500 -- (-2058.607) [-2057.867] (-2058.756) (-2059.676) * (-2066.594) [-2076.880] (-2057.812) (-2058.816) -- 0:00:41 24000 -- (-2059.693) [-2059.200] (-2059.149) (-2059.765) * [-2067.491] (-2077.319) (-2058.489) (-2059.821) -- 0:00:40 24500 -- [-2058.885] (-2059.083) (-2058.106) (-2059.708) * [-2060.848] (-2070.944) (-2057.460) (-2057.692) -- 0:00:39 25000 -- (-2058.743) (-2061.661) [-2058.076] (-2059.090) * (-2069.865) [-2061.957] (-2057.513) (-2063.996) -- 0:00:39 Average standard deviation of split frequencies: 0.047800 25500 -- (-2058.587) [-2061.124] (-2060.822) (-2057.728) * (-2068.931) (-2072.599) [-2057.507] (-2058.596) -- 0:00:38 26000 -- (-2058.599) [-2059.845] (-2058.528) (-2058.778) * (-2072.128) (-2073.516) (-2057.510) [-2057.278] -- 0:00:37 26500 -- (-2058.635) [-2060.256] (-2058.976) (-2062.637) * (-2070.739) (-2073.956) [-2057.518] (-2058.412) -- 0:00:36 27000 -- (-2058.810) (-2060.425) [-2059.581] (-2063.806) * (-2071.224) [-2068.550] (-2058.704) (-2063.459) -- 0:01:12 27500 -- [-2064.669] (-2059.154) (-2059.580) (-2062.436) * (-2069.879) (-2067.178) (-2059.154) [-2058.886] -- 0:01:10 28000 -- [-2059.016] (-2058.074) (-2059.373) (-2059.554) * [-2067.946] (-2075.291) (-2058.121) (-2059.176) -- 0:01:09 28500 -- (-2059.012) (-2059.332) (-2058.384) [-2059.303] * (-2070.205) (-2070.746) (-2060.443) [-2058.060] -- 0:01:08 29000 -- [-2058.440] (-2059.354) (-2059.852) (-2062.185) * [-2062.988] (-2072.921) (-2059.714) (-2059.324) -- 0:01:06 29500 -- [-2059.353] (-2059.334) (-2057.379) (-2062.268) * (-2066.118) (-2071.226) [-2061.682] (-2058.257) -- 0:01:05 30000 -- [-2062.769] (-2058.266) (-2057.995) (-2061.189) * [-2068.064] (-2074.427) (-2058.067) (-2061.789) -- 0:01:04 Average standard deviation of split frequencies: 0.046884 30500 -- (-2062.279) (-2058.272) [-2058.406] (-2061.014) * (-2073.787) (-2069.762) (-2057.523) [-2061.186] -- 0:01:03 31000 -- (-2060.025) (-2058.912) (-2058.919) [-2060.063] * [-2065.324] (-2067.852) (-2059.387) (-2061.307) -- 0:01:02 31500 -- (-2060.536) (-2062.193) [-2058.167] (-2058.062) * (-2070.828) [-2066.246] (-2062.601) (-2065.072) -- 0:01:01 32000 -- (-2061.582) (-2059.039) (-2060.408) [-2058.015] * (-2066.313) (-2064.804) [-2061.353] (-2066.844) -- 0:01:00 32500 -- [-2061.148] (-2058.495) (-2057.302) (-2059.749) * (-2067.015) (-2073.482) (-2057.515) [-2061.263] -- 0:00:59 33000 -- (-2058.699) (-2058.636) [-2057.868] (-2058.808) * [-2065.677] (-2070.246) (-2057.505) (-2061.967) -- 0:00:58 33500 -- (-2058.337) (-2059.691) (-2058.399) [-2059.183] * (-2070.920) (-2071.766) [-2058.796] (-2067.211) -- 0:00:57 34000 -- (-2058.331) (-2059.689) [-2058.423] (-2060.883) * (-2071.560) [-2068.376] (-2058.436) (-2064.720) -- 0:00:56 34500 -- (-2057.706) [-2060.858] (-2058.427) (-2062.241) * (-2068.928) (-2063.615) (-2061.594) [-2061.357] -- 0:00:55 35000 -- (-2058.664) (-2059.209) (-2060.059) [-2061.458] * (-2076.034) [-2062.220] (-2058.204) (-2061.130) -- 0:00:55 Average standard deviation of split frequencies: 0.046766 35500 -- (-2067.130) (-2058.010) [-2059.823] (-2061.721) * (-2067.681) [-2066.588] (-2059.425) (-2060.873) -- 0:00:54 36000 -- (-2062.427) (-2059.494) [-2059.830] (-2058.883) * [-2064.519] (-2073.071) (-2058.510) (-2060.334) -- 0:00:53 36500 -- [-2061.225] (-2059.488) (-2059.215) (-2059.104) * (-2071.403) (-2066.538) [-2058.620] (-2059.833) -- 0:00:52 37000 -- [-2061.922] (-2061.280) (-2061.762) (-2061.298) * (-2066.516) [-2066.308] (-2064.838) (-2058.716) -- 0:00:52 37500 -- [-2060.108] (-2061.170) (-2062.701) (-2060.216) * [-2071.283] (-2072.290) (-2061.013) (-2058.500) -- 0:00:51 38000 -- (-2059.347) (-2062.182) (-2061.991) [-2059.719] * (-2068.498) (-2070.726) [-2064.853] (-2059.177) -- 0:00:50 38500 -- [-2058.729] (-2062.907) (-2061.840) (-2063.374) * (-2066.253) (-2065.287) [-2060.861] (-2059.327) -- 0:00:49 39000 -- (-2058.816) (-2060.025) (-2060.799) [-2060.896] * [-2066.796] (-2071.321) (-2062.381) (-2063.222) -- 0:00:49 39500 -- (-2058.629) [-2060.672] (-2061.291) (-2060.695) * (-2068.380) (-2066.623) [-2061.019] (-2064.312) -- 0:00:48 40000 -- [-2062.131] (-2059.995) (-2060.457) (-2062.488) * (-2068.747) (-2078.084) [-2061.164] (-2061.039) -- 0:00:48 Average standard deviation of split frequencies: 0.042890 40500 -- (-2059.482) (-2059.593) (-2061.494) [-2069.347] * [-2066.920] (-2083.125) (-2058.765) (-2061.810) -- 0:00:47 41000 -- (-2058.688) (-2060.186) (-2064.105) [-2060.783] * (-2072.032) [-2063.839] (-2058.128) (-2065.037) -- 0:00:46 41500 -- (-2060.029) [-2059.172] (-2061.544) (-2061.417) * [-2070.704] (-2064.433) (-2061.873) (-2059.500) -- 0:01:09 42000 -- (-2059.132) [-2058.079] (-2063.017) (-2060.642) * [-2066.336] (-2068.609) (-2057.991) (-2059.997) -- 0:01:08 42500 -- (-2061.487) [-2057.552] (-2060.648) (-2063.222) * (-2066.039) (-2068.941) [-2058.142] (-2060.970) -- 0:01:07 43000 -- [-2060.414] (-2058.579) (-2061.832) (-2058.144) * (-2066.849) (-2070.593) (-2058.404) [-2060.972] -- 0:01:06 43500 -- (-2059.569) (-2057.621) [-2059.759] (-2060.250) * [-2065.383] (-2073.799) (-2058.381) (-2060.490) -- 0:01:05 44000 -- (-2060.818) [-2059.301] (-2060.167) (-2059.896) * [-2070.876] (-2063.623) (-2060.717) (-2059.136) -- 0:01:05 44500 -- (-2058.094) [-2059.134] (-2058.019) (-2058.314) * (-2067.841) (-2072.201) (-2059.026) [-2057.629] -- 0:01:04 45000 -- (-2058.318) (-2063.855) [-2058.914] (-2059.686) * (-2069.288) [-2065.494] (-2059.527) (-2061.762) -- 0:01:03 Average standard deviation of split frequencies: 0.037405 45500 -- (-2058.629) [-2060.845] (-2059.630) (-2069.044) * (-2072.247) (-2080.155) (-2060.824) [-2059.178] -- 0:01:02 46000 -- (-2058.507) (-2058.764) [-2059.319] (-2062.268) * [-2071.477] (-2064.234) (-2060.639) (-2059.505) -- 0:01:02 46500 -- [-2059.065] (-2058.975) (-2058.030) (-2061.010) * (-2068.895) (-2068.004) [-2059.467] (-2062.483) -- 0:01:01 47000 -- (-2060.163) [-2059.614] (-2058.757) (-2060.109) * (-2065.238) (-2071.776) (-2059.233) [-2062.398] -- 0:01:00 47500 -- (-2061.272) (-2060.105) (-2058.787) [-2057.344] * (-2066.347) (-2069.491) [-2060.974] (-2059.997) -- 0:01:00 48000 -- [-2061.648] (-2058.645) (-2058.973) (-2058.450) * [-2063.954] (-2067.225) (-2063.337) (-2059.109) -- 0:00:59 48500 -- (-2063.247) (-2058.693) (-2057.397) [-2058.343] * (-2066.328) [-2066.578] (-2069.235) (-2058.374) -- 0:00:58 49000 -- (-2058.301) [-2061.813] (-2057.539) (-2058.173) * (-2063.171) (-2074.614) (-2059.371) [-2058.274] -- 0:00:58 49500 -- (-2060.155) (-2061.852) [-2058.371] (-2057.982) * (-2073.157) [-2081.753] (-2065.785) (-2059.276) -- 0:00:57 50000 -- (-2062.128) [-2059.670] (-2061.429) (-2058.175) * (-2065.930) (-2061.143) (-2059.987) [-2058.756] -- 0:00:57 Average standard deviation of split frequencies: 0.036330 50500 -- (-2061.562) (-2058.994) [-2057.820] (-2058.136) * [-2068.736] (-2059.721) (-2061.523) (-2059.599) -- 0:00:56 51000 -- (-2062.090) (-2059.085) (-2062.371) [-2059.062] * (-2072.165) (-2059.518) (-2061.279) [-2059.414] -- 0:00:55 51500 -- [-2060.960] (-2061.871) (-2063.113) (-2060.286) * (-2066.713) (-2061.432) [-2061.528] (-2060.644) -- 0:00:55 52000 -- (-2062.390) (-2061.325) (-2060.646) [-2059.481] * (-2065.994) [-2057.570] (-2059.479) (-2061.354) -- 0:00:54 52500 -- [-2060.374] (-2063.377) (-2064.290) (-2059.442) * (-2068.784) [-2057.764] (-2059.334) (-2064.026) -- 0:00:54 53000 -- (-2060.623) (-2062.896) (-2068.528) [-2063.106] * [-2069.348] (-2060.504) (-2059.380) (-2059.162) -- 0:00:53 53500 -- [-2059.486] (-2062.245) (-2060.380) (-2061.596) * (-2074.877) (-2059.817) (-2059.468) [-2060.754] -- 0:00:53 54000 -- [-2058.641] (-2061.947) (-2061.839) (-2066.730) * (-2067.670) (-2058.912) (-2062.968) [-2057.911] -- 0:00:52 54500 -- [-2058.780] (-2060.884) (-2059.701) (-2060.349) * [-2063.815] (-2059.016) (-2059.206) (-2058.481) -- 0:00:52 55000 -- (-2059.499) (-2060.235) (-2059.104) [-2059.391] * [-2066.742] (-2059.632) (-2066.830) (-2058.932) -- 0:00:51 Average standard deviation of split frequencies: 0.038723 55500 -- (-2061.107) [-2059.523] (-2059.104) (-2060.509) * (-2072.551) (-2061.332) (-2066.382) [-2059.071] -- 0:00:51 56000 -- (-2059.801) (-2059.632) (-2060.232) [-2059.279] * (-2072.732) (-2061.460) (-2059.948) [-2059.101] -- 0:00:50 56500 -- [-2060.487] (-2060.622) (-2058.868) (-2061.153) * (-2059.586) (-2060.117) (-2060.676) [-2057.431] -- 0:01:06 57000 -- (-2059.635) (-2058.672) (-2058.752) [-2059.008] * (-2060.351) (-2058.531) (-2058.647) [-2057.367] -- 0:01:06 57500 -- (-2059.529) (-2058.672) [-2059.074] (-2061.336) * [-2068.023] (-2058.626) (-2059.077) (-2060.163) -- 0:01:05 58000 -- [-2058.934] (-2058.444) (-2059.234) (-2058.745) * (-2061.457) (-2062.961) [-2058.153] (-2057.473) -- 0:01:04 58500 -- [-2059.356] (-2059.944) (-2059.244) (-2058.758) * (-2058.994) (-2064.486) (-2058.207) [-2057.864] -- 0:01:04 59000 -- (-2060.779) [-2058.584] (-2058.743) (-2059.637) * [-2060.311] (-2060.334) (-2058.897) (-2057.870) -- 0:01:03 59500 -- (-2062.973) (-2058.169) [-2058.235] (-2061.945) * (-2058.629) [-2060.787] (-2058.351) (-2059.227) -- 0:01:03 60000 -- (-2061.672) (-2057.677) (-2058.235) [-2059.553] * [-2058.862] (-2063.813) (-2060.469) (-2059.239) -- 0:01:02 Average standard deviation of split frequencies: 0.035580 60500 -- (-2059.491) [-2057.800] (-2057.932) (-2062.281) * (-2063.505) [-2062.598] (-2059.464) (-2057.987) -- 0:01:02 61000 -- (-2059.983) (-2058.720) (-2063.490) [-2062.895] * (-2060.867) (-2062.588) [-2058.998] (-2057.774) -- 0:01:01 61500 -- (-2060.107) [-2057.651] (-2061.678) (-2061.175) * (-2059.458) (-2058.106) (-2061.467) [-2058.371] -- 0:01:01 62000 -- (-2059.292) [-2057.377] (-2062.408) (-2059.187) * [-2059.031] (-2058.085) (-2061.107) (-2058.397) -- 0:01:00 62500 -- [-2059.169] (-2058.760) (-2062.945) (-2060.394) * [-2058.201] (-2058.213) (-2061.420) (-2057.534) -- 0:01:00 63000 -- (-2059.282) [-2059.457] (-2061.135) (-2059.617) * [-2058.463] (-2057.786) (-2064.510) (-2059.769) -- 0:00:59 63500 -- (-2059.535) (-2059.342) (-2059.550) [-2058.998] * (-2059.651) [-2057.786] (-2060.856) (-2060.137) -- 0:00:58 64000 -- (-2059.158) (-2059.492) (-2059.885) [-2057.912] * (-2057.607) (-2058.693) (-2061.655) [-2059.296] -- 0:00:58 64500 -- (-2063.377) (-2060.484) [-2060.014] (-2060.517) * (-2060.862) (-2057.380) (-2061.562) [-2059.393] -- 0:00:58 65000 -- (-2063.580) (-2060.282) [-2061.442] (-2059.934) * [-2060.489] (-2058.421) (-2064.688) (-2058.113) -- 0:00:57 Average standard deviation of split frequencies: 0.030356 65500 -- (-2061.636) (-2063.602) [-2060.353] (-2059.766) * (-2063.751) (-2058.427) (-2060.396) [-2058.250] -- 0:00:57 66000 -- (-2059.946) [-2060.264] (-2061.647) (-2059.779) * (-2063.367) (-2059.652) (-2058.410) [-2058.032] -- 0:00:56 66500 -- (-2059.747) [-2059.946] (-2061.375) (-2058.812) * (-2057.954) (-2061.425) [-2058.531] (-2058.155) -- 0:00:56 67000 -- [-2059.538] (-2059.055) (-2059.245) (-2061.870) * (-2058.085) (-2061.890) (-2063.333) [-2059.523] -- 0:00:55 67500 -- (-2059.725) (-2059.762) (-2058.976) [-2066.201] * (-2057.257) (-2060.599) [-2059.865] (-2058.537) -- 0:00:55 68000 -- [-2057.532] (-2060.158) (-2058.365) (-2063.716) * (-2057.283) (-2061.694) [-2059.961] (-2059.386) -- 0:00:54 68500 -- [-2059.813] (-2059.859) (-2060.816) (-2061.983) * (-2057.700) (-2058.497) (-2061.443) [-2058.679] -- 0:00:54 69000 -- (-2063.620) (-2062.123) [-2060.393] (-2060.448) * (-2057.711) (-2058.497) (-2062.793) [-2058.200] -- 0:00:53 69500 -- (-2060.494) [-2063.882] (-2058.713) (-2060.555) * (-2062.154) (-2058.644) [-2059.588] (-2057.785) -- 0:00:53 70000 -- (-2059.272) (-2061.801) [-2058.176] (-2061.016) * (-2062.381) (-2060.297) [-2058.347] (-2061.410) -- 0:00:53 Average standard deviation of split frequencies: 0.025349 70500 -- (-2060.115) (-2059.679) [-2059.297] (-2060.529) * [-2058.642] (-2061.852) (-2058.392) (-2061.511) -- 0:00:52 71000 -- (-2058.720) (-2058.749) [-2062.755] (-2059.397) * (-2058.417) (-2064.749) [-2058.407] (-2058.086) -- 0:00:52 71500 -- (-2058.463) [-2061.570] (-2062.252) (-2059.188) * (-2059.051) [-2059.854] (-2060.696) (-2063.899) -- 0:01:04 72000 -- (-2057.663) [-2062.226] (-2060.815) (-2060.633) * (-2058.936) (-2061.329) (-2058.435) [-2062.153] -- 0:01:04 72500 -- [-2058.855] (-2060.304) (-2059.446) (-2061.494) * (-2060.262) (-2061.677) [-2061.347] (-2062.000) -- 0:01:03 73000 -- (-2058.152) (-2058.504) (-2061.425) [-2062.413] * [-2058.870] (-2058.414) (-2063.044) (-2059.048) -- 0:01:03 73500 -- [-2059.960] (-2059.250) (-2060.284) (-2059.865) * (-2058.688) [-2058.377] (-2063.264) (-2059.155) -- 0:01:03 74000 -- [-2060.874] (-2058.789) (-2062.933) (-2059.420) * (-2057.860) (-2059.764) (-2059.940) [-2058.645] -- 0:01:02 74500 -- (-2060.702) [-2058.833] (-2060.917) (-2060.196) * (-2061.378) (-2058.954) (-2060.665) [-2060.837] -- 0:01:02 75000 -- [-2062.495] (-2058.866) (-2059.379) (-2059.031) * (-2058.587) [-2058.975] (-2059.221) (-2060.435) -- 0:01:01 Average standard deviation of split frequencies: 0.022526 75500 -- (-2062.492) (-2061.941) [-2059.123] (-2058.754) * (-2060.643) [-2059.984] (-2059.034) (-2061.448) -- 0:01:01 76000 -- (-2059.059) (-2059.006) (-2057.933) [-2063.838] * (-2058.560) (-2061.140) (-2058.412) [-2061.040] -- 0:01:00 76500 -- [-2059.888] (-2061.803) (-2058.234) (-2058.576) * [-2057.698] (-2058.924) (-2060.267) (-2061.504) -- 0:01:00 77000 -- (-2060.065) (-2058.946) (-2059.621) [-2060.630] * (-2059.604) (-2058.661) (-2060.702) [-2059.661] -- 0:00:59 77500 -- (-2057.697) [-2058.184] (-2059.024) (-2060.218) * [-2060.689] (-2059.077) (-2059.294) (-2060.035) -- 0:00:59 78000 -- [-2057.414] (-2059.939) (-2058.544) (-2060.541) * (-2060.295) (-2059.077) (-2060.706) [-2059.790] -- 0:00:59 78500 -- (-2060.908) (-2058.589) (-2058.911) [-2060.529] * (-2058.852) (-2060.960) [-2061.057] (-2058.566) -- 0:00:58 79000 -- (-2062.692) [-2061.540] (-2058.840) (-2061.011) * (-2058.382) (-2060.751) [-2059.149] (-2058.356) -- 0:00:58 79500 -- (-2060.821) [-2058.320] (-2058.385) (-2062.935) * (-2058.351) (-2059.926) [-2059.934] (-2061.222) -- 0:00:57 80000 -- (-2057.932) (-2062.901) [-2059.451] (-2060.274) * (-2058.351) (-2059.956) [-2061.368] (-2065.032) -- 0:00:57 Average standard deviation of split frequencies: 0.022688 80500 -- (-2058.512) (-2059.520) (-2059.517) [-2061.007] * [-2058.654] (-2058.747) (-2057.267) (-2059.750) -- 0:00:57 81000 -- (-2059.126) (-2058.421) (-2063.077) [-2060.865] * (-2058.730) (-2060.470) (-2058.055) [-2058.156] -- 0:00:56 81500 -- [-2061.131] (-2060.838) (-2057.975) (-2059.306) * (-2059.482) [-2059.365] (-2057.751) (-2059.713) -- 0:00:56 82000 -- (-2059.181) (-2059.295) (-2062.373) [-2058.900] * (-2059.221) (-2059.650) (-2057.751) [-2059.197] -- 0:00:55 82500 -- (-2059.042) (-2061.570) [-2059.786] (-2059.078) * [-2057.616] (-2057.712) (-2057.683) (-2058.866) -- 0:00:55 83000 -- (-2058.122) (-2059.140) (-2060.648) [-2061.469] * (-2057.629) [-2058.461] (-2057.620) (-2057.496) -- 0:00:55 83500 -- [-2058.044] (-2057.598) (-2060.649) (-2062.380) * (-2061.995) (-2058.469) [-2058.191] (-2059.007) -- 0:00:54 84000 -- (-2058.020) (-2057.598) (-2060.832) [-2062.328] * [-2060.846] (-2058.251) (-2058.484) (-2063.188) -- 0:00:54 84500 -- (-2059.364) (-2058.353) (-2058.806) [-2061.077] * (-2060.820) [-2061.926] (-2059.424) (-2064.331) -- 0:00:54 85000 -- (-2059.662) (-2058.440) [-2059.344] (-2060.449) * (-2058.307) [-2059.074] (-2060.593) (-2058.661) -- 0:00:53 Average standard deviation of split frequencies: 0.024234 85500 -- (-2059.276) (-2058.646) [-2059.353] (-2061.311) * (-2058.247) (-2059.295) [-2058.891] (-2058.861) -- 0:00:53 86000 -- (-2060.460) [-2058.166] (-2061.418) (-2058.846) * [-2058.296] (-2058.129) (-2058.893) (-2058.503) -- 0:00:53 86500 -- (-2059.812) (-2058.545) (-2062.583) [-2058.807] * (-2059.257) [-2059.143] (-2062.373) (-2060.016) -- 0:00:52 87000 -- (-2058.257) [-2061.890] (-2062.878) (-2058.944) * (-2060.268) (-2058.288) [-2058.511] (-2060.279) -- 0:01:02 87500 -- (-2060.031) (-2058.726) (-2063.098) [-2059.983] * [-2057.939] (-2058.294) (-2058.728) (-2058.696) -- 0:01:02 88000 -- [-2062.961] (-2060.946) (-2060.375) (-2060.057) * (-2057.939) (-2058.183) (-2058.132) [-2060.840] -- 0:01:02 88500 -- (-2059.475) (-2057.760) [-2062.689] (-2062.519) * [-2060.129] (-2058.601) (-2057.915) (-2058.649) -- 0:01:01 89000 -- [-2059.480] (-2058.031) (-2063.289) (-2059.468) * [-2057.808] (-2058.761) (-2063.518) (-2059.930) -- 0:01:01 89500 -- (-2062.592) [-2057.980] (-2059.762) (-2063.599) * (-2057.296) [-2058.394] (-2058.115) (-2058.937) -- 0:01:01 90000 -- (-2063.322) [-2061.351] (-2058.479) (-2061.096) * (-2060.530) [-2058.129] (-2059.696) (-2059.849) -- 0:01:00 Average standard deviation of split frequencies: 0.024697 90500 -- (-2063.262) (-2058.010) (-2060.100) [-2061.376] * (-2065.322) (-2058.863) [-2059.934] (-2059.728) -- 0:01:00 91000 -- (-2063.055) [-2062.053] (-2060.099) (-2059.066) * (-2059.525) (-2060.035) [-2062.573] (-2058.736) -- 0:00:59 91500 -- (-2061.963) (-2061.635) [-2060.374] (-2059.963) * (-2058.899) [-2060.215] (-2062.692) (-2058.432) -- 0:00:59 92000 -- (-2060.833) (-2060.066) (-2060.324) [-2066.094] * (-2058.964) (-2060.178) (-2062.711) [-2061.143] -- 0:00:59 92500 -- [-2059.266] (-2060.517) (-2059.961) (-2062.058) * (-2059.945) [-2060.320] (-2061.622) (-2060.610) -- 0:00:58 93000 -- (-2060.870) [-2059.696] (-2058.788) (-2058.983) * (-2060.596) [-2058.948] (-2059.532) (-2058.770) -- 0:00:58 93500 -- [-2058.369] (-2058.381) (-2060.233) (-2061.334) * (-2068.797) [-2058.390] (-2059.277) (-2057.823) -- 0:00:58 94000 -- [-2058.470] (-2057.647) (-2061.954) (-2059.172) * [-2064.076] (-2059.521) (-2062.118) (-2058.601) -- 0:00:57 94500 -- (-2061.074) (-2057.701) [-2059.814] (-2058.675) * (-2061.933) [-2058.890] (-2061.557) (-2063.012) -- 0:00:57 95000 -- (-2060.732) (-2058.059) (-2059.709) [-2057.360] * (-2060.438) (-2061.097) [-2061.316] (-2059.334) -- 0:00:57 Average standard deviation of split frequencies: 0.025043 95500 -- (-2059.221) (-2060.251) [-2059.489] (-2060.237) * [-2058.752] (-2062.296) (-2060.366) (-2063.619) -- 0:00:56 96000 -- (-2058.074) (-2058.897) (-2058.894) [-2057.937] * (-2058.169) (-2061.225) [-2057.891] (-2059.188) -- 0:00:56 96500 -- (-2058.293) [-2057.665] (-2058.514) (-2062.288) * [-2059.398] (-2060.272) (-2057.780) (-2060.145) -- 0:00:56 97000 -- (-2058.315) [-2060.255] (-2058.504) (-2059.951) * [-2059.271] (-2059.105) (-2059.629) (-2064.714) -- 0:00:55 97500 -- (-2058.899) (-2060.215) (-2061.562) [-2062.817] * (-2060.624) (-2060.037) (-2062.373) [-2064.429] -- 0:00:55 98000 -- (-2058.114) (-2058.551) [-2061.400] (-2059.042) * [-2058.965] (-2058.854) (-2059.335) (-2063.506) -- 0:00:55 98500 -- (-2058.391) [-2058.927] (-2061.169) (-2064.241) * (-2058.166) [-2058.379] (-2059.125) (-2063.907) -- 0:00:54 99000 -- (-2058.793) [-2058.690] (-2058.338) (-2059.255) * [-2057.931] (-2059.631) (-2060.426) (-2063.810) -- 0:00:54 99500 -- [-2058.793] (-2065.034) (-2059.308) (-2058.061) * [-2058.968] (-2058.641) (-2062.546) (-2068.721) -- 0:00:54 100000 -- [-2062.825] (-2060.301) (-2059.418) (-2058.290) * (-2058.985) (-2058.644) (-2061.883) [-2063.415] -- 0:00:54 Average standard deviation of split frequencies: 0.023882 100500 -- (-2059.987) (-2060.343) (-2059.381) [-2058.716] * (-2059.955) (-2059.156) [-2061.992] (-2062.557) -- 0:00:53 101000 -- (-2058.159) [-2060.385] (-2058.450) (-2061.256) * [-2057.511] (-2058.237) (-2066.241) (-2061.306) -- 0:00:53 101500 -- (-2057.896) [-2060.443] (-2058.694) (-2061.017) * [-2058.058] (-2061.829) (-2061.341) (-2060.608) -- 0:00:53 102000 -- (-2057.616) (-2060.260) (-2063.915) [-2062.158] * (-2061.500) [-2058.186] (-2059.280) (-2060.545) -- 0:01:01 102500 -- (-2057.704) [-2060.167] (-2061.769) (-2060.203) * [-2059.296] (-2059.605) (-2058.879) (-2065.815) -- 0:01:01 103000 -- (-2058.045) (-2058.070) [-2057.418] (-2061.136) * (-2060.122) (-2058.424) [-2059.132] (-2064.222) -- 0:01:00 103500 -- (-2058.182) [-2058.919] (-2057.374) (-2062.839) * (-2060.122) (-2061.376) [-2059.240] (-2062.617) -- 0:01:00 104000 -- [-2058.160] (-2061.286) (-2057.738) (-2059.308) * (-2059.728) [-2058.225] (-2059.885) (-2059.414) -- 0:01:00 104500 -- [-2057.636] (-2058.978) (-2058.564) (-2059.301) * (-2058.847) (-2059.720) [-2061.109] (-2059.311) -- 0:00:59 105000 -- (-2057.945) (-2058.935) (-2058.064) [-2059.188] * (-2062.539) (-2061.532) [-2061.360] (-2060.638) -- 0:00:59 Average standard deviation of split frequencies: 0.022871 105500 -- (-2058.715) (-2062.485) [-2060.176] (-2058.979) * [-2060.564] (-2058.208) (-2058.688) (-2060.018) -- 0:00:59 106000 -- (-2061.605) (-2062.309) [-2059.221] (-2058.312) * (-2061.198) (-2058.378) [-2060.972] (-2060.563) -- 0:00:59 106500 -- (-2059.403) [-2062.649] (-2058.755) (-2057.445) * [-2060.880] (-2060.687) (-2059.353) (-2059.550) -- 0:00:58 107000 -- [-2058.481] (-2061.837) (-2059.957) (-2057.878) * (-2060.962) [-2059.248] (-2063.567) (-2064.826) -- 0:00:58 107500 -- (-2059.490) [-2059.933] (-2059.350) (-2057.878) * [-2059.043] (-2059.119) (-2061.712) (-2062.282) -- 0:00:58 108000 -- [-2064.258] (-2060.187) (-2057.790) (-2058.667) * (-2058.832) (-2059.389) [-2057.943] (-2064.574) -- 0:00:57 108500 -- (-2063.199) [-2059.693] (-2057.470) (-2059.764) * (-2059.287) [-2060.024] (-2058.001) (-2061.805) -- 0:00:57 109000 -- (-2063.164) (-2059.994) [-2058.305] (-2058.645) * (-2060.691) [-2058.327] (-2058.874) (-2064.006) -- 0:00:57 109500 -- (-2062.439) (-2060.587) [-2061.774] (-2058.647) * (-2059.296) (-2058.400) [-2060.180] (-2061.465) -- 0:00:56 110000 -- [-2060.739] (-2065.201) (-2062.318) (-2060.343) * (-2059.859) (-2060.073) [-2057.923] (-2060.230) -- 0:00:56 Average standard deviation of split frequencies: 0.023641 110500 -- (-2061.873) (-2060.286) [-2063.948] (-2061.675) * (-2059.871) (-2059.236) (-2058.685) [-2060.031] -- 0:00:56 111000 -- (-2064.500) [-2059.628] (-2061.827) (-2060.169) * [-2061.092] (-2059.303) (-2060.334) (-2060.864) -- 0:00:56 111500 -- [-2059.610] (-2061.557) (-2061.774) (-2058.381) * [-2061.256] (-2064.617) (-2057.641) (-2059.072) -- 0:00:55 112000 -- (-2060.492) (-2062.946) [-2060.056] (-2060.958) * [-2061.706] (-2063.788) (-2057.613) (-2060.539) -- 0:00:55 112500 -- (-2059.738) [-2058.755] (-2061.732) (-2059.333) * (-2058.053) (-2063.946) [-2057.914] (-2060.915) -- 0:00:55 113000 -- (-2063.746) (-2058.782) (-2059.018) [-2061.623] * (-2059.776) (-2063.730) [-2057.405] (-2063.736) -- 0:00:54 113500 -- (-2060.204) [-2058.419] (-2058.264) (-2061.195) * (-2061.344) (-2064.152) [-2057.381] (-2063.470) -- 0:00:54 114000 -- (-2059.215) (-2059.145) (-2059.858) [-2059.467] * (-2061.509) [-2063.073] (-2057.406) (-2063.660) -- 0:00:54 114500 -- [-2058.908] (-2059.017) (-2062.635) (-2059.436) * (-2058.128) (-2061.648) (-2066.041) [-2060.688] -- 0:00:54 115000 -- (-2061.910) (-2058.921) (-2061.779) [-2059.279] * [-2059.172] (-2059.572) (-2061.985) (-2060.336) -- 0:00:53 Average standard deviation of split frequencies: 0.021945 115500 -- (-2062.942) [-2061.547] (-2063.819) (-2064.069) * (-2058.959) (-2058.318) (-2059.195) [-2059.192] -- 0:00:53 116000 -- (-2057.976) [-2059.832] (-2061.267) (-2061.816) * (-2058.842) [-2061.435] (-2058.204) (-2061.269) -- 0:00:53 116500 -- [-2057.369] (-2060.370) (-2061.541) (-2059.136) * (-2060.174) (-2059.553) [-2058.560] (-2059.891) -- 0:01:00 117000 -- [-2057.727] (-2059.945) (-2061.078) (-2063.113) * (-2060.684) (-2058.882) (-2058.382) [-2059.271] -- 0:01:00 117500 -- [-2058.306] (-2059.371) (-2058.127) (-2057.961) * (-2060.149) [-2059.792] (-2061.419) (-2061.673) -- 0:01:00 118000 -- (-2062.273) (-2059.636) [-2058.122] (-2061.952) * (-2059.701) (-2059.656) (-2062.783) [-2060.765] -- 0:00:59 118500 -- (-2061.258) (-2059.637) (-2061.301) [-2058.887] * (-2058.878) (-2059.324) (-2060.662) [-2060.129] -- 0:00:59 119000 -- (-2059.408) [-2058.316] (-2062.724) (-2060.300) * (-2059.589) (-2060.183) [-2059.520] (-2060.640) -- 0:00:59 119500 -- (-2060.802) (-2063.142) (-2064.172) [-2059.208] * [-2059.574] (-2060.669) (-2061.855) (-2060.962) -- 0:00:58 120000 -- [-2061.113] (-2060.532) (-2061.721) (-2065.301) * (-2059.780) (-2061.161) [-2059.779] (-2060.223) -- 0:00:58 Average standard deviation of split frequencies: 0.022001 120500 -- (-2059.398) [-2058.591] (-2062.761) (-2059.412) * (-2059.579) (-2060.238) [-2058.746] (-2062.596) -- 0:00:58 121000 -- (-2059.361) (-2059.022) [-2058.225] (-2060.503) * (-2061.059) [-2059.478] (-2058.566) (-2061.626) -- 0:00:58 121500 -- [-2059.497] (-2059.579) (-2061.624) (-2059.389) * (-2061.802) [-2059.526] (-2058.129) (-2059.871) -- 0:00:57 122000 -- (-2059.194) (-2058.627) [-2061.177] (-2060.978) * (-2058.900) (-2065.112) [-2058.875] (-2061.127) -- 0:00:57 122500 -- [-2060.196] (-2058.062) (-2058.366) (-2059.368) * [-2059.563] (-2062.493) (-2058.804) (-2062.186) -- 0:00:57 123000 -- (-2060.262) (-2058.062) (-2059.499) [-2059.007] * (-2058.817) (-2061.356) (-2059.416) [-2058.644] -- 0:00:57 123500 -- (-2058.071) [-2059.258] (-2060.552) (-2058.744) * [-2062.556] (-2062.137) (-2061.419) (-2060.007) -- 0:00:56 124000 -- (-2058.362) [-2059.258] (-2058.591) (-2058.472) * (-2062.956) (-2062.895) (-2062.099) [-2059.336] -- 0:00:56 124500 -- (-2059.300) (-2060.065) (-2059.009) [-2058.020] * (-2060.646) (-2060.842) (-2059.175) [-2058.769] -- 0:00:56 125000 -- (-2060.194) (-2063.779) [-2059.032] (-2066.400) * (-2059.807) (-2059.599) [-2059.179] (-2063.194) -- 0:00:56 Average standard deviation of split frequencies: 0.023383 125500 -- (-2059.556) [-2058.026] (-2059.148) (-2066.510) * [-2061.338] (-2060.396) (-2060.091) (-2060.949) -- 0:00:55 126000 -- (-2058.367) [-2058.234] (-2059.468) (-2062.194) * (-2059.242) (-2064.712) (-2059.683) [-2058.941] -- 0:00:55 126500 -- (-2064.290) (-2061.308) [-2059.599] (-2058.772) * (-2059.555) (-2058.781) [-2059.735] (-2060.497) -- 0:00:55 127000 -- (-2064.919) (-2060.925) [-2059.153] (-2059.945) * (-2058.202) (-2058.396) (-2058.735) [-2058.646] -- 0:00:54 127500 -- (-2059.274) (-2061.148) [-2063.374] (-2062.323) * (-2059.740) [-2060.636] (-2058.735) (-2067.635) -- 0:00:54 128000 -- (-2060.290) (-2059.881) (-2061.549) [-2059.495] * (-2059.686) (-2061.987) [-2058.235] (-2059.724) -- 0:00:54 128500 -- (-2060.225) [-2059.559] (-2060.532) (-2059.496) * (-2057.654) [-2058.165] (-2059.864) (-2060.125) -- 0:00:54 129000 -- (-2062.617) (-2062.082) [-2060.350] (-2062.284) * (-2057.729) (-2057.619) [-2059.419] (-2061.919) -- 0:00:54 129500 -- (-2061.549) (-2058.702) [-2059.016] (-2065.009) * (-2058.837) (-2059.256) (-2066.250) [-2061.329] -- 0:00:53 130000 -- [-2061.974] (-2058.204) (-2059.596) (-2067.459) * (-2057.853) (-2058.104) (-2059.395) [-2060.815] -- 0:00:53 Average standard deviation of split frequencies: 0.019585 130500 -- (-2062.446) (-2059.100) (-2061.976) [-2059.316] * (-2058.496) (-2057.616) [-2058.598] (-2060.339) -- 0:00:53 131000 -- (-2067.908) (-2065.496) (-2061.815) [-2057.986] * (-2058.268) (-2060.221) (-2057.825) [-2059.127] -- 0:00:53 131500 -- (-2066.116) (-2058.544) (-2063.849) [-2058.821] * [-2057.664] (-2059.964) (-2058.908) (-2058.624) -- 0:00:59 132000 -- (-2067.721) (-2062.652) (-2062.324) [-2059.283] * (-2058.376) [-2060.002] (-2059.198) (-2061.856) -- 0:00:59 132500 -- [-2061.239] (-2062.568) (-2059.254) (-2058.458) * (-2057.485) (-2059.913) (-2058.995) [-2058.581] -- 0:00:58 133000 -- (-2059.036) (-2060.179) [-2058.522] (-2059.243) * (-2058.885) (-2059.022) (-2059.461) [-2058.728] -- 0:00:58 133500 -- [-2057.831] (-2059.600) (-2058.515) (-2060.928) * [-2058.886] (-2061.599) (-2060.474) (-2058.573) -- 0:00:58 134000 -- (-2057.796) (-2063.973) (-2058.514) [-2060.793] * (-2058.792) (-2059.647) [-2059.861] (-2059.185) -- 0:00:58 134500 -- (-2058.903) (-2067.775) (-2059.426) [-2063.336] * [-2060.794] (-2061.267) (-2058.985) (-2060.179) -- 0:00:57 135000 -- (-2059.831) (-2068.613) (-2057.912) [-2059.990] * (-2059.867) (-2061.578) [-2058.311] (-2061.009) -- 0:00:57 Average standard deviation of split frequencies: 0.018544 135500 -- [-2060.306] (-2063.140) (-2058.756) (-2058.174) * (-2061.951) [-2063.842] (-2058.390) (-2062.197) -- 0:00:57 136000 -- (-2059.749) (-2062.225) (-2059.834) [-2059.292] * [-2062.133] (-2059.133) (-2059.197) (-2058.495) -- 0:00:57 136500 -- (-2061.104) (-2058.244) [-2060.115] (-2060.673) * (-2064.139) (-2059.535) (-2059.527) [-2058.387] -- 0:00:56 137000 -- (-2060.656) (-2058.137) (-2061.084) [-2064.268] * [-2060.068] (-2061.733) (-2062.146) (-2064.376) -- 0:00:56 137500 -- (-2058.677) [-2059.359] (-2059.781) (-2064.221) * [-2060.140] (-2061.125) (-2062.507) (-2063.180) -- 0:00:56 138000 -- (-2058.735) (-2059.157) (-2059.305) [-2064.288] * [-2060.501] (-2060.188) (-2060.416) (-2058.439) -- 0:00:56 138500 -- (-2059.531) (-2060.273) (-2061.907) [-2061.254] * (-2060.821) [-2058.770] (-2058.636) (-2058.853) -- 0:00:55 139000 -- (-2060.090) (-2062.017) [-2063.530] (-2063.701) * [-2061.432] (-2058.958) (-2058.906) (-2062.064) -- 0:00:55 139500 -- [-2058.905] (-2059.103) (-2063.730) (-2061.852) * [-2061.710] (-2058.887) (-2061.219) (-2064.102) -- 0:00:55 140000 -- (-2061.051) (-2059.494) (-2064.015) [-2059.547] * (-2066.027) (-2059.257) [-2059.632] (-2061.850) -- 0:00:55 Average standard deviation of split frequencies: 0.019437 140500 -- [-2060.116] (-2060.320) (-2061.173) (-2059.502) * (-2062.426) (-2059.076) (-2060.010) [-2059.107] -- 0:00:55 141000 -- (-2059.089) [-2060.177] (-2057.465) (-2059.792) * [-2061.755] (-2057.950) (-2061.512) (-2058.044) -- 0:00:54 141500 -- (-2062.009) (-2060.289) [-2057.432] (-2060.857) * (-2060.668) (-2057.950) [-2059.066] (-2058.803) -- 0:00:54 142000 -- (-2063.607) [-2060.306] (-2058.873) (-2058.788) * (-2059.440) (-2060.384) [-2058.097] (-2058.787) -- 0:00:54 142500 -- (-2059.724) (-2061.855) [-2058.439] (-2058.744) * (-2059.449) (-2064.700) [-2064.198] (-2059.509) -- 0:00:54 143000 -- [-2058.611] (-2059.662) (-2058.966) (-2058.241) * [-2058.554] (-2063.025) (-2065.072) (-2059.968) -- 0:00:53 143500 -- (-2059.289) [-2060.107] (-2058.193) (-2060.005) * (-2057.966) (-2064.159) [-2062.880] (-2061.328) -- 0:00:53 144000 -- (-2059.281) (-2059.888) (-2058.296) [-2059.355] * (-2057.963) [-2058.591] (-2058.684) (-2061.233) -- 0:00:53 144500 -- (-2058.834) (-2060.620) [-2057.891] (-2059.745) * (-2062.868) [-2058.331] (-2060.585) (-2059.033) -- 0:00:53 145000 -- (-2062.498) (-2061.179) (-2059.521) [-2062.638] * (-2058.098) [-2058.209] (-2058.892) (-2058.315) -- 0:00:53 Average standard deviation of split frequencies: 0.018566 145500 -- (-2059.427) (-2065.886) (-2059.571) [-2061.759] * [-2058.160] (-2063.523) (-2057.765) (-2059.243) -- 0:00:52 146000 -- (-2058.834) (-2060.293) [-2059.903] (-2060.072) * (-2060.203) [-2059.599] (-2057.961) (-2060.575) -- 0:00:52 146500 -- (-2058.670) (-2058.392) (-2058.603) [-2060.073] * (-2058.035) (-2059.578) [-2058.937] (-2059.601) -- 0:00:58 147000 -- (-2058.814) (-2059.145) (-2058.604) [-2057.906] * (-2058.733) (-2060.393) (-2059.750) [-2059.803] -- 0:00:58 147500 -- (-2060.626) [-2058.976] (-2058.456) (-2058.596) * (-2062.484) (-2060.016) (-2060.599) [-2059.487] -- 0:00:57 148000 -- [-2059.649] (-2061.800) (-2062.124) (-2058.969) * (-2060.577) [-2059.970] (-2060.047) (-2062.627) -- 0:00:57 148500 -- (-2059.296) (-2059.266) (-2059.720) [-2058.578] * (-2061.434) (-2061.157) (-2059.877) [-2060.383] -- 0:00:57 149000 -- (-2062.423) [-2059.199] (-2058.892) (-2057.733) * (-2060.657) (-2057.889) [-2059.102] (-2058.977) -- 0:00:57 149500 -- (-2062.772) [-2058.468] (-2058.601) (-2059.133) * (-2058.024) (-2059.184) (-2059.671) [-2058.441] -- 0:00:56 150000 -- (-2059.799) (-2057.910) [-2062.620] (-2059.311) * (-2059.320) (-2059.355) (-2058.546) [-2058.497] -- 0:00:56 Average standard deviation of split frequencies: 0.018303 150500 -- (-2058.024) (-2058.046) (-2058.610) [-2059.837] * (-2061.299) (-2061.810) (-2060.421) [-2058.580] -- 0:00:56 151000 -- (-2059.645) [-2058.571] (-2059.907) (-2062.515) * (-2064.858) [-2063.297] (-2060.027) (-2066.464) -- 0:00:56 151500 -- [-2061.376] (-2057.641) (-2060.638) (-2058.888) * [-2063.550] (-2058.839) (-2058.555) (-2059.399) -- 0:00:56 152000 -- (-2058.912) [-2057.662] (-2061.498) (-2062.912) * (-2064.744) [-2058.190] (-2064.030) (-2059.837) -- 0:00:55 152500 -- (-2058.624) (-2058.091) (-2060.043) [-2062.969] * (-2062.139) (-2058.906) [-2060.729] (-2061.312) -- 0:00:55 153000 -- (-2059.824) [-2060.397] (-2058.798) (-2059.912) * (-2062.255) [-2059.105] (-2060.926) (-2059.379) -- 0:00:55 153500 -- (-2060.314) [-2059.436] (-2063.518) (-2060.961) * (-2062.079) [-2059.153] (-2060.147) (-2058.338) -- 0:00:55 154000 -- (-2064.594) (-2059.385) (-2064.377) [-2061.211] * (-2062.543) (-2061.015) (-2060.170) [-2058.809] -- 0:00:54 154500 -- (-2065.135) [-2059.170] (-2063.279) (-2059.591) * (-2063.443) (-2059.566) (-2060.448) [-2058.575] -- 0:00:54 155000 -- [-2059.654] (-2059.544) (-2065.836) (-2058.560) * (-2058.378) (-2060.314) [-2060.105] (-2058.421) -- 0:00:54 Average standard deviation of split frequencies: 0.015745 155500 -- (-2061.001) [-2059.346] (-2063.757) (-2059.224) * (-2058.407) [-2059.524] (-2059.043) (-2059.320) -- 0:00:54 156000 -- (-2062.432) (-2061.784) [-2060.866] (-2061.875) * (-2058.626) (-2058.164) [-2060.960] (-2059.271) -- 0:00:54 156500 -- (-2060.181) (-2059.247) [-2058.513] (-2060.804) * (-2058.605) [-2060.339] (-2060.604) (-2059.280) -- 0:00:53 157000 -- (-2060.704) (-2059.973) [-2059.495] (-2057.760) * (-2058.626) [-2059.125] (-2065.070) (-2059.273) -- 0:00:53 157500 -- [-2060.181] (-2057.961) (-2061.432) (-2058.048) * (-2059.581) (-2059.578) (-2060.109) [-2060.648] -- 0:00:53 158000 -- [-2064.038] (-2057.847) (-2059.638) (-2059.725) * (-2059.427) [-2059.342] (-2061.336) (-2060.813) -- 0:00:53 158500 -- [-2060.899] (-2057.895) (-2057.753) (-2059.851) * [-2060.027] (-2061.318) (-2061.902) (-2061.381) -- 0:00:53 159000 -- (-2061.289) [-2057.929] (-2057.861) (-2059.894) * (-2059.120) (-2059.731) [-2059.396] (-2058.501) -- 0:00:52 159500 -- (-2059.915) (-2061.283) (-2058.989) [-2062.607] * (-2064.210) (-2060.076) (-2061.005) [-2057.923] -- 0:00:52 160000 -- (-2059.066) (-2062.225) (-2057.680) [-2060.229] * (-2060.126) (-2060.419) [-2060.653] (-2057.923) -- 0:00:52 Average standard deviation of split frequencies: 0.015442 160500 -- (-2061.161) (-2064.982) [-2058.903] (-2059.032) * (-2059.956) (-2059.987) [-2059.988] (-2064.321) -- 0:00:52 161000 -- [-2060.213] (-2061.512) (-2060.375) (-2059.213) * [-2062.259] (-2060.383) (-2062.584) (-2065.690) -- 0:00:57 161500 -- (-2064.821) (-2063.694) [-2059.221] (-2058.459) * (-2061.485) [-2060.814] (-2060.907) (-2061.353) -- 0:00:57 162000 -- (-2059.856) (-2064.795) (-2059.219) [-2058.133] * (-2059.994) (-2062.508) (-2061.028) [-2061.911] -- 0:00:56 162500 -- (-2061.111) (-2062.926) [-2061.056] (-2057.648) * (-2060.354) (-2063.713) [-2060.970] (-2062.684) -- 0:00:56 163000 -- (-2060.528) [-2057.994] (-2060.859) (-2057.748) * (-2059.525) (-2063.691) [-2059.313] (-2062.123) -- 0:00:56 163500 -- (-2059.104) (-2057.143) [-2058.662] (-2059.046) * (-2058.938) [-2061.805] (-2061.794) (-2061.977) -- 0:00:56 164000 -- [-2059.541] (-2062.249) (-2058.999) (-2058.544) * [-2057.825] (-2062.454) (-2061.635) (-2061.823) -- 0:00:56 164500 -- (-2060.459) (-2058.493) [-2058.998] (-2059.393) * (-2060.893) (-2059.778) [-2061.498] (-2060.102) -- 0:00:55 165000 -- (-2059.881) (-2058.906) (-2058.176) [-2059.393] * (-2063.176) (-2060.362) [-2058.133] (-2060.102) -- 0:00:55 Average standard deviation of split frequencies: 0.017174 165500 -- (-2060.866) (-2058.505) (-2059.833) [-2061.125] * [-2060.381] (-2060.312) (-2059.788) (-2059.668) -- 0:00:55 166000 -- [-2059.349] (-2061.355) (-2058.542) (-2061.125) * (-2069.582) (-2059.457) [-2058.657] (-2061.658) -- 0:00:55 166500 -- [-2059.138] (-2059.050) (-2059.832) (-2061.106) * (-2069.177) (-2061.598) (-2058.646) [-2060.250] -- 0:00:55 167000 -- (-2060.341) (-2058.160) (-2059.354) [-2058.832] * [-2061.747] (-2061.513) (-2058.486) (-2062.730) -- 0:00:54 167500 -- (-2060.652) [-2063.639] (-2059.220) (-2059.253) * (-2060.700) (-2060.723) [-2059.440] (-2061.672) -- 0:00:54 168000 -- (-2061.095) (-2061.277) (-2059.195) [-2057.405] * (-2058.902) (-2060.723) [-2059.627] (-2060.382) -- 0:00:54 168500 -- (-2061.003) [-2059.256] (-2058.440) (-2057.466) * [-2057.489] (-2059.413) (-2057.883) (-2061.327) -- 0:00:54 169000 -- (-2057.791) (-2060.584) [-2058.785] (-2061.361) * (-2058.740) (-2057.692) [-2060.674] (-2060.055) -- 0:00:54 169500 -- (-2060.760) (-2060.409) [-2058.651] (-2060.964) * (-2061.969) [-2057.903] (-2060.710) (-2060.830) -- 0:00:53 170000 -- (-2061.065) [-2065.641] (-2057.909) (-2059.692) * (-2060.412) (-2057.568) (-2063.192) [-2060.769] -- 0:00:53 Average standard deviation of split frequencies: 0.017125 170500 -- (-2060.969) (-2062.020) (-2059.515) [-2059.865] * (-2059.744) (-2057.519) [-2058.091] (-2059.531) -- 0:00:53 171000 -- (-2061.470) [-2060.889] (-2059.273) (-2059.283) * (-2058.988) [-2057.645] (-2062.312) (-2059.243) -- 0:00:53 171500 -- (-2059.667) [-2059.898] (-2061.202) (-2057.463) * (-2059.510) (-2059.106) [-2060.880] (-2058.518) -- 0:00:53 172000 -- (-2059.359) (-2059.722) [-2060.182] (-2057.578) * [-2058.868] (-2059.069) (-2057.253) (-2059.466) -- 0:00:52 172500 -- (-2059.581) [-2059.829] (-2058.294) (-2059.536) * (-2058.888) (-2059.998) [-2058.585] (-2063.304) -- 0:00:52 173000 -- (-2063.803) (-2061.017) [-2060.295] (-2060.199) * (-2060.437) [-2060.368] (-2060.936) (-2061.058) -- 0:00:52 173500 -- (-2058.031) (-2060.506) [-2060.908] (-2063.381) * (-2058.686) [-2058.851] (-2062.685) (-2060.044) -- 0:00:52 174000 -- [-2058.161] (-2059.961) (-2066.687) (-2059.838) * [-2058.596] (-2060.773) (-2062.985) (-2060.391) -- 0:00:52 174500 -- [-2058.925] (-2059.117) (-2058.076) (-2057.929) * (-2060.390) [-2058.369] (-2064.183) (-2059.618) -- 0:00:52 175000 -- [-2059.048] (-2058.859) (-2060.251) (-2059.772) * [-2058.906] (-2058.601) (-2063.313) (-2059.835) -- 0:00:51 Average standard deviation of split frequencies: 0.019017 175500 -- (-2063.616) [-2058.555] (-2063.101) (-2060.099) * [-2058.860] (-2059.044) (-2062.065) (-2060.266) -- 0:00:51 176000 -- (-2060.464) (-2058.521) [-2060.756] (-2061.645) * (-2059.315) [-2058.717] (-2060.951) (-2060.180) -- 0:00:56 176500 -- (-2060.996) (-2058.535) (-2059.730) [-2058.230] * (-2058.810) (-2059.702) (-2060.164) [-2058.518] -- 0:00:55 177000 -- (-2062.348) (-2061.141) (-2059.139) [-2060.186] * [-2059.209] (-2059.539) (-2057.824) (-2058.276) -- 0:00:55 177500 -- (-2058.851) [-2059.915] (-2058.081) (-2062.378) * [-2059.503] (-2060.351) (-2057.727) (-2062.687) -- 0:00:55 178000 -- (-2058.783) [-2062.403] (-2061.980) (-2061.157) * (-2060.208) (-2059.878) (-2059.328) [-2067.519] -- 0:00:55 178500 -- (-2061.414) (-2062.044) [-2061.250] (-2060.739) * (-2059.604) [-2058.751] (-2060.824) (-2068.099) -- 0:00:55 179000 -- (-2064.044) (-2062.251) (-2060.668) [-2061.968] * (-2058.801) [-2059.610] (-2058.963) (-2067.456) -- 0:00:55 179500 -- (-2061.352) (-2061.691) (-2059.719) [-2059.360] * [-2059.182] (-2058.056) (-2058.468) (-2062.702) -- 0:00:54 180000 -- [-2062.086] (-2057.718) (-2061.176) (-2059.727) * [-2059.287] (-2058.505) (-2059.400) (-2063.967) -- 0:00:54 Average standard deviation of split frequencies: 0.019048 180500 -- [-2058.186] (-2058.169) (-2058.688) (-2061.007) * (-2060.811) (-2057.652) [-2059.424] (-2059.408) -- 0:00:54 181000 -- (-2058.065) (-2058.989) [-2058.773] (-2060.836) * (-2061.515) (-2061.659) [-2059.864] (-2059.289) -- 0:00:54 181500 -- (-2057.538) (-2058.537) [-2058.829] (-2061.593) * (-2061.405) (-2059.585) (-2058.999) [-2060.550] -- 0:00:54 182000 -- (-2059.740) (-2059.543) [-2059.482] (-2060.261) * [-2063.102] (-2060.309) (-2062.683) (-2060.690) -- 0:00:53 182500 -- (-2058.653) [-2060.327] (-2058.369) (-2058.845) * (-2062.839) (-2060.983) [-2057.791] (-2060.960) -- 0:00:53 183000 -- (-2057.367) (-2060.760) [-2059.801] (-2060.460) * (-2060.737) [-2058.882] (-2059.000) (-2060.534) -- 0:00:53 183500 -- (-2057.843) (-2060.010) (-2058.796) [-2060.414] * (-2059.114) (-2059.405) [-2058.017] (-2062.446) -- 0:00:53 184000 -- (-2058.353) [-2059.791] (-2060.326) (-2059.095) * [-2058.233] (-2059.147) (-2058.028) (-2062.840) -- 0:00:53 184500 -- (-2058.974) [-2059.357] (-2059.813) (-2058.786) * (-2057.965) (-2058.812) [-2059.440] (-2062.717) -- 0:00:53 185000 -- (-2059.395) (-2058.495) [-2059.091] (-2058.632) * (-2060.668) (-2058.918) [-2061.525] (-2065.192) -- 0:00:52 Average standard deviation of split frequencies: 0.016051 185500 -- (-2061.125) (-2058.504) (-2059.947) [-2058.678] * (-2058.757) [-2060.754] (-2062.903) (-2065.499) -- 0:00:52 186000 -- (-2060.609) (-2058.526) (-2061.091) [-2060.563] * (-2058.336) (-2059.320) [-2061.012] (-2061.956) -- 0:00:52 186500 -- (-2059.149) (-2060.043) [-2058.298] (-2058.279) * (-2057.967) (-2057.825) (-2062.201) [-2060.488] -- 0:00:52 187000 -- (-2059.223) [-2059.883] (-2058.148) (-2060.804) * (-2064.091) [-2059.860] (-2060.386) (-2061.848) -- 0:00:52 187500 -- [-2058.470] (-2066.905) (-2059.210) (-2059.965) * (-2061.616) (-2058.908) (-2058.883) [-2057.916] -- 0:00:52 188000 -- [-2058.462] (-2067.570) (-2066.410) (-2058.515) * (-2062.329) [-2058.637] (-2058.956) (-2057.916) -- 0:00:51 188500 -- (-2066.014) [-2059.436] (-2058.931) (-2057.506) * (-2058.867) (-2059.190) (-2062.475) [-2058.426] -- 0:00:51 189000 -- (-2059.506) (-2059.098) (-2058.931) [-2059.530] * [-2058.226] (-2060.168) (-2059.320) (-2058.338) -- 0:00:51 189500 -- (-2062.618) [-2059.724] (-2060.072) (-2060.382) * (-2058.153) (-2059.788) [-2059.486] (-2058.553) -- 0:00:51 190000 -- [-2061.167] (-2059.169) (-2060.375) (-2060.617) * (-2058.113) (-2059.544) [-2058.544] (-2059.888) -- 0:00:51 Average standard deviation of split frequencies: 0.016656 190500 -- (-2060.333) (-2059.110) (-2062.988) [-2059.945] * (-2062.726) (-2060.953) [-2061.802] (-2058.761) -- 0:00:50 191000 -- (-2060.414) [-2061.652] (-2061.290) (-2058.528) * (-2058.403) (-2061.712) [-2062.695] (-2058.761) -- 0:00:55 191500 -- (-2062.165) (-2061.695) (-2057.774) [-2058.096] * (-2058.693) (-2058.512) [-2062.894] (-2058.196) -- 0:00:54 192000 -- (-2062.453) (-2060.339) [-2057.926] (-2058.133) * [-2059.425] (-2058.434) (-2059.917) (-2060.031) -- 0:00:54 192500 -- (-2057.507) (-2059.951) (-2060.426) [-2059.501] * (-2060.428) (-2062.624) [-2060.523] (-2060.789) -- 0:00:54 193000 -- (-2057.752) (-2059.193) (-2060.937) [-2059.663] * [-2060.691] (-2059.613) (-2059.780) (-2061.236) -- 0:00:54 193500 -- [-2057.902] (-2059.258) (-2059.413) (-2060.381) * (-2060.891) (-2059.613) [-2060.160] (-2061.423) -- 0:00:54 194000 -- [-2058.687] (-2058.190) (-2058.383) (-2059.086) * (-2062.820) (-2061.884) (-2060.493) [-2059.056] -- 0:00:54 194500 -- (-2059.013) (-2058.280) [-2057.881] (-2058.940) * (-2062.040) [-2060.610] (-2059.917) (-2059.251) -- 0:00:53 195000 -- (-2057.977) (-2058.319) [-2061.499] (-2059.100) * (-2059.466) [-2060.726] (-2060.011) (-2059.327) -- 0:00:53 Average standard deviation of split frequencies: 0.016330 195500 -- [-2058.287] (-2058.091) (-2060.604) (-2058.865) * (-2059.682) (-2062.014) [-2060.060] (-2059.704) -- 0:00:53 196000 -- [-2058.934] (-2061.800) (-2061.981) (-2059.692) * (-2060.137) (-2060.093) (-2058.671) [-2058.722] -- 0:00:53 196500 -- [-2059.400] (-2063.789) (-2062.138) (-2061.369) * [-2059.407] (-2058.679) (-2062.791) (-2058.739) -- 0:00:53 197000 -- [-2059.440] (-2059.225) (-2058.947) (-2063.877) * (-2059.854) (-2057.517) [-2062.908] (-2059.856) -- 0:00:52 197500 -- (-2058.606) (-2058.440) [-2057.751] (-2062.592) * [-2059.380] (-2060.075) (-2060.531) (-2059.306) -- 0:00:52 198000 -- (-2059.310) [-2058.695] (-2057.468) (-2059.462) * (-2058.156) (-2060.075) [-2058.280] (-2059.063) -- 0:00:52 198500 -- (-2059.310) (-2059.766) [-2058.357] (-2059.644) * (-2061.328) [-2060.075] (-2061.639) (-2058.620) -- 0:00:52 199000 -- (-2059.982) (-2059.244) [-2060.135] (-2060.301) * (-2059.516) [-2058.844] (-2060.893) (-2060.587) -- 0:00:52 199500 -- (-2057.345) [-2060.009] (-2066.058) (-2058.094) * (-2058.076) (-2059.409) (-2058.347) [-2063.503] -- 0:00:52 200000 -- (-2058.170) (-2060.632) (-2057.537) [-2059.491] * (-2058.379) (-2063.623) [-2058.902] (-2061.414) -- 0:00:51 Average standard deviation of split frequencies: 0.015084 200500 -- (-2057.422) (-2061.739) [-2057.705] (-2059.614) * [-2058.166] (-2066.254) (-2059.789) (-2058.899) -- 0:00:51 201000 -- (-2058.769) (-2066.141) (-2059.359) [-2060.444] * (-2057.431) [-2061.823] (-2058.438) (-2058.126) -- 0:00:51 201500 -- [-2059.817] (-2063.717) (-2060.702) (-2059.982) * (-2060.333) [-2061.593] (-2060.673) (-2060.786) -- 0:00:51 202000 -- [-2062.645] (-2062.790) (-2063.906) (-2058.884) * (-2059.946) (-2059.325) (-2057.501) [-2060.365] -- 0:00:51 202500 -- (-2060.631) [-2062.323] (-2057.887) (-2058.899) * (-2058.742) (-2060.786) [-2058.918] (-2059.829) -- 0:00:51 203000 -- (-2060.980) [-2060.912] (-2058.097) (-2058.824) * [-2058.082] (-2060.046) (-2059.913) (-2060.451) -- 0:00:51 203500 -- (-2060.930) (-2060.181) (-2060.833) [-2058.824] * (-2060.706) [-2060.208] (-2059.079) (-2057.778) -- 0:00:50 204000 -- [-2061.751] (-2060.089) (-2058.183) (-2058.704) * (-2065.208) (-2060.080) (-2058.824) [-2059.316] -- 0:00:50 204500 -- (-2061.217) [-2062.007] (-2058.288) (-2059.324) * (-2063.847) (-2060.186) [-2059.784] (-2060.513) -- 0:00:50 205000 -- (-2060.463) (-2060.156) [-2059.041] (-2059.843) * [-2059.769] (-2062.147) (-2060.009) (-2062.892) -- 0:00:50 Average standard deviation of split frequencies: 0.013839 205500 -- (-2059.621) (-2061.744) [-2060.267] (-2057.383) * (-2059.375) [-2059.541] (-2059.262) (-2062.402) -- 0:00:54 206000 -- (-2059.398) [-2059.802] (-2058.368) (-2058.495) * (-2059.567) (-2057.545) (-2060.180) [-2059.276] -- 0:00:53 206500 -- (-2059.856) (-2060.981) (-2059.755) [-2058.681] * [-2059.811] (-2059.198) (-2059.163) (-2059.750) -- 0:00:53 207000 -- (-2060.824) (-2057.852) [-2059.803] (-2057.239) * (-2057.407) [-2059.180] (-2062.336) (-2061.096) -- 0:00:53 207500 -- (-2057.981) (-2058.617) [-2059.553] (-2058.336) * (-2057.627) [-2060.241] (-2058.094) (-2061.215) -- 0:00:53 208000 -- (-2057.977) (-2058.622) [-2058.102] (-2058.510) * [-2059.841] (-2060.455) (-2058.854) (-2060.214) -- 0:00:53 208500 -- (-2058.621) (-2060.322) (-2057.657) [-2058.207] * (-2059.467) [-2060.157] (-2061.206) (-2058.513) -- 0:00:53 209000 -- [-2057.796] (-2061.587) (-2057.788) (-2062.139) * (-2058.621) (-2059.078) [-2061.206] (-2060.297) -- 0:00:52 209500 -- [-2057.734] (-2058.753) (-2064.094) (-2061.008) * (-2058.057) (-2059.131) [-2060.950] (-2062.369) -- 0:00:52 210000 -- [-2060.690] (-2062.610) (-2058.701) (-2061.001) * (-2059.824) [-2059.566] (-2061.188) (-2063.836) -- 0:00:52 Average standard deviation of split frequencies: 0.014433 210500 -- [-2058.835] (-2060.223) (-2058.297) (-2060.893) * (-2059.231) (-2064.148) (-2058.799) [-2059.739] -- 0:00:52 211000 -- (-2059.419) (-2061.126) [-2058.138] (-2059.706) * (-2059.351) (-2062.964) [-2060.792] (-2060.942) -- 0:00:52 211500 -- (-2057.978) (-2061.616) (-2057.265) [-2060.441] * (-2060.058) (-2061.484) [-2061.651] (-2059.693) -- 0:00:52 212000 -- (-2058.683) (-2062.567) (-2057.290) [-2060.322] * (-2059.827) [-2059.501] (-2061.137) (-2061.571) -- 0:00:52 212500 -- (-2058.410) (-2061.274) [-2057.473] (-2059.955) * [-2060.707] (-2063.455) (-2060.073) (-2060.578) -- 0:00:51 213000 -- (-2057.824) (-2062.242) (-2059.098) [-2058.819] * [-2059.652] (-2058.338) (-2061.060) (-2060.370) -- 0:00:51 213500 -- (-2058.157) (-2059.979) (-2060.144) [-2059.150] * (-2059.097) (-2059.777) (-2062.783) [-2059.995] -- 0:00:51 214000 -- (-2058.173) [-2060.350] (-2060.217) (-2058.139) * (-2061.503) [-2058.299] (-2062.300) (-2059.959) -- 0:00:51 214500 -- [-2061.935] (-2058.784) (-2060.508) (-2058.139) * (-2061.931) [-2058.126] (-2058.692) (-2059.799) -- 0:00:51 215000 -- (-2059.980) [-2059.997] (-2061.436) (-2057.922) * (-2058.099) (-2058.095) [-2059.998] (-2059.905) -- 0:00:51 Average standard deviation of split frequencies: 0.014703 215500 -- (-2061.858) (-2059.423) (-2061.992) [-2059.925] * (-2059.579) [-2058.258] (-2063.359) (-2065.099) -- 0:00:50 216000 -- (-2059.381) (-2059.396) (-2062.069) [-2062.022] * [-2059.740] (-2058.259) (-2062.563) (-2064.148) -- 0:00:50 216500 -- (-2058.271) [-2058.867] (-2059.984) (-2060.034) * (-2058.750) [-2058.952] (-2063.024) (-2062.783) -- 0:00:50 217000 -- (-2057.960) [-2060.341] (-2061.821) (-2059.997) * (-2060.663) (-2061.318) (-2061.727) [-2065.703] -- 0:00:50 217500 -- (-2059.534) (-2059.149) [-2058.254] (-2061.681) * [-2058.518] (-2059.232) (-2061.171) (-2059.424) -- 0:00:50 218000 -- [-2057.881] (-2062.268) (-2058.273) (-2058.162) * (-2059.525) (-2064.206) (-2058.699) [-2057.690] -- 0:00:50 218500 -- [-2058.010] (-2060.859) (-2059.252) (-2057.655) * (-2059.563) (-2059.160) (-2059.075) [-2059.535] -- 0:00:50 219000 -- [-2057.443] (-2058.744) (-2060.839) (-2057.470) * (-2059.505) [-2058.089] (-2060.038) (-2060.866) -- 0:00:49 219500 -- (-2057.277) [-2057.879] (-2061.587) (-2057.671) * (-2058.110) (-2059.677) (-2060.673) [-2058.341] -- 0:00:49 220000 -- [-2059.867] (-2061.758) (-2064.893) (-2059.448) * (-2058.110) [-2058.793] (-2066.434) (-2060.114) -- 0:00:49 Average standard deviation of split frequencies: 0.015853 220500 -- (-2058.519) [-2060.542] (-2062.461) (-2060.275) * (-2059.044) [-2061.712] (-2063.605) (-2060.407) -- 0:00:53 221000 -- (-2057.701) [-2059.201] (-2058.488) (-2062.491) * (-2059.165) (-2061.404) (-2061.646) [-2059.368] -- 0:00:52 221500 -- (-2060.582) (-2061.146) [-2058.508] (-2064.981) * (-2059.674) (-2059.370) (-2061.006) [-2059.744] -- 0:00:52 222000 -- (-2061.020) [-2061.901] (-2060.538) (-2067.663) * (-2059.463) (-2058.996) [-2061.252] (-2061.434) -- 0:00:52 222500 -- (-2059.596) (-2060.509) [-2060.988] (-2057.935) * [-2058.514] (-2059.293) (-2063.860) (-2061.544) -- 0:00:52 223000 -- (-2060.830) [-2060.158] (-2062.819) (-2058.081) * [-2057.825] (-2058.420) (-2060.678) (-2061.516) -- 0:00:52 223500 -- (-2061.825) (-2057.966) [-2062.319] (-2062.206) * (-2058.016) (-2061.042) (-2063.159) [-2060.910] -- 0:00:52 224000 -- (-2061.758) (-2059.071) [-2067.277] (-2059.998) * (-2060.224) [-2059.085] (-2061.625) (-2059.481) -- 0:00:51 224500 -- [-2063.110] (-2058.623) (-2062.173) (-2060.742) * [-2062.664] (-2058.761) (-2062.384) (-2057.761) -- 0:00:51 225000 -- (-2060.907) (-2058.805) (-2061.408) [-2058.234] * [-2061.927] (-2058.666) (-2065.650) (-2058.552) -- 0:00:51 Average standard deviation of split frequencies: 0.016138 225500 -- (-2059.299) (-2059.657) [-2061.599] (-2059.306) * [-2059.885] (-2062.246) (-2060.268) (-2057.598) -- 0:00:51 226000 -- (-2059.572) (-2062.516) [-2058.863] (-2060.758) * [-2059.728] (-2060.300) (-2061.900) (-2059.031) -- 0:00:51 226500 -- (-2058.815) [-2060.386] (-2059.364) (-2060.030) * [-2058.941] (-2058.479) (-2063.389) (-2057.964) -- 0:00:51 227000 -- (-2058.414) [-2062.542] (-2058.443) (-2059.994) * (-2059.462) (-2058.435) (-2061.331) [-2057.629] -- 0:00:51 227500 -- (-2058.975) (-2057.795) [-2058.558] (-2060.549) * (-2060.430) [-2059.333] (-2059.959) (-2058.553) -- 0:00:50 228000 -- (-2060.665) [-2058.089] (-2058.761) (-2066.973) * (-2060.214) (-2061.403) (-2059.914) [-2062.116] -- 0:00:50 228500 -- [-2062.659] (-2057.414) (-2059.152) (-2064.114) * (-2064.649) [-2057.753] (-2061.006) (-2063.597) -- 0:00:50 229000 -- (-2060.710) [-2058.393] (-2057.364) (-2068.747) * [-2062.692] (-2058.991) (-2061.732) (-2058.947) -- 0:00:50 229500 -- (-2061.779) [-2058.486] (-2058.555) (-2057.708) * (-2062.406) (-2058.575) (-2059.253) [-2058.861] -- 0:00:50 230000 -- (-2058.478) (-2061.360) (-2057.228) [-2057.523] * (-2061.237) (-2059.796) (-2060.656) [-2058.164] -- 0:00:50 Average standard deviation of split frequencies: 0.016457 230500 -- (-2059.438) (-2059.689) (-2058.009) [-2059.348] * [-2057.514] (-2062.228) (-2063.530) (-2059.809) -- 0:00:50 231000 -- (-2059.777) (-2059.925) [-2058.009] (-2058.815) * [-2057.565] (-2059.924) (-2060.520) (-2059.412) -- 0:00:49 231500 -- [-2062.952] (-2059.551) (-2058.480) (-2058.315) * (-2057.471) (-2060.364) (-2057.457) [-2057.673] -- 0:00:49 232000 -- (-2066.143) (-2058.882) (-2058.480) [-2057.939] * (-2057.863) (-2059.439) (-2058.100) [-2058.346] -- 0:00:49 232500 -- (-2059.619) (-2058.463) [-2057.713] (-2061.600) * [-2059.164] (-2060.232) (-2057.543) (-2058.193) -- 0:00:49 233000 -- (-2059.980) (-2061.760) [-2057.945] (-2058.074) * [-2058.439] (-2060.709) (-2058.768) (-2059.369) -- 0:00:49 233500 -- [-2057.891] (-2057.961) (-2058.247) (-2057.764) * (-2060.263) (-2059.397) [-2059.207] (-2059.443) -- 0:00:49 234000 -- (-2060.469) (-2061.837) [-2057.800] (-2061.013) * (-2059.350) (-2060.655) (-2058.828) [-2060.360] -- 0:00:49 234500 -- (-2061.186) (-2057.807) (-2059.215) [-2060.927] * (-2059.280) (-2063.314) [-2058.504] (-2059.389) -- 0:00:48 235000 -- (-2057.761) (-2057.379) [-2057.510] (-2065.218) * [-2061.518] (-2059.675) (-2057.891) (-2059.666) -- 0:00:48 Average standard deviation of split frequencies: 0.017452 235500 -- (-2059.238) (-2058.159) [-2057.510] (-2065.214) * (-2059.546) (-2060.787) (-2060.061) [-2059.761] -- 0:00:51 236000 -- (-2060.414) (-2060.132) (-2058.842) [-2064.581] * [-2058.763] (-2059.930) (-2058.666) (-2059.634) -- 0:00:51 236500 -- (-2059.504) [-2058.800] (-2058.119) (-2058.101) * (-2058.538) (-2058.599) (-2058.956) [-2058.646] -- 0:00:51 237000 -- (-2059.681) (-2057.579) [-2059.831] (-2060.446) * [-2059.063] (-2058.805) (-2060.149) (-2059.151) -- 0:00:51 237500 -- [-2058.757] (-2057.590) (-2060.260) (-2063.545) * (-2060.200) (-2060.021) (-2059.586) [-2061.228] -- 0:00:51 238000 -- (-2063.744) (-2057.561) (-2060.002) [-2060.101] * [-2060.200] (-2058.012) (-2058.789) (-2062.196) -- 0:00:51 238500 -- [-2058.189] (-2063.253) (-2062.372) (-2057.425) * (-2058.833) (-2057.849) [-2058.746] (-2063.612) -- 0:00:51 239000 -- (-2059.251) (-2059.941) [-2060.090] (-2057.588) * (-2059.167) [-2060.848] (-2058.970) (-2060.764) -- 0:00:50 239500 -- (-2059.123) (-2062.902) (-2060.066) [-2058.801] * (-2059.330) (-2058.916) [-2058.815] (-2060.484) -- 0:00:50 240000 -- (-2059.388) (-2060.191) [-2059.454] (-2066.110) * [-2060.826] (-2058.755) (-2058.900) (-2065.504) -- 0:00:50 Average standard deviation of split frequencies: 0.018717 240500 -- (-2065.682) (-2060.088) (-2060.837) [-2057.491] * (-2059.983) [-2057.736] (-2058.342) (-2060.393) -- 0:00:50 241000 -- [-2065.786] (-2058.474) (-2060.427) (-2057.723) * (-2062.999) [-2058.543] (-2058.346) (-2060.453) -- 0:00:50 241500 -- (-2059.593) [-2060.533] (-2059.078) (-2060.105) * (-2060.026) [-2063.344] (-2058.078) (-2058.292) -- 0:00:50 242000 -- (-2061.286) [-2058.095] (-2066.198) (-2062.636) * [-2058.664] (-2062.585) (-2058.509) (-2060.458) -- 0:00:50 242500 -- (-2060.457) (-2059.720) [-2062.247] (-2062.019) * (-2060.618) (-2061.046) (-2060.346) [-2059.376] -- 0:00:49 243000 -- [-2059.672] (-2057.614) (-2062.061) (-2061.432) * (-2059.508) (-2063.392) [-2059.991] (-2058.281) -- 0:00:49 243500 -- (-2059.107) (-2065.810) (-2059.133) [-2058.761] * (-2060.469) [-2059.792] (-2058.672) (-2058.292) -- 0:00:49 244000 -- (-2059.488) (-2066.679) [-2059.189] (-2057.956) * (-2063.565) (-2060.687) (-2059.306) [-2058.244] -- 0:00:49 244500 -- (-2058.034) (-2061.508) [-2059.646] (-2058.755) * (-2060.511) (-2059.774) (-2059.108) [-2063.484] -- 0:00:49 245000 -- (-2058.118) [-2059.775] (-2058.634) (-2061.481) * (-2061.906) (-2058.447) [-2058.700] (-2060.374) -- 0:00:49 Average standard deviation of split frequencies: 0.017347 245500 -- (-2060.090) [-2061.357] (-2058.351) (-2063.421) * [-2059.265] (-2057.849) (-2059.586) (-2061.055) -- 0:00:49 246000 -- (-2059.462) (-2059.021) [-2058.959] (-2062.392) * (-2064.951) [-2058.469] (-2063.295) (-2058.878) -- 0:00:49 246500 -- (-2059.508) (-2058.202) [-2060.190] (-2063.601) * (-2058.350) [-2058.456] (-2063.293) (-2061.718) -- 0:00:48 247000 -- [-2060.822] (-2059.642) (-2060.195) (-2063.607) * (-2060.298) (-2058.487) [-2061.172] (-2059.869) -- 0:00:48 247500 -- (-2060.599) [-2058.348] (-2059.799) (-2063.865) * (-2060.348) [-2058.174] (-2061.167) (-2057.801) -- 0:00:48 248000 -- [-2060.434] (-2059.695) (-2058.229) (-2060.401) * (-2059.066) (-2060.317) (-2058.807) [-2057.671] -- 0:00:48 248500 -- (-2059.930) (-2062.203) [-2058.610] (-2060.853) * (-2060.176) (-2058.543) [-2060.276] (-2057.943) -- 0:00:48 249000 -- (-2064.507) (-2061.771) (-2058.663) [-2063.829] * (-2060.706) (-2058.905) (-2059.495) [-2059.779] -- 0:00:48 249500 -- [-2060.233] (-2062.762) (-2059.538) (-2062.069) * (-2059.487) (-2058.653) [-2058.039] (-2059.328) -- 0:00:48 250000 -- (-2059.143) (-2059.851) (-2057.882) [-2059.469] * (-2058.799) [-2058.787] (-2063.851) (-2059.327) -- 0:00:48 Average standard deviation of split frequencies: 0.016530 250500 -- [-2059.302] (-2059.363) (-2060.653) (-2061.250) * (-2059.965) [-2059.733] (-2063.894) (-2060.619) -- 0:00:50 251000 -- (-2060.623) (-2060.973) (-2059.623) [-2061.710] * (-2064.104) [-2058.873] (-2059.658) (-2060.109) -- 0:00:50 251500 -- (-2059.925) (-2058.654) [-2060.599] (-2058.670) * (-2061.784) [-2060.025] (-2059.278) (-2059.921) -- 0:00:50 252000 -- (-2059.010) [-2058.512] (-2059.332) (-2059.370) * (-2063.660) (-2060.265) [-2058.832] (-2059.004) -- 0:00:50 252500 -- (-2061.983) (-2058.461) [-2057.911] (-2062.354) * (-2060.319) (-2059.951) (-2057.844) [-2059.737] -- 0:00:50 253000 -- (-2061.944) (-2058.110) (-2062.352) [-2060.114] * [-2060.422] (-2059.946) (-2057.735) (-2060.710) -- 0:00:50 253500 -- (-2061.787) (-2060.507) [-2060.204] (-2060.477) * (-2059.042) (-2060.812) [-2058.411] (-2059.718) -- 0:00:50 254000 -- (-2060.788) [-2059.586] (-2060.040) (-2061.968) * (-2059.768) (-2064.824) [-2060.378] (-2062.238) -- 0:00:49 254500 -- [-2061.456] (-2057.572) (-2058.756) (-2058.362) * (-2059.636) [-2059.113] (-2059.548) (-2064.041) -- 0:00:49 255000 -- (-2060.948) (-2057.372) [-2058.351] (-2060.181) * (-2060.014) [-2061.254] (-2059.651) (-2061.346) -- 0:00:49 Average standard deviation of split frequencies: 0.015991 255500 -- (-2059.261) [-2059.144] (-2058.667) (-2063.329) * (-2058.195) [-2061.104] (-2061.812) (-2062.054) -- 0:00:49 256000 -- [-2063.779] (-2057.598) (-2060.546) (-2061.961) * (-2058.160) (-2058.081) [-2061.769] (-2059.663) -- 0:00:49 256500 -- (-2059.986) (-2058.349) [-2060.427] (-2058.162) * (-2059.465) [-2058.080] (-2060.310) (-2060.526) -- 0:00:49 257000 -- [-2057.991] (-2060.403) (-2059.926) (-2058.889) * [-2058.076] (-2058.335) (-2059.504) (-2062.313) -- 0:00:49 257500 -- (-2062.170) (-2058.548) [-2060.259] (-2058.867) * [-2059.848] (-2058.461) (-2059.665) (-2059.751) -- 0:00:49 258000 -- (-2061.031) (-2059.273) [-2058.259] (-2059.189) * (-2058.739) (-2061.447) (-2060.382) [-2061.158] -- 0:00:48 258500 -- [-2058.942] (-2058.138) (-2058.315) (-2068.702) * (-2057.805) (-2068.118) (-2057.809) [-2060.102] -- 0:00:48 259000 -- (-2057.718) (-2059.470) [-2057.913] (-2059.523) * (-2057.748) (-2060.664) [-2057.668] (-2063.502) -- 0:00:48 259500 -- [-2058.457] (-2060.361) (-2059.992) (-2060.881) * (-2057.771) (-2057.897) [-2057.650] (-2063.217) -- 0:00:48 260000 -- (-2061.784) [-2060.712] (-2062.618) (-2058.121) * [-2058.412] (-2057.811) (-2061.443) (-2062.656) -- 0:00:48 Average standard deviation of split frequencies: 0.016276 260500 -- [-2059.544] (-2061.214) (-2060.959) (-2059.437) * (-2059.071) (-2059.018) [-2064.780] (-2060.517) -- 0:00:48 261000 -- (-2059.587) (-2060.971) (-2060.163) [-2059.437] * (-2057.688) (-2060.962) (-2060.874) [-2058.841] -- 0:00:48 261500 -- (-2059.650) [-2060.266] (-2061.140) (-2057.865) * (-2058.386) [-2064.917] (-2063.167) (-2058.364) -- 0:00:48 262000 -- (-2058.631) (-2063.069) (-2061.371) [-2059.970] * (-2058.514) (-2060.331) (-2061.473) [-2060.199] -- 0:00:47 262500 -- [-2057.712] (-2058.794) (-2061.011) (-2059.885) * (-2068.128) (-2059.124) (-2059.293) [-2062.393] -- 0:00:47 263000 -- (-2057.691) (-2059.726) (-2059.846) [-2060.525] * (-2066.324) (-2059.426) [-2059.995] (-2060.954) -- 0:00:47 263500 -- (-2061.189) [-2060.127] (-2061.317) (-2061.545) * [-2061.639] (-2058.993) (-2062.829) (-2061.483) -- 0:00:47 264000 -- (-2060.602) (-2059.654) (-2061.556) [-2062.097] * (-2061.892) (-2059.628) (-2060.038) [-2058.009] -- 0:00:47 264500 -- [-2061.336] (-2059.823) (-2059.431) (-2058.081) * (-2060.912) (-2058.244) [-2060.290] (-2058.335) -- 0:00:47 265000 -- (-2060.964) (-2059.193) (-2065.252) [-2057.648] * [-2061.788] (-2057.630) (-2061.731) (-2061.152) -- 0:00:47 Average standard deviation of split frequencies: 0.016216 265500 -- [-2062.105] (-2063.210) (-2059.810) (-2058.547) * (-2061.960) [-2061.656] (-2061.520) (-2061.552) -- 0:00:49 266000 -- (-2060.183) (-2060.705) (-2058.614) [-2057.474] * (-2063.814) (-2058.400) (-2061.486) [-2059.632] -- 0:00:49 266500 -- (-2058.150) (-2057.605) (-2059.154) [-2060.681] * (-2061.186) [-2059.308] (-2060.963) (-2059.103) -- 0:00:49 267000 -- (-2059.155) [-2057.599] (-2060.681) (-2059.496) * (-2061.907) (-2059.164) [-2059.624] (-2059.243) -- 0:00:49 267500 -- (-2058.269) (-2059.698) (-2060.418) [-2064.618] * (-2060.323) (-2059.223) (-2058.159) [-2059.477] -- 0:00:49 268000 -- (-2058.223) (-2058.364) (-2059.103) [-2059.278] * (-2061.264) [-2059.223] (-2057.851) (-2058.706) -- 0:00:49 268500 -- (-2060.328) (-2058.366) [-2060.283] (-2059.579) * (-2060.140) (-2061.053) [-2057.867] (-2058.626) -- 0:00:49 269000 -- (-2061.945) [-2058.385] (-2058.921) (-2064.648) * (-2059.987) (-2058.984) (-2059.029) [-2061.245] -- 0:00:48 269500 -- (-2061.390) (-2058.336) [-2058.599] (-2063.951) * [-2060.485] (-2060.595) (-2063.626) (-2063.114) -- 0:00:48 270000 -- (-2060.469) (-2058.557) (-2059.550) [-2061.774] * (-2061.153) (-2059.876) (-2061.449) [-2059.798] -- 0:00:48 Average standard deviation of split frequencies: 0.015936 270500 -- (-2058.980) (-2058.475) [-2057.735] (-2059.236) * [-2060.971] (-2060.624) (-2060.180) (-2058.991) -- 0:00:48 271000 -- [-2058.688] (-2061.425) (-2058.129) (-2060.746) * (-2061.369) (-2060.021) (-2060.190) [-2059.316] -- 0:00:48 271500 -- (-2058.246) (-2058.457) (-2059.497) [-2058.219] * (-2062.807) (-2061.034) [-2060.379] (-2063.694) -- 0:00:48 272000 -- (-2058.231) [-2060.382] (-2059.497) (-2057.712) * (-2059.973) [-2058.851] (-2059.007) (-2057.785) -- 0:00:48 272500 -- (-2061.940) [-2058.767] (-2059.118) (-2058.521) * (-2057.916) (-2059.750) (-2061.200) [-2057.919] -- 0:00:48 273000 -- (-2063.059) (-2058.501) [-2059.172] (-2060.286) * (-2058.008) (-2059.806) [-2060.198] (-2058.740) -- 0:00:47 273500 -- (-2062.956) (-2059.391) [-2058.570] (-2058.845) * (-2059.249) (-2060.025) (-2060.177) [-2058.053] -- 0:00:47 274000 -- [-2058.722] (-2059.066) (-2058.654) (-2058.675) * (-2058.310) [-2060.003] (-2059.133) (-2059.033) -- 0:00:47 274500 -- (-2059.980) (-2060.688) (-2058.430) [-2060.722] * (-2058.995) (-2060.646) [-2058.947] (-2059.934) -- 0:00:47 275000 -- (-2060.900) [-2061.514] (-2059.461) (-2063.518) * (-2058.689) [-2058.863] (-2059.060) (-2062.995) -- 0:00:47 Average standard deviation of split frequencies: 0.014859 275500 -- (-2060.653) (-2068.589) [-2059.564] (-2062.643) * [-2058.034] (-2058.921) (-2062.077) (-2061.634) -- 0:00:47 276000 -- [-2060.495] (-2065.737) (-2058.097) (-2063.822) * (-2058.154) [-2058.876] (-2058.809) (-2060.354) -- 0:00:47 276500 -- [-2058.878] (-2059.134) (-2060.288) (-2065.066) * [-2057.772] (-2058.244) (-2059.745) (-2061.689) -- 0:00:47 277000 -- [-2057.650] (-2061.625) (-2058.249) (-2061.207) * (-2058.511) (-2058.664) (-2059.141) [-2062.745] -- 0:00:46 277500 -- (-2063.453) (-2064.597) [-2058.846] (-2058.496) * (-2058.171) (-2058.340) [-2059.176] (-2061.041) -- 0:00:46 278000 -- (-2060.683) (-2063.143) (-2060.366) [-2058.648] * [-2057.503] (-2062.163) (-2057.656) (-2058.243) -- 0:00:46 278500 -- [-2057.962] (-2062.028) (-2059.295) (-2059.779) * (-2060.121) [-2058.019] (-2057.674) (-2058.615) -- 0:00:46 279000 -- (-2058.179) [-2060.585] (-2058.952) (-2060.084) * (-2059.983) (-2058.227) [-2057.804] (-2058.211) -- 0:00:46 279500 -- [-2059.140] (-2058.688) (-2060.154) (-2059.234) * [-2057.775] (-2057.854) (-2060.586) (-2058.169) -- 0:00:46 280000 -- (-2062.555) (-2060.587) (-2059.977) [-2058.803] * (-2059.161) (-2058.193) [-2058.907] (-2058.565) -- 0:00:48 Average standard deviation of split frequencies: 0.015620 280500 -- [-2060.530] (-2060.753) (-2058.786) (-2058.641) * [-2058.279] (-2061.945) (-2058.388) (-2059.054) -- 0:00:48 281000 -- [-2060.638] (-2059.819) (-2064.584) (-2058.191) * (-2057.887) (-2059.741) (-2062.255) [-2058.689] -- 0:00:48 281500 -- (-2060.087) (-2060.358) (-2064.465) [-2059.043] * [-2057.850] (-2059.556) (-2062.714) (-2058.689) -- 0:00:48 282000 -- (-2060.962) [-2059.377] (-2057.988) (-2059.473) * (-2057.778) (-2059.873) (-2061.539) [-2058.995] -- 0:00:48 282500 -- (-2060.378) [-2059.176] (-2058.441) (-2060.449) * (-2060.886) (-2059.777) [-2060.884] (-2058.925) -- 0:00:48 283000 -- (-2060.865) (-2061.238) [-2058.376] (-2060.781) * (-2058.015) (-2059.159) [-2059.847] (-2058.074) -- 0:00:48 283500 -- (-2061.306) (-2058.396) (-2059.518) [-2058.008] * (-2059.892) [-2059.655] (-2063.271) (-2059.731) -- 0:00:48 284000 -- (-2060.923) [-2060.298] (-2063.609) (-2060.673) * (-2058.736) (-2058.974) [-2061.817] (-2059.858) -- 0:00:47 284500 -- (-2058.295) (-2061.983) (-2059.149) [-2057.296] * (-2058.121) (-2059.254) [-2060.437] (-2059.409) -- 0:00:47 285000 -- (-2058.135) (-2058.354) (-2063.041) [-2057.319] * (-2060.402) (-2058.742) [-2061.678] (-2059.330) -- 0:00:47 Average standard deviation of split frequencies: 0.015741 285500 -- [-2058.981] (-2059.216) (-2060.798) (-2059.309) * (-2060.485) [-2059.913] (-2059.762) (-2061.014) -- 0:00:47 286000 -- (-2060.067) (-2063.456) [-2058.377] (-2061.088) * (-2058.348) [-2061.751] (-2060.697) (-2062.850) -- 0:00:47 286500 -- (-2058.270) (-2061.495) (-2058.403) [-2061.671] * [-2057.582] (-2060.492) (-2060.285) (-2059.908) -- 0:00:47 287000 -- (-2059.149) (-2058.643) (-2058.319) [-2059.389] * (-2059.349) [-2057.672] (-2060.942) (-2058.531) -- 0:00:47 287500 -- [-2059.740] (-2059.068) (-2058.619) (-2058.351) * (-2057.814) [-2058.292] (-2059.365) (-2058.804) -- 0:00:47 288000 -- (-2061.231) (-2057.892) [-2060.584] (-2058.130) * (-2057.813) [-2058.784] (-2057.487) (-2058.558) -- 0:00:46 288500 -- (-2061.845) (-2058.111) [-2059.668] (-2062.772) * (-2059.243) [-2058.279] (-2059.157) (-2062.099) -- 0:00:46 289000 -- (-2064.653) [-2061.182] (-2057.932) (-2060.238) * (-2058.335) (-2057.847) (-2060.645) [-2058.484] -- 0:00:46 289500 -- (-2058.182) (-2058.401) [-2058.755] (-2062.458) * (-2058.867) (-2060.843) [-2057.349] (-2059.488) -- 0:00:46 290000 -- (-2058.477) (-2058.266) [-2058.441] (-2059.818) * (-2057.654) (-2058.117) [-2057.351] (-2059.430) -- 0:00:46 Average standard deviation of split frequencies: 0.015975 290500 -- (-2058.152) (-2057.852) [-2059.624] (-2060.126) * [-2058.708] (-2061.159) (-2060.907) (-2058.339) -- 0:00:46 291000 -- (-2058.547) (-2058.248) [-2058.950] (-2060.203) * (-2059.250) [-2063.455] (-2062.725) (-2060.378) -- 0:00:46 291500 -- (-2058.719) [-2057.879] (-2060.256) (-2061.598) * (-2059.074) (-2062.859) [-2061.872] (-2062.461) -- 0:00:46 292000 -- [-2061.311] (-2058.384) (-2060.151) (-2063.805) * (-2058.585) [-2061.215] (-2061.160) (-2064.620) -- 0:00:46 292500 -- (-2058.221) (-2058.420) (-2067.724) [-2061.257] * (-2060.955) (-2059.169) [-2059.201] (-2062.126) -- 0:00:45 293000 -- (-2060.868) (-2065.579) [-2061.569] (-2065.094) * (-2061.123) (-2060.657) (-2059.833) [-2061.111] -- 0:00:45 293500 -- (-2061.109) [-2063.705] (-2059.853) (-2064.675) * (-2059.093) (-2063.081) (-2058.284) [-2058.194] -- 0:00:48 294000 -- [-2059.414] (-2063.347) (-2058.738) (-2061.401) * [-2058.143] (-2059.573) (-2059.557) (-2060.197) -- 0:00:48 294500 -- (-2059.414) [-2063.989] (-2058.952) (-2060.840) * (-2063.110) (-2059.360) [-2059.716] (-2058.606) -- 0:00:47 295000 -- (-2060.513) [-2061.983] (-2059.521) (-2060.644) * (-2059.266) (-2058.889) (-2060.087) [-2060.608] -- 0:00:47 Average standard deviation of split frequencies: 0.015423 295500 -- (-2060.225) (-2065.225) [-2059.681] (-2059.649) * (-2059.438) (-2059.293) [-2058.681] (-2063.379) -- 0:00:47 296000 -- (-2061.888) (-2060.382) [-2060.471] (-2059.183) * (-2060.498) (-2059.101) [-2058.649] (-2062.033) -- 0:00:47 296500 -- (-2059.823) [-2057.579] (-2059.688) (-2058.771) * (-2064.125) (-2067.021) [-2058.406] (-2059.038) -- 0:00:47 297000 -- (-2058.156) [-2057.984] (-2058.437) (-2059.711) * (-2060.581) (-2058.115) [-2058.749] (-2058.220) -- 0:00:47 297500 -- (-2061.919) [-2057.858] (-2058.220) (-2059.141) * (-2058.052) (-2058.091) (-2062.249) [-2060.255] -- 0:00:47 298000 -- (-2062.827) (-2060.457) (-2058.710) [-2060.926] * (-2058.414) [-2057.753] (-2058.953) (-2060.022) -- 0:00:47 298500 -- [-2058.355] (-2061.622) (-2058.879) (-2060.359) * (-2058.413) [-2059.035] (-2061.061) (-2061.870) -- 0:00:47 299000 -- (-2061.460) (-2061.048) [-2059.070] (-2062.948) * (-2062.005) (-2066.382) [-2061.306] (-2061.460) -- 0:00:46 299500 -- (-2061.089) (-2059.315) [-2058.754] (-2060.876) * (-2059.130) [-2062.228] (-2057.916) (-2058.674) -- 0:00:46 300000 -- (-2060.939) (-2065.455) (-2058.707) [-2061.203] * (-2057.796) (-2060.016) [-2058.375] (-2062.067) -- 0:00:46 Average standard deviation of split frequencies: 0.016091 300500 -- (-2062.138) (-2063.743) [-2059.621] (-2059.800) * (-2060.307) (-2064.446) (-2057.866) [-2058.567] -- 0:00:46 301000 -- (-2059.676) (-2063.339) [-2059.234] (-2059.146) * (-2062.640) (-2060.450) (-2058.131) [-2059.869] -- 0:00:46 301500 -- (-2062.403) [-2060.116] (-2063.969) (-2058.782) * (-2063.639) [-2059.359] (-2057.755) (-2058.627) -- 0:00:46 302000 -- (-2061.307) [-2057.557] (-2064.961) (-2061.043) * (-2057.665) (-2060.277) [-2057.821] (-2058.517) -- 0:00:46 302500 -- [-2058.372] (-2058.300) (-2061.149) (-2060.667) * (-2059.571) (-2059.287) (-2057.824) [-2058.732] -- 0:00:46 303000 -- (-2058.711) [-2058.299] (-2061.476) (-2060.867) * [-2058.747] (-2061.084) (-2057.464) (-2062.847) -- 0:00:46 303500 -- [-2058.708] (-2058.747) (-2059.805) (-2062.053) * (-2058.710) (-2062.103) [-2057.623] (-2061.854) -- 0:00:45 304000 -- (-2059.212) (-2059.991) [-2058.128] (-2058.854) * [-2059.686] (-2061.009) (-2057.765) (-2064.273) -- 0:00:45 304500 -- [-2060.560] (-2059.041) (-2060.743) (-2059.163) * (-2060.872) [-2059.115] (-2061.184) (-2062.447) -- 0:00:45 305000 -- (-2059.768) (-2058.729) [-2060.735] (-2058.708) * (-2063.574) (-2059.830) (-2059.460) [-2060.515] -- 0:00:45 Average standard deviation of split frequencies: 0.015713 305500 -- (-2059.449) (-2058.772) (-2063.126) [-2057.472] * (-2065.658) [-2057.820] (-2059.816) (-2059.952) -- 0:00:45 306000 -- (-2058.023) (-2058.562) (-2063.882) [-2058.964] * (-2059.825) (-2058.772) (-2060.633) [-2062.711] -- 0:00:45 306500 -- (-2057.617) (-2060.063) (-2058.780) [-2060.963] * (-2060.191) [-2058.602] (-2059.917) (-2061.045) -- 0:00:45 307000 -- [-2057.617] (-2064.088) (-2059.236) (-2058.218) * (-2066.096) [-2058.267] (-2064.612) (-2060.651) -- 0:00:45 307500 -- (-2058.231) (-2062.178) [-2058.174] (-2060.400) * (-2063.898) (-2058.490) (-2062.603) [-2059.885] -- 0:00:45 308000 -- (-2062.313) (-2062.103) (-2058.502) [-2058.661] * (-2058.803) (-2059.199) (-2061.047) [-2059.231] -- 0:00:44 308500 -- [-2059.051] (-2062.349) (-2058.251) (-2060.494) * [-2058.882] (-2061.598) (-2058.926) (-2060.102) -- 0:00:47 309000 -- (-2058.954) (-2059.244) [-2058.079] (-2059.275) * (-2057.900) [-2061.789] (-2060.627) (-2059.797) -- 0:00:46 309500 -- (-2061.027) [-2060.602] (-2058.989) (-2059.275) * (-2058.741) (-2059.333) [-2059.859] (-2059.522) -- 0:00:46 310000 -- [-2061.953] (-2062.662) (-2057.898) (-2058.792) * [-2060.054] (-2061.743) (-2058.611) (-2060.940) -- 0:00:46 Average standard deviation of split frequencies: 0.014136 310500 -- (-2058.813) (-2060.994) [-2058.637] (-2060.313) * (-2063.156) [-2059.585] (-2061.700) (-2060.216) -- 0:00:46 311000 -- [-2059.086] (-2060.725) (-2061.394) (-2058.294) * (-2062.314) (-2058.547) [-2059.844] (-2058.856) -- 0:00:46 311500 -- (-2060.100) [-2060.155] (-2062.385) (-2059.989) * [-2060.204] (-2062.547) (-2059.879) (-2060.030) -- 0:00:46 312000 -- (-2058.828) (-2059.256) (-2060.226) [-2058.820] * [-2060.036] (-2064.825) (-2059.514) (-2059.854) -- 0:00:46 312500 -- (-2059.672) [-2060.892] (-2058.300) (-2058.820) * (-2062.740) (-2061.040) (-2060.623) [-2058.493] -- 0:00:46 313000 -- [-2059.223] (-2058.131) (-2059.455) (-2058.712) * (-2059.614) (-2057.843) [-2059.369] (-2060.754) -- 0:00:46 313500 -- [-2059.479] (-2058.045) (-2059.619) (-2058.874) * (-2060.965) (-2058.370) [-2060.168] (-2060.139) -- 0:00:45 314000 -- (-2060.870) (-2061.149) [-2058.601] (-2058.819) * (-2061.624) (-2058.832) (-2060.899) [-2063.385] -- 0:00:45 314500 -- [-2059.349] (-2060.814) (-2059.681) (-2058.371) * (-2058.187) (-2061.448) (-2059.567) [-2061.548] -- 0:00:45 315000 -- (-2060.661) [-2059.438] (-2059.401) (-2058.371) * (-2058.442) (-2060.351) (-2062.112) [-2059.791] -- 0:00:45 Average standard deviation of split frequencies: 0.013426 315500 -- (-2062.831) (-2058.909) [-2060.758] (-2058.669) * [-2058.098] (-2059.562) (-2061.336) (-2057.588) -- 0:00:45 316000 -- (-2062.988) (-2058.519) [-2058.742] (-2057.777) * [-2058.464] (-2062.226) (-2059.641) (-2060.686) -- 0:00:45 316500 -- (-2061.659) (-2060.468) (-2059.862) [-2058.166] * (-2057.713) (-2060.639) [-2062.475] (-2059.415) -- 0:00:45 317000 -- (-2061.586) (-2061.863) (-2062.775) [-2058.649] * (-2057.713) (-2058.452) (-2059.921) [-2060.033] -- 0:00:45 317500 -- (-2060.339) (-2060.558) (-2058.363) [-2057.899] * (-2058.276) (-2058.304) (-2060.402) [-2061.629] -- 0:00:45 318000 -- (-2059.347) [-2062.361] (-2058.308) (-2057.899) * [-2059.477] (-2058.754) (-2062.177) (-2057.849) -- 0:00:45 318500 -- (-2058.562) (-2061.495) [-2062.244] (-2057.597) * (-2057.870) [-2057.946] (-2062.023) (-2062.512) -- 0:00:44 319000 -- (-2060.572) (-2059.292) (-2070.443) [-2057.709] * (-2061.602) (-2057.742) [-2058.277] (-2060.078) -- 0:00:44 319500 -- (-2066.243) [-2059.394] (-2064.156) (-2060.147) * [-2061.308] (-2061.075) (-2057.731) (-2060.331) -- 0:00:44 320000 -- [-2061.838] (-2057.744) (-2062.933) (-2060.673) * (-2059.166) [-2060.186] (-2057.509) (-2061.448) -- 0:00:44 Average standard deviation of split frequencies: 0.012921 320500 -- (-2060.913) (-2057.639) [-2059.687] (-2060.802) * (-2059.162) (-2058.629) (-2058.556) [-2059.439] -- 0:00:44 321000 -- [-2060.471] (-2057.153) (-2057.938) (-2059.944) * [-2060.985] (-2061.292) (-2059.069) (-2061.846) -- 0:00:44 321500 -- [-2058.284] (-2058.364) (-2060.795) (-2060.931) * (-2058.664) (-2058.936) (-2058.952) [-2058.403] -- 0:00:44 322000 -- (-2057.934) (-2059.726) [-2060.828] (-2064.149) * (-2060.159) (-2058.919) (-2059.088) [-2059.912] -- 0:00:44 322500 -- [-2057.802] (-2061.884) (-2062.434) (-2061.292) * (-2063.796) [-2058.709] (-2059.844) (-2060.434) -- 0:00:44 323000 -- [-2058.844] (-2061.605) (-2062.349) (-2059.241) * (-2058.905) (-2058.438) (-2065.433) [-2060.235] -- 0:00:44 323500 -- (-2059.357) [-2060.870] (-2062.642) (-2061.853) * [-2061.334] (-2060.811) (-2068.459) (-2058.583) -- 0:00:46 324000 -- (-2062.852) [-2062.584] (-2062.686) (-2057.611) * (-2060.472) [-2059.795] (-2058.186) (-2058.595) -- 0:00:45 324500 -- (-2059.542) (-2062.623) (-2060.863) [-2057.885] * (-2058.933) (-2058.441) [-2057.212] (-2058.895) -- 0:00:45 325000 -- [-2059.609] (-2060.907) (-2058.874) (-2057.833) * [-2060.074] (-2058.420) (-2057.366) (-2059.673) -- 0:00:45 Average standard deviation of split frequencies: 0.012862 325500 -- [-2058.869] (-2059.169) (-2059.941) (-2059.968) * [-2059.925] (-2058.974) (-2057.298) (-2060.054) -- 0:00:45 326000 -- (-2059.709) [-2057.914] (-2062.088) (-2059.438) * [-2057.749] (-2058.238) (-2057.271) (-2059.865) -- 0:00:45 326500 -- (-2059.369) (-2057.993) (-2061.951) [-2057.582] * (-2058.203) (-2059.344) (-2057.447) [-2058.643] -- 0:00:45 327000 -- (-2058.810) (-2057.978) [-2059.268] (-2059.161) * [-2057.690] (-2058.642) (-2058.456) (-2058.802) -- 0:00:45 327500 -- [-2058.322] (-2057.867) (-2058.815) (-2057.999) * [-2060.600] (-2058.637) (-2060.977) (-2058.685) -- 0:00:45 328000 -- (-2057.596) [-2061.341] (-2062.015) (-2058.007) * (-2060.517) [-2059.923] (-2058.110) (-2059.306) -- 0:00:45 328500 -- (-2057.894) [-2060.557] (-2057.896) (-2061.200) * (-2063.038) (-2059.124) (-2058.744) [-2059.229] -- 0:00:44 329000 -- (-2059.973) [-2059.827] (-2057.782) (-2059.285) * (-2059.896) [-2060.691] (-2061.245) (-2059.516) -- 0:00:44 329500 -- (-2059.707) [-2058.278] (-2057.928) (-2058.254) * [-2060.180] (-2061.358) (-2060.341) (-2059.505) -- 0:00:44 330000 -- (-2059.859) (-2057.933) [-2059.356] (-2059.386) * (-2058.516) [-2059.820] (-2058.231) (-2058.685) -- 0:00:44 Average standard deviation of split frequencies: 0.011930 330500 -- (-2061.804) (-2058.301) (-2060.901) [-2058.511] * (-2059.453) (-2057.933) [-2058.359] (-2058.225) -- 0:00:44 331000 -- (-2060.709) (-2058.878) [-2061.059] (-2058.090) * (-2058.893) (-2058.692) [-2060.661] (-2058.859) -- 0:00:44 331500 -- (-2059.395) (-2059.402) (-2060.911) [-2058.363] * [-2061.282] (-2060.680) (-2059.471) (-2060.363) -- 0:00:44 332000 -- (-2059.541) (-2061.683) (-2061.034) [-2062.563] * (-2059.240) (-2057.758) [-2060.171] (-2058.303) -- 0:00:44 332500 -- [-2059.202] (-2060.412) (-2059.142) (-2064.380) * [-2059.115] (-2062.038) (-2058.370) (-2058.148) -- 0:00:44 333000 -- (-2059.812) [-2059.550] (-2061.466) (-2060.794) * (-2058.773) (-2060.222) (-2061.858) [-2058.521] -- 0:00:44 333500 -- (-2059.038) (-2059.452) [-2061.496] (-2062.467) * [-2057.890] (-2057.587) (-2062.021) (-2057.529) -- 0:00:43 334000 -- (-2059.010) (-2058.625) (-2060.199) [-2057.758] * (-2058.127) [-2059.757] (-2068.118) (-2058.224) -- 0:00:43 334500 -- [-2061.402] (-2059.588) (-2060.617) (-2057.758) * (-2059.423) [-2057.778] (-2060.621) (-2057.643) -- 0:00:43 335000 -- [-2062.959] (-2065.308) (-2058.748) (-2058.257) * [-2060.577] (-2057.672) (-2058.071) (-2057.647) -- 0:00:43 Average standard deviation of split frequencies: 0.011076 335500 -- [-2058.972] (-2060.456) (-2059.344) (-2061.592) * (-2058.259) [-2059.212] (-2058.365) (-2057.776) -- 0:00:43 336000 -- (-2058.041) [-2058.076] (-2062.662) (-2061.056) * [-2058.878] (-2057.487) (-2059.789) (-2059.851) -- 0:00:43 336500 -- (-2058.330) (-2058.804) (-2062.246) [-2061.454] * (-2057.805) (-2057.487) (-2060.873) [-2058.090] -- 0:00:43 337000 -- (-2058.195) (-2065.397) [-2059.389] (-2057.863) * (-2062.699) (-2058.003) [-2061.401] (-2058.303) -- 0:00:43 337500 -- (-2059.967) (-2058.662) [-2059.090] (-2058.271) * (-2057.346) (-2061.522) [-2059.651] (-2058.639) -- 0:00:43 338000 -- (-2063.273) (-2060.745) [-2059.861] (-2058.426) * (-2057.377) (-2059.225) (-2060.260) [-2059.100] -- 0:00:43 338500 -- [-2059.618] (-2061.035) (-2059.764) (-2062.315) * (-2057.964) [-2062.814] (-2059.360) (-2060.302) -- 0:00:44 339000 -- (-2058.869) (-2060.780) [-2060.097] (-2058.921) * (-2058.955) [-2059.924] (-2059.882) (-2061.616) -- 0:00:44 339500 -- (-2058.418) [-2060.015] (-2061.527) (-2058.044) * (-2057.959) [-2057.714] (-2060.890) (-2063.185) -- 0:00:44 340000 -- (-2058.327) [-2060.919] (-2059.911) (-2059.864) * [-2062.740] (-2058.182) (-2062.211) (-2060.099) -- 0:00:44 Average standard deviation of split frequencies: 0.011608 340500 -- (-2057.961) (-2058.250) (-2058.870) [-2057.931] * (-2064.908) (-2058.114) (-2058.756) [-2059.061] -- 0:00:44 341000 -- (-2057.948) (-2060.817) (-2062.500) [-2058.105] * (-2059.130) (-2058.063) [-2057.568] (-2061.867) -- 0:00:44 341500 -- [-2059.263] (-2058.751) (-2061.651) (-2060.355) * (-2058.572) (-2061.135) (-2058.844) [-2061.420] -- 0:00:44 342000 -- (-2061.261) (-2060.250) (-2059.202) [-2059.867] * (-2058.154) (-2059.881) (-2059.230) [-2061.984] -- 0:00:44 342500 -- (-2061.714) [-2060.107] (-2059.067) (-2060.834) * (-2057.588) (-2058.187) (-2060.131) [-2063.094] -- 0:00:44 343000 -- (-2059.539) [-2059.794] (-2059.010) (-2061.032) * [-2058.265] (-2061.236) (-2060.660) (-2061.309) -- 0:00:44 343500 -- (-2064.385) [-2062.505] (-2058.569) (-2060.734) * (-2060.321) (-2060.048) (-2061.004) [-2060.419] -- 0:00:43 344000 -- (-2062.316) [-2059.977] (-2060.004) (-2059.202) * [-2059.798] (-2059.726) (-2060.753) (-2060.704) -- 0:00:43 344500 -- (-2060.565) (-2061.942) (-2059.228) [-2060.328] * (-2058.308) (-2059.644) [-2061.175] (-2059.418) -- 0:00:43 345000 -- (-2060.549) [-2062.244] (-2057.833) (-2061.637) * (-2058.634) (-2059.861) [-2060.555] (-2063.016) -- 0:00:43 Average standard deviation of split frequencies: 0.011688 345500 -- [-2058.860] (-2060.865) (-2057.409) (-2061.851) * [-2060.472] (-2060.195) (-2060.285) (-2058.963) -- 0:00:43 346000 -- (-2059.146) [-2060.950] (-2062.852) (-2062.065) * [-2058.423] (-2058.550) (-2059.966) (-2061.404) -- 0:00:43 346500 -- (-2060.563) (-2062.642) (-2060.364) [-2059.708] * (-2059.079) (-2059.746) [-2060.321] (-2060.101) -- 0:00:43 347000 -- (-2059.971) (-2059.336) (-2060.824) [-2059.179] * (-2060.092) (-2058.945) [-2060.335] (-2058.121) -- 0:00:43 347500 -- (-2060.545) (-2059.929) (-2061.706) [-2062.886] * [-2059.241] (-2058.791) (-2059.783) (-2057.724) -- 0:00:43 348000 -- [-2058.352] (-2060.188) (-2061.809) (-2058.246) * (-2058.379) [-2058.696] (-2059.867) (-2057.724) -- 0:00:43 348500 -- (-2058.706) [-2059.620] (-2063.556) (-2059.376) * (-2059.707) (-2058.292) (-2060.913) [-2057.724] -- 0:00:42 349000 -- (-2059.145) (-2058.282) [-2060.403] (-2059.351) * [-2058.301] (-2062.045) (-2062.342) (-2060.792) -- 0:00:42 349500 -- (-2062.609) (-2058.723) [-2059.348] (-2059.672) * [-2059.224] (-2059.361) (-2059.486) (-2058.327) -- 0:00:42 350000 -- (-2061.188) [-2064.097] (-2059.022) (-2061.640) * (-2058.065) (-2059.468) (-2059.213) [-2061.617] -- 0:00:42 Average standard deviation of split frequencies: 0.010829 350500 -- (-2065.877) (-2060.637) (-2060.667) [-2059.609] * (-2059.295) [-2060.404] (-2058.178) (-2058.843) -- 0:00:42 351000 -- (-2060.954) (-2060.602) (-2058.474) [-2061.053] * (-2059.323) [-2059.493] (-2059.328) (-2059.340) -- 0:00:42 351500 -- [-2058.302] (-2058.898) (-2058.116) (-2059.638) * (-2059.792) (-2058.219) [-2059.389] (-2059.858) -- 0:00:42 352000 -- (-2061.184) (-2058.690) [-2059.855] (-2059.505) * (-2060.191) (-2057.642) (-2059.691) [-2059.325] -- 0:00:42 352500 -- (-2061.511) [-2058.542] (-2059.812) (-2058.659) * (-2059.975) [-2057.662] (-2059.102) (-2063.743) -- 0:00:42 353000 -- (-2060.869) (-2059.290) [-2059.039] (-2062.714) * [-2061.846] (-2057.966) (-2058.742) (-2060.435) -- 0:00:43 353500 -- (-2061.342) [-2058.650] (-2059.506) (-2059.790) * (-2062.680) [-2058.841] (-2059.515) (-2058.015) -- 0:00:43 354000 -- (-2062.223) [-2058.354] (-2057.799) (-2059.823) * [-2059.709] (-2057.865) (-2061.474) (-2066.401) -- 0:00:43 354500 -- [-2058.523] (-2058.872) (-2057.764) (-2061.732) * (-2064.229) [-2058.393] (-2058.345) (-2059.961) -- 0:00:43 355000 -- [-2060.053] (-2059.400) (-2059.730) (-2064.234) * (-2062.793) [-2064.510] (-2057.852) (-2058.534) -- 0:00:43 Average standard deviation of split frequencies: 0.011255 355500 -- (-2061.319) (-2062.029) [-2059.730] (-2061.558) * [-2060.215] (-2065.995) (-2061.763) (-2059.130) -- 0:00:43 356000 -- [-2058.006] (-2061.357) (-2058.587) (-2061.111) * (-2062.412) [-2058.906] (-2059.898) (-2059.059) -- 0:00:43 356500 -- [-2058.372] (-2061.140) (-2061.807) (-2062.617) * (-2064.312) (-2059.212) [-2059.079] (-2058.696) -- 0:00:43 357000 -- (-2059.746) (-2061.211) [-2057.334] (-2060.147) * [-2060.968] (-2058.088) (-2061.309) (-2058.848) -- 0:00:43 357500 -- (-2059.674) [-2061.584] (-2058.810) (-2060.934) * (-2060.308) (-2059.677) [-2059.842] (-2058.941) -- 0:00:43 358000 -- (-2060.453) (-2062.358) (-2059.068) [-2059.783] * (-2066.528) (-2058.678) [-2062.984] (-2060.250) -- 0:00:43 358500 -- (-2062.825) (-2060.556) (-2059.264) [-2061.321] * (-2058.424) (-2059.857) [-2060.599] (-2060.399) -- 0:00:42 359000 -- (-2058.291) (-2061.891) (-2060.236) [-2059.448] * (-2060.958) (-2058.232) [-2064.726] (-2060.475) -- 0:00:42 359500 -- (-2060.464) (-2060.151) [-2062.011] (-2058.688) * (-2061.149) (-2058.197) [-2063.985] (-2062.793) -- 0:00:42 360000 -- (-2062.537) [-2061.261] (-2061.871) (-2060.553) * (-2060.619) [-2058.665] (-2059.838) (-2063.617) -- 0:00:42 Average standard deviation of split frequencies: 0.010674 360500 -- [-2059.690] (-2061.601) (-2062.763) (-2058.535) * (-2061.338) (-2057.803) [-2060.280] (-2060.744) -- 0:00:42 361000 -- (-2059.695) (-2062.515) [-2058.606] (-2061.040) * (-2066.525) (-2057.828) (-2057.925) [-2063.264] -- 0:00:42 361500 -- (-2058.672) (-2063.029) (-2060.314) [-2062.503] * (-2059.748) (-2062.238) (-2060.009) [-2059.711] -- 0:00:42 362000 -- (-2058.110) (-2062.407) [-2062.509] (-2057.852) * (-2057.815) [-2061.428] (-2061.065) (-2059.686) -- 0:00:42 362500 -- (-2057.813) (-2061.320) (-2058.581) [-2058.925] * [-2057.988] (-2059.628) (-2059.463) (-2059.441) -- 0:00:42 363000 -- [-2058.105] (-2061.619) (-2060.302) (-2059.066) * [-2061.361] (-2057.851) (-2061.618) (-2062.204) -- 0:00:42 363500 -- (-2060.418) (-2060.814) (-2060.300) [-2060.521] * [-2064.089] (-2058.804) (-2060.832) (-2058.805) -- 0:00:42 364000 -- [-2058.508] (-2060.863) (-2058.138) (-2059.305) * (-2060.865) [-2058.385] (-2065.091) (-2058.484) -- 0:00:41 364500 -- (-2058.443) (-2059.481) (-2058.361) [-2058.434] * (-2061.645) [-2060.033] (-2060.923) (-2059.230) -- 0:00:41 365000 -- (-2059.010) [-2057.848] (-2058.395) (-2058.378) * (-2060.260) [-2061.533] (-2059.905) (-2058.609) -- 0:00:41 Average standard deviation of split frequencies: 0.010033 365500 -- [-2064.766] (-2058.592) (-2060.350) (-2059.134) * (-2065.050) (-2059.033) [-2058.518] (-2058.877) -- 0:00:41 366000 -- (-2058.903) [-2058.847] (-2058.617) (-2058.666) * [-2060.621] (-2060.259) (-2058.931) (-2058.985) -- 0:00:41 366500 -- [-2058.940] (-2062.123) (-2059.054) (-2058.876) * (-2058.830) (-2058.906) (-2059.542) [-2058.778] -- 0:00:41 367000 -- (-2059.028) (-2062.090) [-2058.725] (-2058.748) * (-2059.318) (-2059.023) (-2059.387) [-2059.623] -- 0:00:41 367500 -- (-2059.030) (-2060.915) (-2060.894) [-2064.001] * (-2060.262) (-2059.145) [-2058.515] (-2062.000) -- 0:00:43 368000 -- (-2058.059) [-2062.496] (-2061.466) (-2062.652) * (-2061.065) (-2059.647) [-2059.292] (-2060.386) -- 0:00:42 368500 -- [-2057.443] (-2061.293) (-2060.438) (-2058.515) * (-2062.243) (-2059.074) [-2058.993] (-2060.333) -- 0:00:42 369000 -- (-2060.318) (-2061.427) (-2063.239) [-2057.743] * [-2058.264] (-2057.937) (-2062.026) (-2060.018) -- 0:00:42 369500 -- (-2058.676) [-2058.724] (-2058.907) (-2059.967) * (-2061.039) (-2059.140) [-2060.109] (-2060.536) -- 0:00:42 370000 -- (-2058.836) (-2058.596) [-2059.184] (-2057.696) * (-2059.208) (-2061.777) (-2063.997) [-2061.051] -- 0:00:42 Average standard deviation of split frequencies: 0.009468 370500 -- [-2058.808] (-2060.197) (-2058.278) (-2058.345) * (-2059.208) [-2061.749] (-2061.179) (-2060.449) -- 0:00:42 371000 -- (-2060.810) (-2058.474) (-2058.292) [-2058.523] * (-2058.323) (-2057.697) [-2059.989] (-2060.179) -- 0:00:42 371500 -- (-2063.100) (-2058.809) [-2060.721] (-2060.464) * (-2058.384) [-2057.696] (-2058.868) (-2060.489) -- 0:00:42 372000 -- (-2064.446) (-2063.797) [-2060.599] (-2061.041) * [-2057.645] (-2060.278) (-2058.553) (-2063.727) -- 0:00:42 372500 -- (-2062.429) (-2057.799) (-2059.743) [-2058.675] * (-2058.701) [-2060.064] (-2058.474) (-2058.991) -- 0:00:42 373000 -- (-2060.282) [-2058.455] (-2062.971) (-2058.444) * [-2059.257] (-2060.933) (-2058.505) (-2059.903) -- 0:00:42 373500 -- (-2058.395) (-2058.425) (-2058.474) [-2058.558] * (-2059.971) [-2057.870] (-2059.565) (-2061.834) -- 0:00:41 374000 -- (-2059.216) [-2058.816] (-2059.877) (-2060.294) * [-2058.350] (-2057.663) (-2059.405) (-2061.657) -- 0:00:41 374500 -- (-2057.328) (-2059.180) [-2061.207] (-2058.169) * (-2059.250) (-2057.771) (-2061.185) [-2059.713] -- 0:00:41 375000 -- (-2057.624) (-2058.707) [-2059.317] (-2060.612) * (-2059.450) [-2059.115] (-2061.226) (-2060.375) -- 0:00:41 Average standard deviation of split frequencies: 0.009634 375500 -- (-2058.174) (-2058.762) [-2060.209] (-2060.535) * (-2059.466) (-2058.447) (-2064.909) [-2060.968] -- 0:00:41 376000 -- [-2058.173] (-2060.828) (-2057.709) (-2059.334) * (-2058.204) [-2059.501] (-2057.770) (-2062.187) -- 0:00:41 376500 -- (-2061.477) (-2059.856) (-2057.562) [-2060.786] * (-2060.969) (-2061.661) (-2057.366) [-2058.322] -- 0:00:41 377000 -- [-2059.432] (-2057.897) (-2063.085) (-2059.337) * (-2064.013) (-2063.604) (-2059.472) [-2059.266] -- 0:00:41 377500 -- (-2059.432) (-2058.768) (-2061.290) [-2058.098] * (-2066.363) (-2060.313) [-2061.119] (-2061.741) -- 0:00:41 378000 -- [-2058.956] (-2062.607) (-2066.772) (-2058.027) * (-2061.452) [-2058.731] (-2061.333) (-2066.040) -- 0:00:41 378500 -- (-2057.752) (-2061.763) [-2058.222] (-2058.572) * (-2059.125) [-2058.229] (-2061.869) (-2063.886) -- 0:00:41 379000 -- [-2057.884] (-2060.023) (-2061.709) (-2061.417) * [-2058.650] (-2058.055) (-2059.178) (-2067.485) -- 0:00:40 379500 -- (-2057.976) [-2059.325] (-2060.280) (-2063.926) * [-2059.847] (-2059.194) (-2060.954) (-2061.512) -- 0:00:40 380000 -- (-2057.858) (-2059.147) [-2063.309] (-2061.215) * (-2058.983) [-2058.480] (-2058.897) (-2061.846) -- 0:00:40 Average standard deviation of split frequencies: 0.009711 380500 -- (-2061.161) (-2065.349) [-2063.980] (-2060.762) * (-2059.041) (-2059.277) (-2058.897) [-2062.257] -- 0:00:40 381000 -- (-2060.856) [-2059.330] (-2060.480) (-2061.191) * (-2059.601) (-2061.938) (-2057.985) [-2062.228] -- 0:00:40 381500 -- (-2061.143) (-2060.499) (-2059.949) [-2060.193] * [-2061.982] (-2059.506) (-2058.151) (-2063.581) -- 0:00:40 382000 -- [-2061.393] (-2061.135) (-2059.212) (-2061.064) * [-2061.443] (-2062.731) (-2058.072) (-2061.802) -- 0:00:42 382500 -- [-2059.942] (-2058.801) (-2059.979) (-2060.518) * (-2061.196) (-2057.707) [-2059.775] (-2061.708) -- 0:00:41 383000 -- (-2062.986) (-2057.344) [-2059.548] (-2061.695) * (-2061.680) [-2059.618] (-2059.385) (-2059.139) -- 0:00:41 383500 -- (-2062.287) [-2057.479] (-2061.691) (-2061.508) * (-2060.983) [-2059.000] (-2060.937) (-2060.044) -- 0:00:41 384000 -- (-2065.984) (-2057.792) [-2060.328] (-2061.554) * (-2061.076) (-2057.525) (-2060.945) [-2061.704] -- 0:00:41 384500 -- (-2062.793) (-2057.774) [-2058.535] (-2063.625) * (-2061.138) [-2057.519] (-2058.952) (-2064.190) -- 0:00:41 385000 -- [-2061.488] (-2057.728) (-2060.399) (-2058.636) * (-2062.532) [-2057.477] (-2059.007) (-2059.095) -- 0:00:41 Average standard deviation of split frequencies: 0.009899 385500 -- [-2057.949] (-2060.334) (-2064.915) (-2060.743) * (-2062.615) [-2059.132] (-2059.101) (-2058.108) -- 0:00:41 386000 -- (-2058.584) [-2061.076] (-2059.487) (-2061.510) * [-2062.881] (-2058.909) (-2062.470) (-2059.045) -- 0:00:41 386500 -- (-2058.360) [-2062.382] (-2059.055) (-2058.328) * (-2059.660) [-2060.194] (-2058.892) (-2058.542) -- 0:00:41 387000 -- (-2060.593) (-2062.728) (-2058.544) [-2057.628] * (-2066.096) (-2060.220) [-2061.661] (-2059.075) -- 0:00:41 387500 -- (-2059.046) (-2062.015) [-2058.367] (-2057.818) * [-2061.995] (-2058.857) (-2057.641) (-2061.762) -- 0:00:41 388000 -- [-2060.541] (-2061.433) (-2058.367) (-2059.500) * (-2060.015) (-2062.967) (-2057.785) [-2059.383] -- 0:00:41 388500 -- (-2061.286) [-2058.028] (-2061.902) (-2057.482) * (-2059.558) (-2059.990) (-2058.291) [-2058.186] -- 0:00:40 389000 -- [-2060.492] (-2058.693) (-2060.907) (-2057.488) * (-2061.332) [-2059.592] (-2060.212) (-2058.981) -- 0:00:40 389500 -- (-2063.338) [-2059.183] (-2058.999) (-2059.104) * (-2059.185) [-2061.070] (-2061.482) (-2059.012) -- 0:00:40 390000 -- (-2067.293) (-2060.235) (-2057.834) [-2058.783] * (-2059.166) [-2059.238] (-2061.875) (-2057.936) -- 0:00:40 Average standard deviation of split frequencies: 0.011463 390500 -- (-2057.329) (-2061.681) [-2061.111] (-2065.433) * [-2058.342] (-2059.052) (-2058.561) (-2057.936) -- 0:00:40 391000 -- (-2057.692) (-2059.625) (-2058.435) [-2063.802] * (-2060.750) [-2063.467] (-2058.227) (-2057.731) -- 0:00:40 391500