--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 16:21:06 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0229/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1257.49 -1261.37 2 -1257.53 -1261.02 -------------------------------------- TOTAL -1257.51 -1261.21 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.900643 0.092477 0.364200 1.515012 0.864920 1488.72 1494.86 1.000 r(A<->C){all} 0.159936 0.020284 0.000005 0.438621 0.120621 216.56 240.37 1.000 r(A<->G){all} 0.161085 0.018992 0.000014 0.449127 0.123617 200.18 202.11 1.000 r(A<->T){all} 0.174391 0.021459 0.000021 0.464138 0.136073 132.05 194.33 1.000 r(C<->G){all} 0.169169 0.021031 0.000026 0.466477 0.127136 206.81 272.42 1.013 r(C<->T){all} 0.171707 0.019187 0.000022 0.446871 0.138987 172.63 211.20 1.000 r(G<->T){all} 0.163713 0.018688 0.000118 0.435713 0.127275 168.40 284.62 1.003 pi(A){all} 0.166456 0.000151 0.142257 0.189022 0.165970 1388.49 1420.91 1.000 pi(C){all} 0.286262 0.000221 0.254973 0.313787 0.285727 1235.71 1283.16 1.000 pi(G){all} 0.328079 0.000241 0.296183 0.358233 0.328115 1155.72 1261.40 1.000 pi(T){all} 0.219203 0.000189 0.193255 0.245969 0.218903 1294.42 1314.50 1.000 alpha{1,2} 0.432838 0.234402 0.000223 1.392350 0.265475 1059.22 1170.10 1.000 alpha{3} 0.459893 0.246594 0.000259 1.469272 0.302824 1076.35 1212.07 1.000 pinvar{all} 0.998425 0.000003 0.995150 0.999999 0.998974 1326.28 1347.80 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1217.411641 Model 2: PositiveSelection -1217.411554 Model 0: one-ratio -1217.411512 Model 7: beta -1217.41172 Model 8: beta&w>1 -1217.411504 Model 0 vs 1 2.5800000003073364E-4 Model 2 vs 1 1.739999997880659E-4 Model 8 vs 7 4.320000002735469E-4
>C1 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C2 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C3 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C4 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C5 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C6 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=309 C1 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C2 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C3 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C4 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C5 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C6 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR ************************************************** C1 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C2 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C3 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C4 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C5 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C6 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT ************************************************** C1 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C2 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C3 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C4 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C5 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C6 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT ************************************************** C1 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C2 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C3 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C4 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C5 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C6 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE ************************************************** C1 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C2 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C3 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C4 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C5 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C6 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ ************************************************** C1 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C2 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C3 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C4 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C5 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C6 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP ************************************************** C1 YDVVEALAP C2 YDVVEALAP C3 YDVVEALAP C4 YDVVEALAP C5 YDVVEALAP C6 YDVVEALAP ********* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 309 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 309 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9270] Library Relaxation: Multi_proc [96] Relaxation Summary: [9270]--->[9270] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.509 Mb, Max= 30.872 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C2 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C3 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C4 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C5 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR C6 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR ************************************************** C1 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C2 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C3 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C4 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C5 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT C6 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT ************************************************** C1 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C2 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C3 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C4 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C5 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT C6 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT ************************************************** C1 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C2 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C3 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C4 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C5 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE C6 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE ************************************************** C1 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C2 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C3 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C4 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C5 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ C6 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ ************************************************** C1 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C2 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C3 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C4 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C5 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP C6 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP ************************************************** C1 YDVVEALAP C2 YDVVEALAP C3 YDVVEALAP C4 YDVVEALAP C5 YDVVEALAP C6 YDVVEALAP ********* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT C2 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT C3 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT C4 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT C5 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT C6 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT ************************************************** C1 CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG C2 CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG C3 CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG C4 CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG C5 CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG C6 CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG ************************************************** C1 TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG C2 TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG C3 TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG C4 TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG C5 TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG C6 TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG ************************************************** C1 TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA C2 TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA C3 TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA C4 TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA C5 TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA C6 TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA ************************************************** C1 GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG C2 GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG C3 GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG C4 GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG C5 GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG C6 GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG ************************************************** C1 GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT C2 GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT C3 GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT C4 GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT C5 GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT C6 GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT ************************************************** C1 TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG C2 TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG C3 TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG C4 TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG C5 TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG C6 TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG ************************************************** C1 TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG C2 TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG C3 TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG C4 TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG C5 TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG C6 TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ************************************************** C1 ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT C2 ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT C3 ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT C4 ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT C5 ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT C6 ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT ************************************************** C1 GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG C2 GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG C3 GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG C4 GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG C5 GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG C6 GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG ************************************************** C1 AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT C2 AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT C3 AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT C4 AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT C5 AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT C6 AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT ************************************************** C1 CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG C2 CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG C3 CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG C4 CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG C5 CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG C6 CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG ************************************************** C1 GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC C2 GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC C3 GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC C4 GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC C5 GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC C6 GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC ************************************************** C1 TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG C2 TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG C3 TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG C4 TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG C5 TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG C6 TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG ************************************************** C1 AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG C2 AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG C3 AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG C4 AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG C5 AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG C6 AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG ************************************************** C1 CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC C2 CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC C3 CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC C4 CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC C5 CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC C6 CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC ************************************************** C1 GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC C2 GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC C3 GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC C4 GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC C5 GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC C6 GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC ************************************************** C1 AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC C2 AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC C3 AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC C4 AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC C5 AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC C6 AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC ************************************************** C1 TACGATGTCGTCGAAGCGCTGGCGCCA C2 TACGATGTCGTCGAAGCGCTGGCGCCA C3 TACGATGTCGTCGAAGCGCTGGCGCCA C4 TACGATGTCGTCGAAGCGCTGGCGCCA C5 TACGATGTCGTCGAAGCGCTGGCGCCA C6 TACGATGTCGTCGAAGCGCTGGCGCCA *************************** >C1 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >C2 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >C3 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >C4 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >C5 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >C6 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >C1 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C2 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C3 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C4 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C5 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >C6 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 927 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579796388 Setting output file names to "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1362352105 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0577367638 Seed = 2097125644 Swapseed = 1579796388 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2074.670436 -- -24.965149 Chain 2 -- -2074.670436 -- -24.965149 Chain 3 -- -2074.670436 -- -24.965149 Chain 4 -- -2074.670316 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2074.670316 -- -24.965149 Chain 2 -- -2074.670436 -- -24.965149 Chain 3 -- -2074.670436 -- -24.965149 Chain 4 -- -2074.670316 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2074.670] (-2074.670) (-2074.670) (-2074.670) * [-2074.670] (-2074.670) (-2074.670) (-2074.670) 500 -- (-1278.002) (-1279.360) [-1267.784] (-1285.264) * (-1280.331) (-1273.812) (-1270.948) [-1266.173] -- 0:00:00 1000 -- (-1274.656) [-1270.359] (-1269.134) (-1282.504) * (-1274.848) [-1269.575] (-1274.594) (-1270.796) -- 0:00:00 1500 -- (-1278.167) (-1268.656) [-1263.934] (-1281.154) * [-1261.557] (-1265.645) (-1265.095) (-1269.434) -- 0:00:00 2000 -- (-1267.422) (-1273.834) [-1265.880] (-1272.937) * (-1269.877) [-1271.294] (-1265.010) (-1265.774) -- 0:00:00 2500 -- (-1270.032) (-1263.937) [-1264.727] (-1266.508) * (-1266.372) (-1263.784) [-1265.958] (-1260.556) -- 0:00:00 3000 -- (-1268.397) [-1269.605] (-1270.028) (-1266.317) * [-1262.968] (-1272.120) (-1272.057) (-1272.164) -- 0:00:00 3500 -- (-1268.486) (-1266.401) [-1265.188] (-1273.131) * (-1268.894) (-1267.714) (-1266.909) [-1268.284] -- 0:00:00 4000 -- (-1266.621) (-1269.461) (-1267.083) [-1266.348] * (-1267.894) [-1265.831] (-1263.831) (-1269.829) -- 0:00:00 4500 -- (-1266.115) (-1268.743) [-1263.913] (-1263.380) * (-1268.493) (-1271.690) (-1260.739) [-1267.705] -- 0:00:00 5000 -- (-1272.282) (-1269.044) [-1265.837] (-1268.406) * (-1259.479) (-1268.102) (-1261.761) [-1266.237] -- 0:00:00 Average standard deviation of split frequencies: 0.107513 5500 -- [-1268.778] (-1267.222) (-1264.604) (-1265.964) * (-1263.586) (-1275.408) [-1265.581] (-1274.673) -- 0:00:00 6000 -- (-1262.622) (-1268.931) (-1265.393) [-1264.252] * (-1269.833) (-1270.341) [-1267.708] (-1264.909) -- 0:00:00 6500 -- (-1268.243) [-1277.216] (-1265.530) (-1265.037) * (-1273.439) (-1263.494) (-1274.307) [-1264.200] -- 0:00:00 7000 -- [-1261.733] (-1263.962) (-1278.679) (-1262.449) * (-1263.691) [-1272.486] (-1278.898) (-1268.303) -- 0:00:00 7500 -- (-1265.234) [-1268.796] (-1264.377) (-1265.144) * [-1271.009] (-1268.624) (-1266.106) (-1267.340) -- 0:00:00 8000 -- [-1267.597] (-1268.142) (-1271.423) (-1268.288) * (-1273.826) (-1267.473) (-1280.957) [-1264.602] -- 0:00:00 8500 -- [-1260.365] (-1280.143) (-1269.368) (-1272.161) * [-1265.529] (-1265.535) (-1271.016) (-1270.330) -- 0:00:00 9000 -- (-1271.025) [-1266.837] (-1265.644) (-1267.561) * (-1265.603) (-1269.684) [-1261.891] (-1264.062) -- 0:00:00 9500 -- [-1266.358] (-1266.245) (-1264.287) (-1267.451) * (-1265.282) (-1271.998) [-1263.991] (-1271.821) -- 0:00:00 10000 -- (-1265.055) (-1267.598) (-1268.554) [-1270.886] * (-1279.242) (-1270.754) (-1279.475) [-1260.119] -- 0:01:39 Average standard deviation of split frequencies: 0.064082 10500 -- (-1267.541) (-1270.163) [-1268.167] (-1272.081) * (-1270.242) [-1263.577] (-1275.257) (-1270.959) -- 0:01:34 11000 -- (-1264.784) [-1265.780] (-1264.752) (-1277.984) * (-1272.039) [-1267.198] (-1268.131) (-1269.829) -- 0:01:29 11500 -- (-1266.469) [-1264.174] (-1267.487) (-1266.051) * (-1272.369) (-1272.153) [-1263.793] (-1270.540) -- 0:01:25 12000 -- [-1272.976] (-1267.035) (-1267.368) (-1267.212) * (-1265.934) (-1267.819) (-1275.475) [-1271.697] -- 0:01:22 12500 -- (-1266.513) (-1272.515) [-1266.881] (-1264.925) * (-1262.463) [-1262.290] (-1262.634) (-1265.518) -- 0:01:19 13000 -- (-1263.917) (-1263.142) (-1264.842) [-1260.869] * [-1267.617] (-1271.069) (-1273.465) (-1272.059) -- 0:01:15 13500 -- (-1267.244) (-1268.785) (-1265.201) [-1263.208] * (-1268.405) [-1263.295] (-1263.668) (-1278.873) -- 0:01:13 14000 -- (-1268.221) [-1269.469] (-1265.273) (-1270.269) * [-1259.807] (-1274.667) (-1266.015) (-1281.304) -- 0:01:10 14500 -- (-1270.340) (-1266.209) [-1264.320] (-1271.993) * (-1266.439) (-1269.250) [-1262.856] (-1256.115) -- 0:01:07 15000 -- (-1271.343) [-1266.065] (-1267.513) (-1261.912) * (-1269.109) [-1262.907] (-1264.903) (-1257.183) -- 0:01:05 Average standard deviation of split frequencies: 0.065473 15500 -- (-1269.587) [-1265.319] (-1267.229) (-1272.756) * (-1268.825) (-1266.262) [-1263.197] (-1256.939) -- 0:01:03 16000 -- (-1267.790) [-1267.476] (-1267.129) (-1263.087) * (-1265.186) (-1264.270) (-1275.223) [-1259.115] -- 0:01:01 16500 -- (-1266.087) [-1267.567] (-1273.878) (-1268.112) * (-1266.660) (-1272.355) [-1269.426] (-1257.160) -- 0:00:59 17000 -- (-1271.257) [-1263.880] (-1268.822) (-1262.545) * (-1268.205) [-1268.070] (-1263.193) (-1258.613) -- 0:00:57 17500 -- [-1261.442] (-1257.684) (-1265.441) (-1267.876) * (-1271.249) (-1264.991) (-1263.756) [-1256.770] -- 0:00:56 18000 -- (-1271.965) (-1257.768) [-1264.765] (-1272.479) * (-1269.456) [-1263.174] (-1264.415) (-1257.510) -- 0:00:54 18500 -- (-1268.468) (-1260.360) (-1268.515) [-1267.585] * (-1269.351) (-1274.994) (-1270.264) [-1260.362] -- 0:00:53 19000 -- (-1269.842) [-1259.771] (-1263.082) (-1268.492) * (-1267.528) (-1268.313) [-1266.435] (-1260.048) -- 0:00:51 19500 -- (-1273.271) (-1256.869) (-1267.534) [-1265.444] * (-1264.488) [-1268.808] (-1271.584) (-1257.813) -- 0:00:50 20000 -- (-1263.059) [-1257.120] (-1268.411) (-1267.443) * [-1262.199] (-1265.864) (-1265.194) (-1260.731) -- 0:00:49 Average standard deviation of split frequencies: 0.048471 20500 -- (-1272.016) [-1256.376] (-1266.445) (-1269.739) * (-1278.309) [-1266.962] (-1269.139) (-1258.126) -- 0:00:47 21000 -- [-1273.852] (-1256.385) (-1271.164) (-1267.990) * (-1265.069) (-1276.392) [-1265.348] (-1261.008) -- 0:00:46 21500 -- (-1267.075) [-1257.808] (-1266.393) (-1264.580) * (-1260.907) (-1268.921) [-1264.008] (-1258.578) -- 0:00:45 22000 -- (-1279.051) (-1256.594) [-1264.364] (-1277.468) * (-1259.164) [-1264.910] (-1262.321) (-1258.663) -- 0:00:44 22500 -- (-1264.113) (-1258.307) (-1268.595) [-1266.016] * (-1256.606) (-1267.678) [-1264.345] (-1259.788) -- 0:00:43 23000 -- [-1265.663] (-1256.278) (-1268.674) (-1267.936) * (-1260.090) (-1269.226) [-1262.596] (-1260.542) -- 0:00:42 23500 -- (-1272.339) [-1256.278] (-1266.650) (-1269.297) * (-1260.655) (-1270.127) [-1263.790] (-1258.531) -- 0:00:41 24000 -- (-1266.808) (-1256.546) [-1265.817] (-1278.717) * (-1260.121) [-1266.274] (-1264.573) (-1258.478) -- 0:00:40 24500 -- (-1267.416) [-1256.524] (-1267.802) (-1269.753) * (-1259.349) [-1273.638] (-1266.022) (-1258.051) -- 0:00:39 25000 -- (-1266.537) [-1256.621] (-1279.027) (-1270.325) * (-1259.584) (-1262.982) (-1268.216) [-1257.242] -- 0:01:18 Average standard deviation of split frequencies: 0.040579 25500 -- (-1271.862) (-1258.223) (-1267.293) [-1267.787] * [-1259.655] (-1273.433) (-1274.540) (-1256.848) -- 0:01:16 26000 -- (-1268.343) (-1257.404) (-1269.758) [-1265.190] * (-1261.679) (-1270.332) [-1266.214] (-1256.743) -- 0:01:14 26500 -- (-1281.135) [-1257.857] (-1270.403) (-1273.648) * (-1263.521) [-1263.297] (-1274.031) (-1257.064) -- 0:01:13 27000 -- (-1273.716) (-1256.442) [-1265.249] (-1262.993) * (-1263.183) (-1270.818) [-1264.314] (-1265.431) -- 0:01:12 27500 -- (-1265.929) (-1257.263) (-1267.925) [-1269.018] * (-1262.177) (-1271.955) [-1266.980] (-1257.247) -- 0:01:10 28000 -- (-1267.531) (-1257.585) [-1262.300] (-1271.747) * [-1261.270] (-1266.947) (-1264.000) (-1259.405) -- 0:01:09 28500 -- (-1266.359) [-1258.956] (-1269.986) (-1269.784) * (-1259.571) [-1261.223] (-1267.812) (-1257.375) -- 0:01:08 29000 -- (-1266.223) (-1257.465) (-1265.416) [-1267.460] * (-1261.700) (-1259.913) (-1271.699) [-1258.867] -- 0:01:06 29500 -- (-1268.510) (-1259.810) (-1265.206) [-1272.543] * (-1267.472) [-1257.388] (-1262.498) (-1259.610) -- 0:01:05 30000 -- (-1270.308) [-1257.867] (-1264.096) (-1270.353) * (-1261.620) [-1259.256] (-1268.597) (-1258.171) -- 0:01:04 Average standard deviation of split frequencies: 0.047653 30500 -- (-1266.993) (-1260.145) (-1264.864) [-1263.557] * (-1257.749) (-1256.747) [-1262.482] (-1257.890) -- 0:01:03 31000 -- [-1263.466] (-1258.250) (-1265.077) (-1267.836) * (-1260.342) [-1256.101] (-1268.843) (-1256.186) -- 0:01:02 31500 -- (-1265.653) [-1258.226] (-1270.827) (-1266.057) * (-1259.356) (-1256.770) (-1268.197) [-1256.160] -- 0:01:01 32000 -- (-1269.647) (-1257.935) [-1264.512] (-1266.885) * [-1257.869] (-1257.993) (-1265.359) (-1256.747) -- 0:01:00 32500 -- (-1269.374) [-1257.363] (-1267.961) (-1267.577) * (-1259.439) (-1256.700) [-1267.764] (-1258.956) -- 0:00:59 33000 -- (-1263.851) (-1258.776) (-1271.642) [-1267.743] * (-1256.552) [-1257.621] (-1259.974) (-1258.210) -- 0:00:58 33500 -- (-1268.506) (-1257.497) (-1264.414) [-1264.608] * (-1258.147) [-1256.711] (-1257.553) (-1258.014) -- 0:00:57 34000 -- (-1278.530) (-1257.965) (-1266.266) [-1271.520] * (-1261.734) (-1258.270) [-1257.426] (-1256.592) -- 0:00:56 34500 -- [-1269.219] (-1256.864) (-1268.695) (-1259.098) * (-1258.830) (-1258.915) (-1259.262) [-1257.075] -- 0:00:55 35000 -- [-1267.028] (-1256.952) (-1262.269) (-1257.777) * (-1257.472) (-1257.388) (-1265.848) [-1257.724] -- 0:00:55 Average standard deviation of split frequencies: 0.041903 35500 -- (-1268.858) [-1258.234] (-1267.206) (-1257.803) * (-1258.096) (-1261.946) [-1266.371] (-1260.040) -- 0:00:54 36000 -- (-1266.646) (-1258.968) [-1262.948] (-1258.122) * [-1258.296] (-1257.437) (-1261.154) (-1257.541) -- 0:00:53 36500 -- (-1276.140) (-1259.029) (-1266.086) [-1258.671] * [-1259.876] (-1260.300) (-1261.895) (-1257.538) -- 0:00:52 37000 -- (-1258.689) (-1259.042) (-1265.299) [-1257.842] * (-1257.376) (-1257.386) [-1258.355] (-1259.933) -- 0:00:52 37500 -- (-1261.860) (-1260.554) (-1269.453) [-1257.691] * (-1258.595) (-1260.328) [-1257.365] (-1261.805) -- 0:00:51 38000 -- (-1258.575) [-1261.053] (-1260.482) (-1258.165) * (-1258.531) [-1257.781] (-1256.796) (-1259.070) -- 0:00:50 38500 -- (-1259.520) (-1264.478) [-1264.829] (-1260.545) * (-1260.619) (-1257.127) (-1256.410) [-1256.742] -- 0:00:49 39000 -- (-1262.090) (-1257.792) [-1264.508] (-1259.902) * (-1262.040) [-1258.530] (-1258.243) (-1259.775) -- 0:00:49 39500 -- [-1258.746] (-1256.428) (-1270.439) (-1259.550) * (-1260.875) (-1258.455) (-1258.876) [-1256.752] -- 0:00:48 40000 -- (-1258.133) [-1257.628] (-1275.984) (-1258.745) * (-1256.789) [-1263.299] (-1257.722) (-1256.641) -- 0:00:48 Average standard deviation of split frequencies: 0.039657 40500 -- (-1256.417) (-1262.008) [-1269.935] (-1256.902) * (-1256.444) (-1257.299) (-1259.450) [-1256.932] -- 0:01:11 41000 -- [-1257.372] (-1259.408) (-1266.363) (-1256.896) * [-1259.190] (-1257.023) (-1259.341) (-1260.723) -- 0:01:10 41500 -- [-1256.396] (-1256.839) (-1272.917) (-1259.324) * (-1258.178) (-1259.016) (-1259.066) [-1257.673] -- 0:01:09 42000 -- (-1256.434) (-1256.082) [-1269.034] (-1257.356) * [-1257.361] (-1257.939) (-1257.011) (-1256.812) -- 0:01:08 42500 -- [-1257.867] (-1259.363) (-1270.489) (-1257.473) * (-1257.709) (-1262.975) (-1259.114) [-1256.021] -- 0:01:07 43000 -- (-1259.259) (-1257.451) [-1270.705] (-1257.195) * (-1258.320) (-1261.994) [-1256.814] (-1259.148) -- 0:01:06 43500 -- (-1257.538) (-1259.501) (-1268.005) [-1257.318] * (-1256.164) (-1261.086) [-1257.513] (-1257.442) -- 0:01:05 44000 -- [-1258.973] (-1264.917) (-1267.906) (-1257.681) * (-1258.382) (-1260.378) (-1258.497) [-1256.199] -- 0:01:05 44500 -- (-1257.829) [-1258.523] (-1270.836) (-1259.763) * (-1258.805) (-1257.900) (-1261.161) [-1257.559] -- 0:01:04 45000 -- (-1257.802) [-1256.945] (-1267.172) (-1257.608) * [-1259.502] (-1259.797) (-1259.681) (-1256.670) -- 0:01:03 Average standard deviation of split frequencies: 0.028881 45500 -- (-1258.378) [-1256.706] (-1265.208) (-1257.756) * (-1261.999) (-1256.349) (-1258.455) [-1258.999] -- 0:01:02 46000 -- (-1257.217) (-1260.236) [-1272.664] (-1256.084) * (-1257.108) [-1256.793] (-1258.568) (-1257.175) -- 0:01:02 46500 -- (-1257.515) [-1262.171] (-1267.401) (-1258.407) * (-1258.552) (-1256.758) [-1256.617] (-1258.000) -- 0:01:01 47000 -- (-1257.587) (-1258.137) (-1265.746) [-1258.958] * (-1262.902) (-1257.539) [-1257.204] (-1258.341) -- 0:01:00 47500 -- (-1256.149) (-1258.566) (-1267.080) [-1257.300] * (-1262.566) [-1257.048] (-1256.784) (-1256.250) -- 0:01:00 48000 -- (-1256.757) [-1257.545] (-1266.801) (-1256.183) * [-1261.063] (-1257.732) (-1258.040) (-1256.319) -- 0:00:59 48500 -- [-1256.303] (-1257.786) (-1264.844) (-1256.340) * (-1261.587) (-1258.722) (-1259.111) [-1258.844] -- 0:00:58 49000 -- (-1256.381) (-1257.185) [-1264.422] (-1256.235) * [-1257.133] (-1258.946) (-1261.682) (-1257.272) -- 0:00:58 49500 -- (-1258.521) (-1260.765) (-1270.276) [-1259.854] * (-1256.886) (-1258.344) (-1263.773) [-1260.265] -- 0:00:57 50000 -- [-1258.407] (-1263.182) (-1265.056) (-1260.142) * [-1259.223] (-1257.455) (-1258.255) (-1258.898) -- 0:00:57 Average standard deviation of split frequencies: 0.029684 50500 -- [-1258.417] (-1260.550) (-1269.609) (-1260.202) * (-1257.489) [-1258.878] (-1256.874) (-1262.812) -- 0:00:56 51000 -- (-1258.828) (-1259.159) [-1265.858] (-1258.574) * (-1256.822) (-1258.788) (-1258.603) [-1258.324] -- 0:00:55 51500 -- (-1259.565) (-1257.955) (-1266.614) [-1257.427] * (-1257.056) [-1256.735] (-1257.271) (-1258.101) -- 0:00:55 52000 -- (-1259.282) (-1257.907) [-1261.699] (-1257.862) * [-1256.933] (-1256.714) (-1256.389) (-1258.050) -- 0:00:54 52500 -- (-1258.720) [-1257.159] (-1267.232) (-1256.819) * (-1256.658) (-1256.516) (-1258.213) [-1257.760] -- 0:00:54 53000 -- (-1257.908) [-1258.583] (-1271.151) (-1257.112) * (-1258.746) [-1256.854] (-1265.586) (-1259.838) -- 0:00:53 53500 -- (-1262.016) [-1257.755] (-1277.102) (-1257.286) * (-1255.876) [-1257.255] (-1258.102) (-1258.065) -- 0:00:53 54000 -- (-1260.052) [-1257.222] (-1271.343) (-1257.327) * (-1258.026) [-1257.059] (-1257.802) (-1265.156) -- 0:00:52 54500 -- (-1257.880) [-1257.503] (-1268.540) (-1257.671) * (-1258.160) (-1256.825) [-1257.580] (-1260.408) -- 0:00:52 55000 -- (-1257.894) [-1257.551] (-1266.199) (-1256.781) * (-1258.070) (-1257.143) [-1256.935] (-1258.294) -- 0:00:51 Average standard deviation of split frequencies: 0.025721 55500 -- (-1256.452) (-1257.778) (-1268.218) [-1258.742] * (-1259.269) (-1256.203) (-1256.721) [-1259.618] -- 0:00:51 56000 -- (-1257.425) (-1258.367) (-1268.763) [-1258.743] * [-1266.463] (-1256.777) (-1256.562) (-1259.129) -- 0:00:50 56500 -- (-1257.014) (-1257.001) (-1263.762) [-1259.144] * [-1257.937] (-1260.896) (-1257.177) (-1261.637) -- 0:01:06 57000 -- (-1258.850) (-1256.495) (-1275.076) [-1259.964] * (-1257.564) [-1262.068] (-1257.460) (-1261.282) -- 0:01:06 57500 -- (-1258.049) [-1259.197] (-1269.439) (-1257.836) * (-1257.675) [-1257.932] (-1260.080) (-1261.591) -- 0:01:05 58000 -- (-1258.915) (-1261.516) (-1294.758) [-1257.203] * (-1257.897) (-1258.249) (-1257.130) [-1263.672] -- 0:01:04 58500 -- [-1256.553] (-1262.766) (-1260.839) (-1256.879) * (-1257.104) (-1258.398) (-1258.853) [-1259.266] -- 0:01:04 59000 -- [-1256.083] (-1258.027) (-1261.011) (-1259.713) * (-1256.521) (-1257.140) [-1260.612] (-1257.372) -- 0:01:03 59500 -- (-1258.530) (-1257.718) (-1256.656) [-1257.412] * (-1257.715) (-1256.799) (-1263.969) [-1259.579] -- 0:01:03 60000 -- [-1256.314] (-1256.505) (-1258.192) (-1258.639) * (-1257.715) (-1256.773) [-1258.892] (-1259.694) -- 0:01:02 Average standard deviation of split frequencies: 0.024129 60500 -- [-1259.578] (-1257.614) (-1258.174) (-1257.754) * [-1256.845] (-1258.194) (-1257.702) (-1258.448) -- 0:01:02 61000 -- (-1256.541) (-1256.421) [-1257.794] (-1259.428) * (-1257.707) (-1263.091) (-1258.434) [-1258.118] -- 0:01:01 61500 -- [-1257.441] (-1257.890) (-1256.705) (-1258.264) * (-1257.563) (-1257.651) [-1259.509] (-1257.465) -- 0:01:01 62000 -- (-1264.446) (-1256.148) (-1259.135) [-1259.685] * [-1261.699] (-1257.686) (-1259.355) (-1257.408) -- 0:01:00 62500 -- (-1264.492) [-1258.098] (-1259.141) (-1259.219) * (-1259.476) [-1260.594] (-1260.218) (-1256.927) -- 0:01:00 63000 -- (-1264.207) [-1256.628] (-1258.362) (-1258.709) * (-1259.266) (-1257.075) [-1256.657] (-1258.544) -- 0:00:59 63500 -- (-1258.502) (-1265.774) [-1259.089] (-1261.340) * [-1258.337] (-1257.196) (-1256.815) (-1258.388) -- 0:00:58 64000 -- (-1259.735) [-1260.532] (-1257.658) (-1261.607) * [-1256.282] (-1257.907) (-1256.584) (-1256.255) -- 0:00:58 64500 -- (-1257.478) (-1257.920) [-1256.273] (-1261.285) * (-1256.429) [-1257.480] (-1256.626) (-1257.390) -- 0:00:58 65000 -- (-1259.279) [-1256.659] (-1256.820) (-1263.811) * (-1257.594) (-1256.997) [-1257.075] (-1256.532) -- 0:00:57 Average standard deviation of split frequencies: 0.023468 65500 -- [-1257.880] (-1260.993) (-1259.631) (-1258.622) * (-1258.074) (-1257.101) [-1256.625] (-1257.069) -- 0:00:57 66000 -- [-1259.124] (-1256.555) (-1259.494) (-1257.111) * (-1259.144) (-1260.443) [-1257.256] (-1262.231) -- 0:00:56 66500 -- (-1257.833) (-1258.415) (-1257.968) [-1259.294] * (-1259.621) (-1256.995) [-1259.074] (-1260.333) -- 0:00:56 67000 -- (-1257.180) (-1260.011) [-1256.601] (-1260.121) * (-1260.127) (-1256.548) (-1259.933) [-1258.381] -- 0:00:55 67500 -- (-1257.762) (-1259.928) (-1256.349) [-1259.085] * (-1258.150) [-1257.163] (-1258.459) (-1260.901) -- 0:00:55 68000 -- (-1256.656) (-1257.728) (-1258.032) [-1259.350] * (-1258.326) [-1257.937] (-1256.927) (-1261.249) -- 0:00:54 68500 -- [-1257.510] (-1256.477) (-1258.044) (-1257.291) * (-1258.495) (-1257.018) (-1256.874) [-1258.022] -- 0:00:54 69000 -- (-1257.896) (-1256.094) (-1256.146) [-1257.020] * (-1260.301) (-1258.348) [-1259.349] (-1257.885) -- 0:00:53 69500 -- (-1260.255) (-1258.434) [-1256.353] (-1259.112) * [-1258.627] (-1259.923) (-1260.958) (-1258.263) -- 0:00:53 70000 -- [-1257.391] (-1257.490) (-1257.666) (-1258.836) * [-1257.118] (-1259.469) (-1261.492) (-1258.400) -- 0:00:53 Average standard deviation of split frequencies: 0.021347 70500 -- (-1256.666) (-1256.909) (-1259.548) [-1258.399] * (-1256.715) (-1261.411) (-1262.217) [-1258.956] -- 0:00:52 71000 -- (-1256.394) (-1258.402) [-1257.951] (-1259.279) * (-1256.417) [-1258.550] (-1257.850) (-1261.397) -- 0:00:52 71500 -- (-1259.119) [-1259.571] (-1258.052) (-1257.480) * (-1256.027) (-1260.065) [-1258.979] (-1260.810) -- 0:00:51 72000 -- (-1257.250) (-1257.228) (-1258.347) [-1257.651] * (-1256.650) [-1258.968] (-1260.424) (-1260.810) -- 0:00:51 72500 -- (-1256.107) (-1258.367) (-1258.471) [-1257.409] * (-1257.970) [-1258.028] (-1260.306) (-1257.386) -- 0:00:51 73000 -- [-1256.423] (-1259.691) (-1257.194) (-1258.367) * (-1258.280) (-1256.945) (-1259.210) [-1257.770] -- 0:00:50 73500 -- [-1256.606] (-1260.939) (-1256.551) (-1257.124) * (-1256.091) (-1257.913) [-1257.625] (-1256.532) -- 0:01:03 74000 -- [-1261.572] (-1259.476) (-1256.542) (-1256.521) * (-1258.109) (-1259.689) (-1257.566) [-1256.945] -- 0:01:02 74500 -- (-1262.016) (-1259.091) (-1256.967) [-1256.530] * (-1257.166) (-1258.285) (-1258.810) [-1258.249] -- 0:01:02 75000 -- (-1256.534) (-1260.729) (-1256.973) [-1257.122] * [-1256.931] (-1260.907) (-1259.011) (-1261.874) -- 0:01:01 Average standard deviation of split frequencies: 0.019849 75500 -- (-1257.181) (-1257.771) [-1257.687] (-1256.821) * (-1257.030) [-1258.437] (-1256.663) (-1262.245) -- 0:01:01 76000 -- (-1258.490) [-1257.657] (-1256.761) (-1256.821) * [-1257.382] (-1257.333) (-1257.624) (-1263.374) -- 0:01:00 76500 -- [-1258.529] (-1257.753) (-1258.562) (-1258.522) * [-1261.384] (-1261.805) (-1257.011) (-1256.916) -- 0:01:00 77000 -- (-1264.195) (-1258.909) [-1257.860] (-1258.422) * [-1259.471] (-1260.386) (-1257.723) (-1256.599) -- 0:00:59 77500 -- (-1263.035) [-1256.758] (-1264.996) (-1257.861) * [-1257.243] (-1259.810) (-1260.336) (-1256.250) -- 0:00:59 78000 -- (-1258.141) (-1257.898) (-1259.897) [-1259.809] * [-1257.245] (-1256.547) (-1258.483) (-1258.807) -- 0:00:59 78500 -- (-1258.403) (-1257.893) (-1259.765) [-1258.204] * (-1257.244) [-1258.305] (-1257.197) (-1258.985) -- 0:00:58 79000 -- [-1260.608] (-1256.754) (-1259.182) (-1258.022) * (-1257.357) (-1259.094) [-1258.800] (-1258.224) -- 0:00:58 79500 -- (-1260.006) (-1257.580) (-1260.501) [-1257.259] * (-1258.038) (-1261.470) [-1258.685] (-1257.346) -- 0:00:57 80000 -- (-1259.164) [-1258.768] (-1257.387) (-1259.817) * (-1261.833) (-1257.287) (-1260.594) [-1256.113] -- 0:00:57 Average standard deviation of split frequencies: 0.020161 80500 -- (-1265.320) (-1261.167) (-1258.573) [-1263.353] * (-1258.691) (-1257.273) [-1260.541] (-1256.245) -- 0:00:57 81000 -- (-1261.296) (-1258.045) (-1261.931) [-1260.749] * (-1260.421) (-1257.372) (-1256.650) [-1256.326] -- 0:00:56 81500 -- (-1263.371) [-1257.605] (-1260.206) (-1257.925) * (-1261.308) (-1258.079) (-1258.509) [-1257.540] -- 0:00:56 82000 -- [-1264.193] (-1257.296) (-1258.294) (-1257.352) * (-1258.280) [-1258.248] (-1262.323) (-1256.906) -- 0:00:55 82500 -- (-1257.994) (-1259.596) (-1257.031) [-1258.300] * (-1255.952) [-1259.569] (-1261.049) (-1262.606) -- 0:00:55 83000 -- (-1258.762) (-1258.060) (-1259.417) [-1259.009] * (-1256.698) (-1261.221) (-1260.890) [-1259.214] -- 0:00:55 83500 -- [-1257.972] (-1258.815) (-1257.294) (-1258.501) * (-1256.339) (-1258.829) (-1258.992) [-1259.625] -- 0:00:54 84000 -- (-1258.581) (-1256.220) [-1256.392] (-1258.057) * [-1256.590] (-1258.421) (-1261.387) (-1258.272) -- 0:00:54 84500 -- (-1259.752) (-1257.914) (-1258.513) [-1257.000] * (-1257.450) [-1257.557] (-1256.577) (-1257.482) -- 0:00:54 85000 -- [-1262.231] (-1256.890) (-1263.591) (-1257.462) * (-1256.694) (-1257.070) [-1257.680] (-1258.949) -- 0:00:53 Average standard deviation of split frequencies: 0.019316 85500 -- (-1262.237) (-1257.707) [-1259.382] (-1260.193) * (-1256.228) [-1259.336] (-1257.281) (-1261.458) -- 0:00:53 86000 -- [-1258.874] (-1257.605) (-1258.060) (-1256.469) * (-1258.033) [-1259.124] (-1257.107) (-1259.303) -- 0:00:53 86500 -- (-1259.502) [-1258.222] (-1257.115) (-1256.066) * (-1258.563) (-1259.619) [-1256.370] (-1258.392) -- 0:00:52 87000 -- [-1259.285] (-1257.081) (-1257.325) (-1256.024) * (-1257.563) [-1257.733] (-1256.374) (-1259.922) -- 0:00:52 87500 -- [-1257.854] (-1257.952) (-1259.922) (-1256.024) * (-1257.701) (-1257.552) (-1256.268) [-1258.208] -- 0:00:52 88000 -- (-1258.687) [-1258.371] (-1261.096) (-1259.908) * (-1257.554) (-1258.165) [-1256.631] (-1261.981) -- 0:00:51 88500 -- (-1259.841) (-1262.998) (-1260.011) [-1257.243] * (-1260.191) (-1259.928) (-1256.326) [-1258.059] -- 0:00:51 89000 -- (-1257.514) [-1261.196] (-1262.815) (-1257.386) * (-1257.301) [-1259.939] (-1256.964) (-1260.197) -- 0:00:51 89500 -- (-1259.701) (-1257.956) (-1258.235) [-1256.802] * [-1257.378] (-1257.924) (-1256.935) (-1260.282) -- 0:00:50 90000 -- (-1257.429) (-1262.070) [-1257.449] (-1257.708) * [-1258.322] (-1258.363) (-1256.692) (-1269.036) -- 0:01:00 Average standard deviation of split frequencies: 0.018321 90500 -- (-1259.957) [-1260.609] (-1257.657) (-1263.461) * (-1257.220) [-1257.450] (-1256.573) (-1259.828) -- 0:01:00 91000 -- (-1256.764) [-1260.852] (-1257.337) (-1261.855) * [-1258.762] (-1260.552) (-1258.911) (-1260.294) -- 0:00:59 91500 -- [-1257.439] (-1260.365) (-1260.156) (-1260.057) * (-1261.128) [-1258.392] (-1258.498) (-1265.854) -- 0:00:59 92000 -- (-1257.080) (-1256.788) [-1256.524] (-1257.923) * [-1260.978] (-1259.579) (-1260.322) (-1267.124) -- 0:00:59 92500 -- (-1261.650) (-1257.147) [-1260.612] (-1257.676) * (-1259.586) [-1259.167] (-1261.122) (-1261.413) -- 0:00:58 93000 -- (-1260.501) (-1257.255) (-1260.019) [-1257.639] * (-1258.350) [-1259.863] (-1257.010) (-1257.589) -- 0:00:58 93500 -- (-1263.279) (-1263.478) (-1259.097) [-1256.363] * (-1257.295) (-1261.024) [-1256.909] (-1256.058) -- 0:00:58 94000 -- (-1268.065) (-1259.802) (-1260.756) [-1256.092] * (-1258.552) (-1265.378) [-1256.906] (-1257.874) -- 0:00:57 94500 -- [-1258.536] (-1257.759) (-1259.119) (-1257.092) * (-1259.149) [-1258.294] (-1257.108) (-1256.978) -- 0:00:57 95000 -- (-1257.675) (-1260.872) (-1257.006) [-1256.570] * [-1257.765] (-1258.286) (-1256.813) (-1256.929) -- 0:00:57 Average standard deviation of split frequencies: 0.015959 95500 -- [-1258.085] (-1257.471) (-1257.533) (-1256.656) * (-1257.166) (-1257.718) [-1259.728] (-1256.969) -- 0:00:56 96000 -- (-1259.796) (-1257.355) [-1257.811] (-1256.895) * (-1257.355) [-1261.130] (-1259.499) (-1259.912) -- 0:00:56 96500 -- (-1258.836) (-1263.849) (-1259.843) [-1258.092] * [-1258.755] (-1257.345) (-1259.498) (-1262.358) -- 0:00:56 97000 -- (-1260.437) (-1258.220) (-1258.909) [-1257.918] * (-1260.982) (-1256.927) [-1255.920] (-1257.825) -- 0:00:55 97500 -- (-1258.592) (-1258.461) [-1258.764] (-1258.325) * [-1258.091] (-1258.114) (-1255.930) (-1257.153) -- 0:00:55 98000 -- [-1256.802] (-1256.906) (-1257.969) (-1257.918) * (-1257.760) [-1259.305] (-1258.433) (-1262.043) -- 0:00:55 98500 -- [-1257.836] (-1256.949) (-1258.541) (-1263.410) * [-1262.185] (-1256.999) (-1256.168) (-1261.911) -- 0:00:54 99000 -- [-1256.567] (-1257.408) (-1258.642) (-1260.174) * (-1259.258) (-1256.741) (-1256.258) [-1259.631] -- 0:00:54 99500 -- (-1256.991) (-1258.645) [-1257.624] (-1257.715) * (-1259.686) (-1258.492) [-1256.919] (-1259.068) -- 0:00:54 100000 -- (-1256.639) (-1256.464) (-1258.924) [-1257.027] * (-1258.694) (-1265.422) (-1256.479) [-1259.140] -- 0:00:54 Average standard deviation of split frequencies: 0.017393 100500 -- (-1256.532) (-1256.530) [-1259.027] (-1258.977) * (-1257.808) (-1261.136) [-1256.642] (-1256.983) -- 0:00:53 101000 -- (-1258.499) [-1257.839] (-1259.565) (-1259.990) * [-1258.622] (-1259.497) (-1257.288) (-1256.431) -- 0:00:53 101500 -- [-1261.270] (-1256.536) (-1260.426) (-1258.286) * [-1257.448] (-1258.920) (-1257.393) (-1258.418) -- 0:00:53 102000 -- (-1260.423) (-1256.220) (-1260.872) [-1256.960] * (-1257.433) [-1258.368] (-1259.449) (-1258.784) -- 0:00:52 102500 -- (-1258.992) (-1257.492) (-1258.872) [-1257.004] * (-1259.646) (-1259.025) [-1256.562] (-1260.055) -- 0:00:52 103000 -- (-1259.006) (-1257.498) (-1256.377) [-1260.655] * (-1256.957) (-1257.509) (-1258.022) [-1258.480] -- 0:00:52 103500 -- (-1263.077) (-1256.804) (-1256.699) [-1259.443] * [-1256.775] (-1260.288) (-1259.891) (-1264.399) -- 0:00:51 104000 -- (-1260.773) [-1258.657] (-1257.024) (-1260.880) * (-1256.844) [-1259.939] (-1262.166) (-1258.276) -- 0:00:51 104500 -- (-1261.907) [-1260.637] (-1256.064) (-1260.638) * (-1259.481) (-1260.968) (-1260.630) [-1256.804] -- 0:00:51 105000 -- [-1260.665] (-1259.566) (-1257.345) (-1256.941) * [-1259.286] (-1260.370) (-1262.298) (-1258.720) -- 0:00:51 Average standard deviation of split frequencies: 0.019406 105500 -- (-1260.501) (-1258.626) [-1258.480] (-1256.987) * (-1257.523) (-1262.656) [-1261.513] (-1259.323) -- 0:00:50 106000 -- [-1257.004] (-1257.912) (-1256.259) (-1256.933) * [-1256.508] (-1257.944) (-1260.558) (-1257.753) -- 0:00:59 106500 -- [-1261.581] (-1258.919) (-1258.868) (-1256.352) * (-1257.201) [-1256.982] (-1258.302) (-1258.640) -- 0:00:58 107000 -- (-1261.505) (-1259.512) [-1257.848] (-1258.995) * (-1256.735) (-1256.825) [-1262.205] (-1256.969) -- 0:00:58 107500 -- (-1261.033) [-1262.115] (-1258.039) (-1260.013) * (-1256.488) (-1257.002) [-1258.192] (-1257.234) -- 0:00:58 108000 -- (-1262.331) [-1260.408] (-1258.163) (-1257.754) * (-1256.682) [-1258.514] (-1257.160) (-1257.799) -- 0:00:57 108500 -- (-1262.668) (-1258.558) (-1258.159) [-1259.367] * (-1258.078) (-1260.048) (-1257.390) [-1257.658] -- 0:00:57 109000 -- (-1257.443) [-1257.888] (-1257.906) (-1262.099) * [-1257.149] (-1259.537) (-1257.605) (-1257.963) -- 0:00:57 109500 -- [-1257.708] (-1260.888) (-1256.849) (-1266.422) * (-1256.650) (-1259.994) (-1257.944) [-1258.114] -- 0:00:56 110000 -- (-1257.990) (-1258.386) [-1257.535] (-1260.679) * [-1256.086] (-1259.980) (-1258.539) (-1256.960) -- 0:00:56 Average standard deviation of split frequencies: 0.017232 110500 -- (-1258.727) (-1257.775) [-1257.117] (-1260.560) * (-1257.868) (-1259.210) [-1257.912] (-1260.381) -- 0:00:56 111000 -- (-1261.931) (-1259.335) (-1258.792) [-1257.251] * [-1258.980] (-1259.370) (-1258.901) (-1256.919) -- 0:00:56 111500 -- (-1260.018) (-1259.803) (-1257.574) [-1260.690] * (-1256.402) (-1257.528) (-1258.690) [-1261.674] -- 0:00:55 112000 -- (-1262.273) [-1259.456] (-1259.368) (-1260.807) * (-1258.547) (-1256.506) (-1256.646) [-1261.264] -- 0:00:55 112500 -- (-1260.376) (-1257.496) [-1259.355] (-1258.626) * (-1258.590) (-1257.236) [-1261.303] (-1266.589) -- 0:00:55 113000 -- (-1258.280) (-1261.208) [-1259.626] (-1260.283) * (-1259.224) (-1256.988) (-1259.864) [-1256.812] -- 0:00:54 113500 -- [-1256.864] (-1261.328) (-1258.185) (-1258.322) * (-1260.136) (-1257.002) (-1261.633) [-1256.793] -- 0:00:54 114000 -- (-1258.229) (-1259.344) [-1259.002] (-1257.648) * [-1258.687] (-1256.473) (-1261.020) (-1256.772) -- 0:00:54 114500 -- (-1257.757) (-1258.439) [-1259.594] (-1260.072) * (-1259.070) (-1256.364) [-1260.931] (-1257.668) -- 0:00:54 115000 -- (-1257.362) (-1256.982) (-1256.014) [-1258.144] * [-1260.105] (-1259.355) (-1258.549) (-1257.188) -- 0:00:53 Average standard deviation of split frequencies: 0.018771 115500 -- (-1259.978) [-1257.516] (-1258.151) (-1259.880) * (-1265.869) [-1261.925] (-1256.799) (-1258.523) -- 0:00:53 116000 -- [-1257.756] (-1258.459) (-1258.069) (-1257.328) * (-1263.916) [-1256.585] (-1262.906) (-1256.831) -- 0:00:53 116500 -- (-1256.295) (-1259.284) (-1257.469) [-1258.215] * (-1260.273) [-1257.757] (-1260.938) (-1259.289) -- 0:00:53 117000 -- (-1256.411) (-1258.628) [-1261.999] (-1257.239) * (-1260.388) [-1258.166] (-1260.378) (-1258.906) -- 0:00:52 117500 -- (-1256.377) (-1256.942) (-1260.952) [-1257.865] * (-1260.062) [-1258.052] (-1260.561) (-1259.942) -- 0:00:52 118000 -- [-1257.954] (-1257.621) (-1260.949) (-1257.404) * (-1260.757) [-1260.314] (-1258.660) (-1259.725) -- 0:00:52 118500 -- (-1259.218) (-1257.302) (-1262.179) [-1260.178] * (-1260.167) (-1257.614) [-1257.110] (-1261.426) -- 0:00:52 119000 -- (-1258.137) [-1260.280] (-1257.904) (-1259.804) * [-1258.372] (-1258.939) (-1257.292) (-1257.837) -- 0:00:51 119500 -- (-1256.889) (-1258.396) [-1259.998] (-1258.621) * (-1258.942) (-1259.762) [-1257.831] (-1256.862) -- 0:00:51 120000 -- [-1257.529] (-1258.142) (-1257.892) (-1267.433) * (-1260.099) (-1260.802) (-1260.140) [-1258.174] -- 0:00:51 Average standard deviation of split frequencies: 0.019924 120500 -- [-1257.320] (-1257.996) (-1259.081) (-1260.277) * (-1257.652) (-1261.044) [-1259.074] (-1259.931) -- 0:00:51 121000 -- [-1257.127] (-1258.387) (-1258.515) (-1257.745) * (-1259.361) (-1259.502) (-1259.672) [-1257.440] -- 0:00:50 121500 -- (-1257.305) (-1258.455) [-1257.389] (-1262.302) * (-1256.700) [-1257.163] (-1259.386) (-1260.826) -- 0:00:57 122000 -- [-1257.366] (-1257.340) (-1257.370) (-1258.029) * (-1258.254) (-1257.062) (-1259.374) [-1257.782] -- 0:00:57 122500 -- (-1258.603) (-1256.798) (-1257.213) [-1258.042] * (-1258.610) (-1258.786) [-1256.773] (-1260.547) -- 0:00:57 123000 -- [-1259.518] (-1261.258) (-1257.156) (-1257.682) * (-1259.429) [-1257.782] (-1259.807) (-1256.842) -- 0:00:57 123500 -- (-1259.573) (-1259.040) [-1256.227] (-1257.780) * [-1257.062] (-1258.260) (-1258.461) (-1259.749) -- 0:00:56 124000 -- (-1257.217) [-1257.390] (-1261.843) (-1257.399) * [-1256.948] (-1262.691) (-1257.281) (-1259.122) -- 0:00:56 124500 -- [-1257.212] (-1259.982) (-1265.524) (-1258.398) * (-1257.262) (-1259.801) (-1260.350) [-1260.020] -- 0:00:56 125000 -- (-1256.589) (-1257.791) (-1260.176) [-1260.919] * (-1259.506) [-1257.719] (-1263.581) (-1258.867) -- 0:00:56 Average standard deviation of split frequencies: 0.021598 125500 -- (-1257.068) (-1258.455) (-1258.422) [-1258.502] * (-1257.498) (-1258.816) [-1258.866] (-1258.020) -- 0:00:55 126000 -- [-1256.851] (-1259.485) (-1257.810) (-1260.956) * (-1257.933) (-1258.661) [-1256.682] (-1258.022) -- 0:00:55 126500 -- (-1260.648) (-1261.705) [-1256.990] (-1259.119) * (-1256.296) (-1263.874) (-1256.605) [-1262.865] -- 0:00:55 127000 -- (-1259.850) (-1260.024) (-1256.944) [-1257.376] * [-1255.996] (-1257.597) (-1258.875) (-1259.118) -- 0:00:54 127500 -- (-1256.842) (-1261.374) (-1256.631) [-1258.125] * [-1257.455] (-1259.003) (-1262.029) (-1259.105) -- 0:00:54 128000 -- (-1257.298) (-1257.567) [-1258.318] (-1256.496) * (-1259.393) [-1260.642] (-1265.750) (-1257.135) -- 0:00:54 128500 -- [-1257.893] (-1258.036) (-1257.349) (-1257.499) * (-1259.683) [-1257.909] (-1258.833) (-1257.358) -- 0:00:54 129000 -- (-1257.816) (-1259.485) [-1256.578] (-1257.730) * (-1258.638) (-1257.083) (-1258.962) [-1257.473] -- 0:00:54 129500 -- (-1260.377) (-1258.967) [-1258.235] (-1256.452) * (-1261.743) (-1257.386) [-1261.221] (-1257.852) -- 0:00:53 130000 -- [-1256.760] (-1257.411) (-1259.726) (-1256.987) * (-1257.778) [-1256.643] (-1258.861) (-1257.178) -- 0:00:53 Average standard deviation of split frequencies: 0.024713 130500 -- [-1256.457] (-1257.222) (-1258.486) (-1258.513) * (-1257.415) (-1256.762) [-1258.913] (-1257.335) -- 0:00:53 131000 -- (-1258.879) (-1263.066) (-1263.870) [-1260.117] * (-1256.853) (-1259.428) [-1256.776] (-1258.802) -- 0:00:53 131500 -- (-1260.460) (-1264.348) (-1262.725) [-1259.248] * (-1256.143) (-1260.271) [-1257.332] (-1261.040) -- 0:00:52 132000 -- (-1258.159) (-1260.843) [-1261.549] (-1257.161) * (-1257.425) (-1261.518) [-1261.383] (-1258.088) -- 0:00:52 132500 -- [-1257.199] (-1260.484) (-1259.629) (-1256.231) * [-1256.256] (-1260.653) (-1256.900) (-1258.517) -- 0:00:52 133000 -- (-1257.819) [-1260.007] (-1256.340) (-1259.059) * (-1256.634) (-1260.569) [-1257.164] (-1263.146) -- 0:00:52 133500 -- (-1258.476) [-1257.481] (-1256.254) (-1257.926) * (-1256.754) (-1259.326) [-1257.793] (-1257.489) -- 0:00:51 134000 -- (-1260.286) (-1261.134) (-1256.850) [-1257.771] * (-1257.264) (-1258.575) [-1257.650] (-1257.877) -- 0:00:51 134500 -- [-1257.777] (-1258.097) (-1256.993) (-1260.272) * (-1259.023) (-1263.381) [-1256.694] (-1259.209) -- 0:00:51 135000 -- (-1257.780) (-1260.844) [-1256.966] (-1257.156) * (-1256.433) (-1266.413) [-1257.290] (-1259.304) -- 0:00:51 Average standard deviation of split frequencies: 0.025997 135500 -- (-1258.176) (-1256.827) [-1259.391] (-1261.151) * (-1257.306) (-1260.635) [-1257.845] (-1258.396) -- 0:00:51 136000 -- (-1258.376) (-1257.532) [-1259.871] (-1260.297) * (-1256.966) (-1259.315) [-1259.299] (-1259.557) -- 0:00:50 136500 -- (-1257.039) (-1267.631) (-1260.721) [-1258.557] * (-1256.642) (-1259.647) [-1259.100] (-1259.806) -- 0:00:50 137000 -- (-1257.039) [-1257.945] (-1262.128) (-1257.990) * (-1257.836) (-1258.771) [-1260.735] (-1258.614) -- 0:00:56 137500 -- (-1257.626) [-1256.689] (-1262.783) (-1259.157) * (-1257.183) (-1259.756) (-1256.038) [-1259.135] -- 0:00:56 138000 -- (-1258.694) [-1258.877] (-1258.048) (-1263.758) * (-1259.801) (-1258.499) (-1257.702) [-1260.343] -- 0:00:56 138500 -- (-1258.689) [-1257.354] (-1256.650) (-1258.278) * (-1265.155) (-1256.550) (-1259.836) [-1259.019] -- 0:00:55 139000 -- (-1258.336) (-1258.103) [-1256.605] (-1263.995) * (-1264.039) (-1260.934) (-1257.247) [-1259.323] -- 0:00:55 139500 -- (-1258.397) (-1258.131) [-1257.798] (-1260.552) * (-1261.185) [-1258.610] (-1259.163) (-1257.177) -- 0:00:55 140000 -- (-1260.373) (-1259.094) (-1258.312) [-1259.595] * (-1261.538) [-1256.989] (-1260.133) (-1257.919) -- 0:00:55 Average standard deviation of split frequencies: 0.021950 140500 -- (-1259.721) (-1257.447) (-1258.007) [-1257.089] * (-1257.806) (-1256.875) [-1259.592] (-1261.176) -- 0:00:55 141000 -- (-1259.646) (-1257.412) (-1257.121) [-1257.111] * (-1257.920) (-1256.875) (-1259.621) [-1257.746] -- 0:00:54 141500 -- (-1267.673) [-1260.248] (-1257.453) (-1257.574) * (-1256.620) (-1257.736) (-1257.873) [-1257.297] -- 0:00:54 142000 -- (-1264.014) [-1257.693] (-1256.854) (-1258.401) * [-1256.535] (-1256.878) (-1258.663) (-1257.829) -- 0:00:54 142500 -- (-1259.740) (-1258.880) (-1257.256) [-1256.870] * [-1256.592] (-1260.167) (-1258.650) (-1257.890) -- 0:00:54 143000 -- (-1259.283) (-1257.922) (-1258.026) [-1256.623] * (-1256.817) (-1264.945) (-1258.926) [-1259.157] -- 0:00:53 143500 -- (-1257.683) (-1258.901) (-1257.956) [-1257.109] * (-1257.008) [-1261.913] (-1257.627) (-1258.314) -- 0:00:53 144000 -- [-1259.359] (-1258.263) (-1260.937) (-1255.929) * [-1257.315] (-1258.255) (-1260.533) (-1256.879) -- 0:00:53 144500 -- (-1259.779) (-1258.107) [-1258.720] (-1257.571) * (-1257.512) [-1256.673] (-1259.609) (-1261.992) -- 0:00:53 145000 -- (-1262.502) [-1258.185] (-1261.592) (-1256.064) * (-1263.248) [-1257.313] (-1262.653) (-1260.461) -- 0:00:53 Average standard deviation of split frequencies: 0.020449 145500 -- [-1260.036] (-1256.428) (-1260.936) (-1256.372) * [-1258.686] (-1257.196) (-1262.452) (-1267.270) -- 0:00:52 146000 -- [-1258.501] (-1258.014) (-1257.637) (-1255.945) * (-1258.355) (-1257.611) [-1257.071] (-1261.879) -- 0:00:52 146500 -- (-1259.683) (-1259.935) (-1256.597) [-1257.726] * [-1257.444] (-1258.216) (-1257.703) (-1266.884) -- 0:00:52 147000 -- (-1259.751) [-1259.333] (-1256.840) (-1265.358) * (-1259.166) [-1257.322] (-1261.712) (-1266.471) -- 0:00:52 147500 -- (-1257.904) (-1256.926) [-1257.926] (-1262.029) * (-1260.043) [-1257.301] (-1258.153) (-1265.951) -- 0:00:52 148000 -- [-1257.867] (-1256.252) (-1257.686) (-1259.748) * (-1259.310) (-1258.385) (-1257.755) [-1262.118] -- 0:00:51 148500 -- [-1258.104] (-1256.809) (-1261.770) (-1257.041) * (-1257.160) (-1257.712) [-1258.626] (-1256.467) -- 0:00:51 149000 -- (-1257.491) (-1256.401) (-1260.615) [-1257.138] * (-1259.150) [-1258.217] (-1258.264) (-1258.130) -- 0:00:51 149500 -- [-1257.396] (-1258.265) (-1256.470) (-1259.068) * [-1258.371] (-1260.355) (-1256.286) (-1259.811) -- 0:00:51 150000 -- [-1256.449] (-1259.683) (-1257.414) (-1257.137) * (-1257.737) [-1260.638] (-1259.257) (-1259.924) -- 0:00:51 Average standard deviation of split frequencies: 0.020749 150500 -- (-1258.320) (-1257.842) (-1262.804) [-1257.235] * (-1258.071) [-1258.675] (-1261.102) (-1258.623) -- 0:00:50 151000 -- [-1258.018] (-1258.676) (-1261.743) (-1257.915) * (-1256.419) (-1258.187) (-1261.433) [-1259.641] -- 0:00:50 151500 -- (-1256.956) [-1256.790] (-1261.317) (-1259.408) * (-1256.852) (-1259.764) (-1257.814) [-1258.938] -- 0:00:50 152000 -- (-1256.858) (-1258.506) [-1257.629] (-1258.826) * (-1258.038) [-1256.515] (-1257.048) (-1260.511) -- 0:00:50 152500 -- (-1260.420) [-1257.407] (-1257.932) (-1257.620) * (-1257.709) [-1255.939] (-1257.132) (-1258.818) -- 0:00:55 153000 -- (-1260.497) (-1260.378) (-1257.849) [-1257.308] * (-1258.377) (-1257.703) [-1257.814] (-1259.192) -- 0:00:55 153500 -- (-1260.467) [-1259.010] (-1257.227) (-1258.853) * (-1260.711) (-1260.564) (-1259.232) [-1258.132] -- 0:00:55 154000 -- [-1258.524] (-1260.156) (-1256.987) (-1263.710) * (-1257.152) (-1261.572) (-1261.567) [-1260.414] -- 0:00:54 154500 -- [-1259.240] (-1257.408) (-1260.025) (-1262.135) * (-1257.801) (-1259.267) (-1262.502) [-1260.559] -- 0:00:54 155000 -- (-1260.710) (-1257.276) [-1257.928] (-1257.849) * (-1258.817) [-1257.115] (-1257.483) (-1261.119) -- 0:00:54 Average standard deviation of split frequencies: 0.018608 155500 -- (-1260.752) [-1262.355] (-1259.817) (-1257.902) * [-1256.034] (-1259.280) (-1259.786) (-1258.198) -- 0:00:54 156000 -- [-1259.571] (-1259.192) (-1256.966) (-1260.057) * (-1258.262) (-1263.816) [-1258.156] (-1256.961) -- 0:00:54 156500 -- (-1258.447) [-1259.884] (-1258.617) (-1259.178) * (-1260.216) (-1256.554) (-1257.663) [-1256.864] -- 0:00:53 157000 -- [-1258.257] (-1259.371) (-1256.644) (-1257.774) * (-1260.481) [-1257.244] (-1257.295) (-1256.650) -- 0:00:53 157500 -- (-1259.253) [-1257.316] (-1256.320) (-1258.743) * (-1261.164) [-1259.385] (-1261.395) (-1259.367) -- 0:00:53 158000 -- (-1257.085) (-1258.067) (-1256.320) [-1258.704] * (-1259.026) [-1262.751] (-1258.585) (-1257.765) -- 0:00:53 158500 -- (-1256.891) [-1257.774] (-1257.442) (-1263.230) * (-1258.546) [-1258.489] (-1261.130) (-1260.698) -- 0:00:53 159000 -- (-1257.531) (-1258.975) [-1257.371] (-1262.231) * (-1261.742) [-1257.018] (-1260.564) (-1259.190) -- 0:00:52 159500 -- [-1257.502] (-1259.891) (-1258.299) (-1258.398) * [-1258.622] (-1257.670) (-1259.885) (-1265.714) -- 0:00:52 160000 -- (-1260.869) (-1257.663) (-1258.705) [-1257.783] * [-1257.041] (-1260.095) (-1259.903) (-1261.866) -- 0:00:52 Average standard deviation of split frequencies: 0.016369 160500 -- [-1258.274] (-1257.667) (-1261.517) (-1257.176) * (-1259.616) (-1259.611) (-1262.794) [-1261.953] -- 0:00:52 161000 -- (-1258.898) [-1256.909] (-1261.958) (-1256.847) * [-1257.028] (-1256.659) (-1261.833) (-1257.703) -- 0:00:52 161500 -- (-1257.634) (-1257.387) [-1265.461] (-1259.371) * (-1259.726) [-1256.527] (-1261.437) (-1259.957) -- 0:00:51 162000 -- (-1256.381) [-1258.204] (-1263.918) (-1256.967) * [-1256.242] (-1257.311) (-1258.553) (-1258.943) -- 0:00:51 162500 -- (-1256.643) [-1258.409] (-1263.981) (-1258.632) * (-1258.709) (-1256.506) [-1257.940] (-1258.668) -- 0:00:51 163000 -- (-1256.642) (-1257.530) (-1257.252) [-1256.703] * [-1258.028] (-1257.792) (-1258.171) (-1258.524) -- 0:00:51 163500 -- [-1257.725] (-1261.501) (-1258.753) (-1259.662) * (-1259.439) (-1258.729) (-1258.791) [-1256.860] -- 0:00:51 164000 -- [-1258.658] (-1259.023) (-1257.321) (-1259.845) * (-1257.922) (-1256.478) (-1258.791) [-1262.542] -- 0:00:50 164500 -- (-1263.822) (-1258.560) [-1256.836] (-1257.357) * (-1256.938) (-1256.448) (-1257.724) [-1256.908] -- 0:00:50 165000 -- (-1258.200) (-1256.052) [-1256.955] (-1257.279) * [-1258.653] (-1257.964) (-1258.026) (-1257.465) -- 0:00:50 Average standard deviation of split frequencies: 0.017039 165500 -- (-1257.716) [-1256.164] (-1260.523) (-1261.383) * (-1256.866) (-1258.345) (-1256.745) [-1259.266] -- 0:00:50 166000 -- [-1258.159] (-1256.632) (-1260.757) (-1261.235) * (-1256.218) [-1256.564] (-1258.593) (-1260.425) -- 0:00:50 166500 -- (-1257.539) (-1256.791) [-1257.064] (-1258.394) * (-1256.490) (-1256.538) [-1257.520] (-1261.412) -- 0:00:50 167000 -- (-1257.688) [-1257.092] (-1256.974) (-1258.215) * (-1256.711) (-1258.364) (-1258.935) [-1257.869] -- 0:00:49 167500 -- [-1258.532] (-1257.628) (-1257.821) (-1261.835) * (-1258.450) (-1258.693) (-1260.733) [-1257.271] -- 0:00:49 168000 -- [-1257.447] (-1262.370) (-1257.895) (-1260.640) * (-1259.536) [-1258.139] (-1261.243) (-1256.395) -- 0:00:49 168500 -- (-1260.608) [-1256.347] (-1256.893) (-1259.602) * (-1259.097) [-1260.711] (-1258.351) (-1256.551) -- 0:00:49 169000 -- (-1258.637) (-1256.676) (-1256.868) [-1258.313] * (-1259.366) [-1258.784] (-1262.978) (-1257.344) -- 0:00:54 169500 -- (-1260.398) (-1257.095) [-1256.207] (-1259.336) * (-1260.811) (-1259.304) (-1256.879) [-1256.370] -- 0:00:53 170000 -- (-1258.119) [-1256.560] (-1256.082) (-1257.959) * (-1262.690) (-1258.746) [-1258.081] (-1256.789) -- 0:00:53 Average standard deviation of split frequencies: 0.016427 170500 -- [-1258.434] (-1257.009) (-1256.475) (-1258.324) * (-1260.599) [-1259.442] (-1257.694) (-1258.563) -- 0:00:53 171000 -- (-1261.292) [-1256.739] (-1258.911) (-1262.967) * (-1260.662) (-1261.694) [-1257.788] (-1262.325) -- 0:00:53 171500 -- (-1258.267) [-1256.843] (-1256.359) (-1256.927) * (-1258.381) [-1260.101] (-1257.815) (-1259.058) -- 0:00:53 172000 -- (-1256.548) (-1257.334) (-1260.404) [-1258.094] * (-1258.858) (-1257.932) [-1256.750] (-1259.779) -- 0:00:52 172500 -- [-1256.854] (-1257.421) (-1256.188) (-1260.783) * (-1259.368) (-1261.694) (-1255.979) [-1256.942] -- 0:00:52 173000 -- (-1259.945) (-1261.049) [-1257.362] (-1260.383) * (-1257.854) (-1260.322) [-1258.457] (-1257.684) -- 0:00:52 173500 -- (-1258.213) (-1258.556) [-1256.108] (-1258.408) * (-1257.648) (-1258.270) [-1258.796] (-1258.941) -- 0:00:52 174000 -- [-1257.354] (-1257.985) (-1256.480) (-1259.713) * (-1257.667) (-1259.903) (-1257.349) [-1256.559] -- 0:00:52 174500 -- (-1261.125) (-1257.938) [-1257.922] (-1259.340) * (-1258.386) (-1256.520) (-1260.093) [-1257.311] -- 0:00:52 175000 -- (-1257.913) (-1257.896) (-1257.409) [-1258.045] * (-1256.314) (-1258.014) (-1263.042) [-1258.317] -- 0:00:51 Average standard deviation of split frequencies: 0.017198 175500 -- (-1260.452) (-1259.302) [-1259.315] (-1257.131) * (-1257.022) (-1256.884) (-1258.713) [-1257.115] -- 0:00:51 176000 -- (-1257.530) (-1258.950) (-1257.316) [-1257.316] * (-1256.793) (-1258.035) (-1258.475) [-1258.036] -- 0:00:51 176500 -- (-1259.900) (-1259.041) [-1256.122] (-1257.357) * [-1256.399] (-1258.870) (-1257.969) (-1256.595) -- 0:00:51 177000 -- (-1258.620) (-1256.539) [-1257.714] (-1258.103) * (-1259.632) (-1258.024) [-1258.311] (-1256.423) -- 0:00:51 177500 -- [-1259.838] (-1256.759) (-1256.832) (-1257.129) * (-1258.334) [-1257.922] (-1258.417) (-1257.586) -- 0:00:50 178000 -- (-1257.866) (-1258.355) [-1259.834] (-1259.129) * (-1258.733) [-1258.526] (-1257.664) (-1260.860) -- 0:00:50 178500 -- (-1263.267) [-1256.651] (-1261.177) (-1257.354) * [-1259.452] (-1257.337) (-1260.058) (-1261.330) -- 0:00:50 179000 -- (-1257.566) (-1257.898) [-1260.910] (-1257.595) * (-1263.344) (-1257.767) [-1257.487] (-1259.458) -- 0:00:50 179500 -- [-1256.946] (-1256.933) (-1259.906) (-1258.314) * (-1261.625) (-1257.648) (-1257.039) [-1260.486] -- 0:00:50 180000 -- (-1256.905) (-1256.495) [-1258.279] (-1256.427) * (-1256.102) (-1258.100) [-1256.914] (-1259.794) -- 0:00:50 Average standard deviation of split frequencies: 0.018265 180500 -- (-1257.617) (-1256.060) [-1258.253] (-1256.673) * (-1257.618) (-1256.943) [-1258.981] (-1259.961) -- 0:00:49 181000 -- [-1257.492] (-1256.105) (-1257.190) (-1259.198) * (-1256.910) (-1256.795) [-1257.725] (-1256.752) -- 0:00:49 181500 -- [-1257.853] (-1257.717) (-1256.407) (-1260.201) * (-1258.554) (-1257.172) [-1258.140] (-1259.949) -- 0:00:49 182000 -- (-1257.336) (-1256.601) [-1256.407] (-1257.514) * (-1258.376) [-1256.250] (-1259.479) (-1260.096) -- 0:00:49 182500 -- (-1259.471) (-1256.621) (-1259.283) [-1260.189] * (-1260.121) (-1256.266) (-1258.514) [-1259.320] -- 0:00:49 183000 -- (-1257.191) [-1257.225] (-1257.914) (-1259.987) * [-1257.236] (-1256.963) (-1259.208) (-1258.581) -- 0:00:49 183500 -- (-1257.124) (-1259.338) (-1259.856) [-1258.942] * (-1257.684) [-1259.877] (-1258.857) (-1258.023) -- 0:00:48 184000 -- (-1260.182) (-1258.261) (-1259.030) [-1256.877] * [-1255.888] (-1261.519) (-1261.288) (-1260.502) -- 0:00:48 184500 -- [-1258.525] (-1256.926) (-1259.105) (-1256.228) * [-1255.908] (-1260.008) (-1260.230) (-1259.271) -- 0:00:48 185000 -- [-1257.207] (-1260.688) (-1257.131) (-1258.183) * (-1255.928) (-1260.332) [-1256.994] (-1257.067) -- 0:00:52 Average standard deviation of split frequencies: 0.018628 185500 -- (-1257.102) [-1259.165] (-1257.953) (-1258.282) * (-1256.807) (-1257.906) [-1257.246] (-1256.397) -- 0:00:52 186000 -- [-1257.063] (-1259.010) (-1257.627) (-1258.228) * (-1256.086) (-1257.595) (-1257.604) [-1256.393] -- 0:00:52 186500 -- (-1257.269) (-1257.522) (-1261.622) [-1256.413] * (-1256.666) [-1257.810] (-1258.024) (-1256.218) -- 0:00:52 187000 -- (-1256.931) (-1259.020) (-1260.743) [-1258.259] * (-1256.415) (-1258.232) [-1257.342] (-1257.440) -- 0:00:52 187500 -- [-1257.339] (-1258.382) (-1259.095) (-1257.943) * (-1256.414) [-1257.300] (-1257.012) (-1256.964) -- 0:00:52 188000 -- [-1258.437] (-1259.204) (-1258.158) (-1256.044) * (-1257.959) (-1258.056) [-1259.088] (-1256.791) -- 0:00:51 188500 -- (-1259.218) (-1257.038) (-1258.948) [-1256.654] * [-1258.715] (-1259.216) (-1256.606) (-1258.124) -- 0:00:51 189000 -- (-1263.980) (-1257.801) [-1258.351] (-1257.649) * [-1258.484] (-1259.669) (-1256.706) (-1257.016) -- 0:00:51 189500 -- [-1259.016] (-1256.143) (-1260.029) (-1258.065) * (-1258.015) (-1260.013) (-1260.827) [-1256.662] -- 0:00:51 190000 -- (-1258.409) (-1257.467) [-1257.590] (-1260.396) * (-1257.056) [-1260.947] (-1258.535) (-1256.483) -- 0:00:51 Average standard deviation of split frequencies: 0.018680 190500 -- (-1258.948) (-1257.677) [-1258.211] (-1258.555) * (-1258.753) (-1258.594) (-1259.526) [-1258.747] -- 0:00:50 191000 -- (-1260.323) (-1258.739) (-1260.247) [-1257.876] * [-1258.682] (-1257.500) (-1256.373) (-1257.571) -- 0:00:50 191500 -- (-1260.026) (-1260.340) [-1258.702] (-1256.523) * (-1257.766) (-1257.839) [-1256.463] (-1257.031) -- 0:00:50 192000 -- (-1257.651) [-1258.815] (-1263.236) (-1256.176) * (-1256.985) (-1257.851) (-1256.674) [-1257.288] -- 0:00:50 192500 -- (-1258.868) (-1258.439) [-1258.750] (-1258.747) * [-1258.204] (-1257.789) (-1256.674) (-1258.120) -- 0:00:50 193000 -- (-1260.428) (-1260.281) (-1258.545) [-1260.293] * [-1260.371] (-1257.054) (-1255.988) (-1259.764) -- 0:00:50 193500 -- (-1257.815) [-1260.517] (-1258.245) (-1258.059) * (-1258.973) (-1260.117) [-1256.013] (-1257.328) -- 0:00:50 194000 -- (-1257.508) (-1257.234) (-1259.040) [-1256.537] * (-1259.214) (-1262.912) (-1260.832) [-1256.926] -- 0:00:49 194500 -- (-1257.604) (-1263.217) [-1261.637] (-1258.294) * (-1260.136) (-1262.776) (-1260.840) [-1256.220] -- 0:00:49 195000 -- (-1257.020) (-1257.929) [-1263.319] (-1257.626) * (-1263.052) (-1257.748) [-1261.516] (-1259.100) -- 0:00:49 Average standard deviation of split frequencies: 0.018840 195500 -- (-1258.860) (-1256.401) [-1259.804] (-1257.545) * (-1257.979) (-1257.557) [-1258.631] (-1258.982) -- 0:00:49 196000 -- (-1259.830) (-1258.077) [-1259.997] (-1258.647) * [-1258.094] (-1258.214) (-1260.061) (-1257.881) -- 0:00:49 196500 -- (-1259.071) [-1258.783] (-1258.405) (-1258.497) * (-1257.053) (-1257.505) [-1259.372] (-1259.344) -- 0:00:49 197000 -- [-1261.511] (-1258.253) (-1257.076) (-1256.813) * (-1259.692) (-1259.299) [-1257.768] (-1260.605) -- 0:00:48 197500 -- (-1257.166) [-1260.693] (-1260.292) (-1260.501) * (-1258.160) [-1257.848] (-1258.885) (-1258.915) -- 0:00:48 198000 -- [-1258.374] (-1258.129) (-1260.059) (-1257.216) * (-1256.054) (-1258.725) (-1257.550) [-1257.686] -- 0:00:48 198500 -- (-1262.420) (-1257.138) [-1256.651] (-1258.441) * [-1259.128] (-1261.950) (-1257.623) (-1261.715) -- 0:00:48 199000 -- (-1260.190) (-1257.402) [-1256.634] (-1262.114) * (-1259.126) (-1257.396) [-1257.392] (-1259.623) -- 0:00:48 199500 -- [-1256.697] (-1256.653) (-1261.237) (-1265.401) * (-1257.876) (-1258.769) [-1257.583] (-1266.073) -- 0:00:48 200000 -- (-1256.754) (-1259.457) [-1256.722] (-1256.240) * (-1258.090) (-1261.545) [-1258.800] (-1262.197) -- 0:00:51 Average standard deviation of split frequencies: 0.018271 200500 -- [-1256.700] (-1260.028) (-1257.391) (-1258.616) * (-1258.232) (-1259.980) [-1257.031] (-1256.968) -- 0:00:51 201000 -- (-1262.167) (-1256.679) (-1257.782) [-1259.444] * (-1256.550) (-1259.351) [-1258.876] (-1257.652) -- 0:00:51 201500 -- (-1259.840) (-1256.990) [-1257.326] (-1260.030) * (-1258.747) (-1259.410) [-1258.125] (-1260.867) -- 0:00:51 202000 -- [-1258.114] (-1256.797) (-1257.550) (-1258.035) * (-1257.894) [-1257.438] (-1257.816) (-1257.550) -- 0:00:51 202500 -- [-1258.740] (-1256.737) (-1258.130) (-1258.234) * [-1259.139] (-1257.028) (-1258.756) (-1257.657) -- 0:00:51 203000 -- (-1256.995) (-1257.024) (-1258.632) [-1258.102] * [-1257.127] (-1259.481) (-1259.599) (-1258.777) -- 0:00:51 203500 -- [-1256.707] (-1256.936) (-1257.474) (-1257.008) * (-1258.234) (-1256.449) (-1257.024) [-1258.361] -- 0:00:50 204000 -- (-1256.714) [-1257.731] (-1257.306) (-1257.567) * (-1257.576) (-1263.539) (-1258.640) [-1257.269] -- 0:00:50 204500 -- (-1261.780) (-1258.221) [-1256.739] (-1257.770) * (-1257.580) (-1257.852) [-1258.581] (-1259.695) -- 0:00:50 205000 -- (-1260.551) [-1256.737] (-1258.601) (-1260.807) * (-1258.662) [-1256.756] (-1258.503) (-1257.737) -- 0:00:50 Average standard deviation of split frequencies: 0.017417 205500 -- (-1258.944) (-1256.929) (-1257.915) [-1259.910] * [-1260.801] (-1258.252) (-1257.054) (-1261.601) -- 0:00:50 206000 -- (-1258.040) (-1258.620) (-1259.669) [-1261.652] * [-1256.404] (-1262.821) (-1257.113) (-1261.671) -- 0:00:50 206500 -- [-1258.418] (-1256.680) (-1264.982) (-1258.879) * (-1256.668) (-1259.196) [-1259.238] (-1258.824) -- 0:00:49 207000 -- (-1260.058) (-1261.662) [-1269.446] (-1256.416) * [-1256.623] (-1259.403) (-1257.848) (-1258.041) -- 0:00:49 207500 -- (-1258.088) (-1261.444) (-1261.035) [-1260.526] * [-1260.501] (-1257.727) (-1258.094) (-1256.770) -- 0:00:49 208000 -- (-1257.722) (-1261.327) [-1256.288] (-1260.784) * (-1257.793) (-1258.792) [-1260.308] (-1261.671) -- 0:00:49 208500 -- (-1257.538) (-1258.325) [-1256.663] (-1260.497) * [-1259.132] (-1259.445) (-1257.768) (-1260.632) -- 0:00:49 209000 -- (-1262.040) [-1258.120] (-1255.949) (-1258.609) * (-1260.729) (-1261.538) (-1259.902) [-1259.357] -- 0:00:49 209500 -- (-1261.806) (-1257.033) (-1256.707) [-1259.115] * (-1263.367) (-1260.334) (-1258.694) [-1258.195] -- 0:00:49 210000 -- (-1257.884) (-1257.672) (-1260.276) [-1257.798] * (-1264.271) (-1259.492) [-1259.853] (-1257.541) -- 0:00:48 Average standard deviation of split frequencies: 0.015539 210500 -- (-1257.853) [-1258.332] (-1260.870) (-1257.436) * (-1256.602) (-1258.395) [-1262.308] (-1259.799) -- 0:00:48 211000 -- [-1256.504] (-1258.823) (-1262.312) (-1256.632) * (-1259.467) (-1259.060) (-1259.048) [-1259.655] -- 0:00:48 211500 -- (-1257.253) (-1259.038) [-1259.574] (-1256.632) * (-1261.469) (-1258.944) [-1261.032] (-1257.003) -- 0:00:48 212000 -- (-1256.865) [-1257.968] (-1256.192) (-1261.116) * (-1260.503) [-1262.160] (-1257.148) (-1256.802) -- 0:00:48 212500 -- [-1257.967] (-1258.634) (-1256.132) (-1260.624) * [-1264.442] (-1259.948) (-1257.189) (-1257.587) -- 0:00:48 213000 -- (-1257.839) [-1263.169] (-1257.262) (-1257.825) * (-1263.215) (-1259.849) [-1258.373] (-1259.088) -- 0:00:48 213500 -- (-1259.386) (-1263.002) (-1256.968) [-1258.015] * (-1258.476) [-1260.967] (-1257.611) (-1259.251) -- 0:00:47 214000 -- (-1258.178) (-1258.093) (-1258.912) [-1259.087] * (-1256.610) [-1256.160] (-1257.346) (-1261.145) -- 0:00:51 214500 -- [-1260.223] (-1257.616) (-1258.311) (-1257.252) * (-1258.716) (-1258.017) [-1256.528] (-1262.209) -- 0:00:51 215000 -- [-1260.141] (-1257.684) (-1259.990) (-1257.097) * (-1257.321) [-1258.271] (-1256.585) (-1259.122) -- 0:00:51 Average standard deviation of split frequencies: 0.015883 215500 -- (-1259.806) (-1259.584) (-1257.378) [-1258.105] * (-1256.390) (-1256.432) (-1256.913) [-1258.610] -- 0:00:50 216000 -- (-1258.975) [-1256.560] (-1256.787) (-1259.743) * (-1257.020) [-1259.070] (-1257.394) (-1257.768) -- 0:00:50 216500 -- [-1258.440] (-1256.302) (-1257.543) (-1260.081) * (-1259.185) [-1261.212] (-1256.192) (-1257.603) -- 0:00:50 217000 -- (-1260.309) [-1257.861] (-1256.875) (-1259.560) * (-1260.170) (-1259.837) (-1256.795) [-1257.122] -- 0:00:50 217500 -- [-1258.755] (-1257.554) (-1258.609) (-1260.284) * (-1261.266) (-1260.104) [-1255.935] (-1257.469) -- 0:00:50 218000 -- (-1261.824) (-1257.695) [-1259.114] (-1259.436) * (-1259.421) [-1257.502] (-1256.338) (-1257.369) -- 0:00:50 218500 -- (-1259.626) [-1257.820] (-1258.223) (-1259.356) * (-1258.597) (-1256.553) [-1256.646] (-1258.385) -- 0:00:50 219000 -- [-1259.237] (-1256.468) (-1257.627) (-1257.494) * (-1256.617) [-1262.971] (-1256.769) (-1258.345) -- 0:00:49 219500 -- (-1259.559) [-1258.594] (-1259.791) (-1257.013) * (-1258.680) (-1256.820) (-1257.304) [-1257.388] -- 0:00:49 220000 -- (-1259.305) (-1260.063) [-1256.689] (-1259.230) * [-1256.544] (-1261.346) (-1258.128) (-1257.987) -- 0:00:49 Average standard deviation of split frequencies: 0.015666 220500 -- (-1261.734) (-1260.010) (-1256.455) [-1260.338] * [-1257.148] (-1258.765) (-1258.626) (-1256.002) -- 0:00:49 221000 -- (-1259.546) [-1257.409] (-1257.118) (-1260.786) * (-1256.210) (-1257.862) [-1256.466] (-1257.376) -- 0:00:49 221500 -- (-1259.398) [-1256.773] (-1257.843) (-1256.404) * (-1257.148) [-1259.705] (-1257.168) (-1257.388) -- 0:00:49 222000 -- (-1258.064) (-1256.904) [-1256.304] (-1257.874) * (-1258.807) (-1257.853) [-1258.874] (-1259.022) -- 0:00:49 222500 -- (-1257.753) (-1258.151) [-1256.446] (-1260.807) * (-1257.479) [-1258.406] (-1257.073) (-1256.985) -- 0:00:48 223000 -- (-1260.933) (-1261.223) (-1257.552) [-1258.794] * (-1256.869) [-1257.201] (-1257.737) (-1258.531) -- 0:00:48 223500 -- (-1261.532) (-1256.652) [-1259.686] (-1257.245) * (-1256.861) (-1257.270) (-1258.808) [-1258.767] -- 0:00:48 224000 -- (-1261.126) (-1257.267) [-1258.917] (-1257.181) * [-1260.523] (-1260.719) (-1257.530) (-1259.548) -- 0:00:48 224500 -- (-1262.191) [-1256.730] (-1258.176) (-1257.724) * (-1260.574) (-1260.393) [-1257.440] (-1258.049) -- 0:00:48 225000 -- (-1258.355) [-1257.741] (-1256.641) (-1259.627) * (-1257.936) (-1258.746) [-1257.354] (-1256.075) -- 0:00:48 Average standard deviation of split frequencies: 0.015412 225500 -- [-1258.302] (-1260.485) (-1257.418) (-1262.996) * (-1257.802) (-1258.617) (-1256.842) [-1257.400] -- 0:00:48 226000 -- (-1259.452) (-1261.018) [-1257.675] (-1260.374) * (-1257.883) [-1257.466] (-1257.486) (-1259.414) -- 0:00:47 226500 -- (-1258.457) (-1259.854) [-1256.609] (-1260.541) * [-1257.323] (-1256.608) (-1259.671) (-1257.805) -- 0:00:47 227000 -- (-1257.480) [-1258.730] (-1256.325) (-1257.155) * (-1258.616) (-1256.870) (-1257.072) [-1257.403] -- 0:00:47 227500 -- (-1257.017) (-1258.307) [-1257.823] (-1257.394) * (-1261.238) (-1259.266) (-1258.633) [-1261.303] -- 0:00:50 228000 -- (-1258.431) (-1256.939) (-1256.242) [-1257.573] * [-1260.717] (-1259.266) (-1257.891) (-1261.304) -- 0:00:50 228500 -- (-1257.334) [-1258.438] (-1258.558) (-1257.357) * (-1258.859) (-1257.181) (-1257.764) [-1256.826] -- 0:00:50 229000 -- (-1260.726) [-1258.788] (-1258.678) (-1258.755) * (-1259.967) [-1257.584] (-1257.576) (-1258.234) -- 0:00:50 229500 -- [-1263.473] (-1258.992) (-1257.113) (-1258.258) * (-1259.737) [-1257.650] (-1261.615) (-1258.549) -- 0:00:50 230000 -- (-1258.845) [-1256.459] (-1257.340) (-1259.430) * [-1258.946] (-1257.650) (-1256.918) (-1259.319) -- 0:00:50 Average standard deviation of split frequencies: 0.015668 230500 -- (-1261.431) (-1257.284) (-1260.547) [-1259.658] * (-1257.675) (-1257.057) [-1257.534] (-1263.101) -- 0:00:50 231000 -- [-1258.782] (-1257.016) (-1256.944) (-1259.183) * (-1259.957) [-1260.574] (-1257.933) (-1259.696) -- 0:00:49 231500 -- (-1258.943) (-1257.391) [-1256.944] (-1259.195) * (-1259.794) (-1256.951) [-1259.320] (-1257.298) -- 0:00:49 232000 -- (-1258.439) (-1257.097) (-1258.931) [-1256.710] * [-1259.093] (-1256.852) (-1259.377) (-1257.943) -- 0:00:49 232500 -- (-1258.108) [-1259.316] (-1258.144) (-1256.711) * (-1256.999) (-1256.853) (-1257.738) [-1260.313] -- 0:00:49 233000 -- (-1257.230) (-1258.868) [-1256.797] (-1256.711) * (-1256.321) [-1258.325] (-1257.342) (-1259.160) -- 0:00:49 233500 -- (-1261.171) [-1259.922] (-1257.126) (-1256.711) * [-1257.598] (-1258.037) (-1260.521) (-1257.450) -- 0:00:49 234000 -- (-1259.393) [-1258.845] (-1256.273) (-1257.875) * (-1257.352) (-1256.811) (-1261.931) [-1256.695] -- 0:00:49 234500 -- (-1258.989) [-1258.045] (-1256.268) (-1258.587) * (-1267.504) (-1257.126) (-1260.122) [-1260.020] -- 0:00:48 235000 -- (-1260.095) (-1257.364) (-1256.082) [-1257.733] * (-1262.000) [-1257.778] (-1261.754) (-1258.752) -- 0:00:48 Average standard deviation of split frequencies: 0.014981 235500 -- (-1261.509) [-1257.325] (-1256.050) (-1258.496) * [-1257.192] (-1255.935) (-1259.039) (-1256.752) -- 0:00:48 236000 -- [-1258.453] (-1257.795) (-1257.331) (-1257.888) * (-1264.941) (-1257.862) (-1257.710) [-1257.685] -- 0:00:48 236500 -- [-1257.320] (-1257.249) (-1257.081) (-1259.442) * [-1257.174] (-1257.067) (-1259.798) (-1257.166) -- 0:00:48 237000 -- (-1257.180) (-1257.854) (-1258.023) [-1259.434] * (-1258.215) (-1256.786) [-1258.257] (-1257.567) -- 0:00:48 237500 -- (-1257.258) (-1257.154) (-1257.100) [-1256.805] * [-1257.759] (-1255.827) (-1257.020) (-1257.408) -- 0:00:48 238000 -- (-1258.200) (-1258.433) [-1258.773] (-1257.658) * (-1259.512) (-1259.896) (-1258.080) [-1257.152] -- 0:00:48 238500 -- (-1259.265) (-1256.758) (-1257.868) [-1257.707] * (-1257.972) [-1261.099] (-1260.147) (-1258.893) -- 0:00:47 239000 -- (-1257.148) (-1259.005) (-1257.790) [-1257.683] * (-1260.753) (-1256.657) (-1257.934) [-1258.443] -- 0:00:47 239500 -- (-1257.761) (-1260.821) [-1258.902] (-1258.185) * (-1262.216) (-1256.310) (-1258.023) [-1261.322] -- 0:00:47 240000 -- (-1258.196) (-1257.239) [-1259.183] (-1258.974) * [-1263.229] (-1258.831) (-1260.316) (-1261.526) -- 0:00:47 Average standard deviation of split frequencies: 0.014582 240500 -- (-1258.522) [-1258.067] (-1258.019) (-1262.529) * (-1260.780) (-1256.801) [-1258.543] (-1259.114) -- 0:00:47 241000 -- (-1258.073) [-1259.140] (-1258.354) (-1263.982) * (-1260.410) (-1259.548) [-1256.267] (-1256.909) -- 0:00:47 241500 -- (-1257.208) (-1257.515) [-1259.706] (-1264.547) * [-1259.887] (-1257.869) (-1256.609) (-1266.342) -- 0:00:47 242000 -- (-1258.652) [-1260.803] (-1260.010) (-1262.454) * [-1258.131] (-1259.064) (-1256.171) (-1256.637) -- 0:00:46 242500 -- (-1257.296) [-1260.887] (-1263.133) (-1260.236) * (-1257.447) (-1258.358) (-1256.327) [-1258.735] -- 0:00:46 243000 -- (-1259.070) [-1259.796] (-1260.836) (-1259.256) * (-1257.492) (-1257.125) (-1256.323) [-1256.830] -- 0:00:49 243500 -- [-1257.795] (-1259.458) (-1257.754) (-1258.741) * (-1258.140) (-1260.202) (-1257.997) [-1257.271] -- 0:00:49 244000 -- (-1261.462) (-1257.991) [-1259.591] (-1258.158) * (-1258.857) (-1256.564) (-1259.383) [-1256.312] -- 0:00:49 244500 -- (-1257.792) (-1259.536) (-1258.758) [-1259.703] * [-1262.695] (-1257.235) (-1262.175) (-1256.433) -- 0:00:49 245000 -- (-1259.682) (-1261.558) (-1257.769) [-1257.122] * (-1257.812) (-1258.472) [-1259.814] (-1256.557) -- 0:00:49 Average standard deviation of split frequencies: 0.013414 245500 -- (-1259.353) (-1261.387) (-1258.011) [-1259.642] * (-1259.952) (-1258.144) (-1257.865) [-1257.299] -- 0:00:49 246000 -- (-1261.549) (-1262.176) [-1257.045] (-1258.048) * (-1260.838) (-1262.307) [-1257.903] (-1257.043) -- 0:00:49 246500 -- (-1257.584) [-1258.618] (-1259.679) (-1258.601) * (-1259.486) (-1258.838) [-1259.796] (-1258.707) -- 0:00:48 247000 -- (-1256.927) [-1260.968] (-1257.371) (-1258.135) * [-1256.767] (-1257.068) (-1259.355) (-1259.190) -- 0:00:48 247500 -- (-1257.331) [-1258.842] (-1257.861) (-1260.578) * (-1257.248) (-1256.810) [-1260.034] (-1259.719) -- 0:00:48 248000 -- (-1260.226) (-1257.693) [-1257.626] (-1259.380) * (-1257.474) (-1258.017) [-1257.680] (-1259.528) -- 0:00:48 248500 -- (-1259.192) [-1257.254] (-1258.232) (-1258.632) * [-1257.774] (-1257.122) (-1258.377) (-1260.297) -- 0:00:48 249000 -- (-1257.453) (-1260.319) (-1259.608) [-1259.605] * [-1256.653] (-1258.194) (-1260.104) (-1257.001) -- 0:00:48 249500 -- (-1261.740) (-1262.519) [-1256.793] (-1258.777) * (-1257.965) (-1257.644) [-1256.546] (-1259.065) -- 0:00:48 250000 -- (-1262.237) (-1259.805) (-1264.841) [-1257.467] * (-1258.867) (-1257.088) [-1257.605] (-1259.569) -- 0:00:48 Average standard deviation of split frequencies: 0.014522 250500 -- (-1257.692) [-1258.981] (-1261.051) (-1257.763) * (-1258.222) (-1257.631) (-1256.694) [-1257.928] -- 0:00:47 251000 -- [-1258.337] (-1259.641) (-1261.658) (-1257.774) * [-1258.476] (-1256.468) (-1255.930) (-1258.583) -- 0:00:47 251500 -- (-1257.126) (-1258.976) (-1267.915) [-1257.487] * (-1257.616) [-1257.219] (-1257.347) (-1257.908) -- 0:00:47 252000 -- (-1258.497) (-1259.959) (-1264.451) [-1257.655] * [-1256.900] (-1260.357) (-1257.642) (-1257.705) -- 0:00:47 252500 -- (-1256.349) [-1258.391] (-1262.073) (-1257.282) * (-1256.837) (-1261.415) [-1257.546] (-1258.520) -- 0:00:47 253000 -- (-1260.841) (-1256.406) [-1256.405] (-1260.494) * [-1258.427] (-1256.976) (-1256.386) (-1257.829) -- 0:00:47 253500 -- (-1259.832) (-1261.012) [-1260.363] (-1258.723) * (-1257.445) (-1257.250) [-1258.448] (-1258.262) -- 0:00:47 254000 -- [-1257.607] (-1258.722) (-1263.235) (-1259.613) * (-1258.748) (-1258.002) [-1257.962] (-1259.705) -- 0:00:46 254500 -- (-1257.050) (-1256.570) (-1259.661) [-1257.175] * (-1257.399) (-1256.980) [-1260.226] (-1256.483) -- 0:00:46 255000 -- (-1257.223) (-1259.291) [-1260.682] (-1258.087) * (-1257.365) [-1256.975] (-1260.049) (-1258.122) -- 0:00:46 Average standard deviation of split frequencies: 0.015345 255500 -- (-1256.796) (-1256.490) (-1257.103) [-1261.331] * (-1258.629) (-1263.753) (-1259.663) [-1257.045] -- 0:00:46 256000 -- [-1256.908] (-1257.891) (-1258.188) (-1258.921) * (-1257.053) (-1258.526) [-1256.290] (-1257.305) -- 0:00:46 256500 -- (-1256.510) (-1265.083) (-1257.198) [-1258.411] * (-1259.082) (-1257.716) [-1256.685] (-1257.383) -- 0:00:46 257000 -- (-1256.985) [-1258.428] (-1262.499) (-1257.432) * (-1259.199) [-1258.226] (-1261.245) (-1259.830) -- 0:00:46 257500 -- (-1256.532) (-1259.127) (-1265.239) [-1259.030] * [-1257.196] (-1257.375) (-1257.773) (-1263.781) -- 0:00:46 258000 -- (-1259.356) (-1263.195) (-1260.534) [-1256.643] * (-1257.036) [-1256.833] (-1257.775) (-1259.952) -- 0:00:46 258500 -- (-1261.305) (-1259.782) [-1260.987] (-1257.078) * (-1263.559) (-1258.269) (-1260.379) [-1256.180] -- 0:00:45 259000 -- [-1261.741] (-1259.076) (-1258.393) (-1259.972) * (-1258.883) (-1261.565) (-1257.408) [-1258.418] -- 0:00:48 259500 -- (-1259.131) (-1256.361) [-1260.200] (-1261.170) * (-1260.657) (-1261.993) (-1259.716) [-1266.008] -- 0:00:48 260000 -- (-1258.888) (-1258.509) [-1259.237] (-1258.376) * (-1256.288) [-1259.421] (-1258.993) (-1263.972) -- 0:00:48 Average standard deviation of split frequencies: 0.014870 260500 -- (-1259.099) (-1256.473) (-1257.587) [-1256.712] * [-1256.652] (-1258.004) (-1258.446) (-1261.537) -- 0:00:48 261000 -- (-1258.162) (-1260.360) [-1256.079] (-1257.614) * (-1257.144) (-1256.659) [-1258.228] (-1265.905) -- 0:00:48 261500 -- (-1258.058) (-1259.187) (-1256.844) [-1258.034] * [-1257.533] (-1257.036) (-1258.280) (-1263.982) -- 0:00:48 262000 -- (-1258.009) (-1257.162) (-1256.204) [-1257.181] * (-1256.279) (-1257.412) [-1257.453] (-1258.167) -- 0:00:47 262500 -- (-1257.020) [-1257.194] (-1259.059) (-1258.510) * (-1256.776) [-1256.464] (-1257.629) (-1260.621) -- 0:00:47 263000 -- (-1256.906) [-1257.906] (-1259.916) (-1259.091) * (-1257.435) (-1257.532) (-1260.820) [-1260.407] -- 0:00:47 263500 -- (-1257.427) (-1258.310) [-1256.994] (-1259.508) * (-1260.239) (-1259.747) (-1261.847) [-1261.087] -- 0:00:47 264000 -- (-1256.887) (-1257.555) [-1258.540] (-1258.343) * (-1259.962) (-1259.215) [-1258.725] (-1257.972) -- 0:00:47 264500 -- (-1258.427) [-1259.647] (-1261.688) (-1258.343) * [-1257.680] (-1260.094) (-1257.666) (-1259.018) -- 0:00:47 265000 -- [-1258.564] (-1260.520) (-1261.195) (-1258.615) * [-1259.936] (-1262.104) (-1257.678) (-1258.741) -- 0:00:47 Average standard deviation of split frequencies: 0.014374 265500 -- (-1259.005) (-1256.801) [-1259.228] (-1256.268) * (-1257.978) [-1258.710] (-1259.421) (-1260.322) -- 0:00:47 266000 -- (-1259.494) (-1256.959) (-1259.297) [-1262.731] * (-1259.314) (-1259.199) (-1259.099) [-1259.214] -- 0:00:46 266500 -- (-1259.020) (-1256.669) (-1258.504) [-1257.158] * (-1258.266) (-1258.406) [-1259.703] (-1256.288) -- 0:00:46 267000 -- (-1259.925) (-1257.830) (-1257.619) [-1262.509] * (-1259.310) (-1259.479) (-1258.601) [-1256.450] -- 0:00:46 267500 -- (-1258.387) [-1256.180] (-1257.845) (-1258.629) * (-1258.822) (-1256.675) (-1258.291) [-1256.614] -- 0:00:46 268000 -- [-1257.000] (-1259.434) (-1256.769) (-1259.261) * (-1258.171) [-1259.558] (-1261.699) (-1257.079) -- 0:00:46 268500 -- (-1259.258) (-1259.280) (-1256.768) [-1259.235] * [-1259.802] (-1258.296) (-1259.066) (-1259.118) -- 0:00:46 269000 -- (-1257.804) [-1258.955] (-1256.318) (-1259.701) * (-1257.794) (-1257.032) (-1259.379) [-1257.361] -- 0:00:46 269500 -- (-1261.135) (-1258.813) [-1259.528] (-1257.434) * (-1257.686) (-1257.720) (-1260.091) [-1259.057] -- 0:00:46 270000 -- (-1257.215) [-1258.905] (-1256.884) (-1259.005) * [-1256.286] (-1257.517) (-1259.144) (-1257.615) -- 0:00:45 Average standard deviation of split frequencies: 0.014804 270500 -- [-1256.219] (-1259.997) (-1259.355) (-1260.294) * (-1259.106) (-1259.922) [-1261.656] (-1259.439) -- 0:00:45 271000 -- (-1256.654) (-1259.948) [-1259.574] (-1257.600) * (-1258.380) (-1259.111) (-1258.992) [-1257.894] -- 0:00:45 271500 -- (-1257.844) (-1260.222) [-1259.232] (-1256.592) * (-1257.750) [-1258.394] (-1260.369) (-1257.847) -- 0:00:45 272000 -- (-1257.887) [-1259.881] (-1257.642) (-1257.335) * (-1257.424) (-1259.480) [-1257.638] (-1260.017) -- 0:00:45 272500 -- (-1258.698) (-1257.005) [-1256.244] (-1259.811) * [-1259.809] (-1261.451) (-1257.974) (-1259.006) -- 0:00:45 273000 -- [-1256.719] (-1257.451) (-1258.235) (-1259.722) * (-1256.904) (-1258.071) [-1258.158] (-1258.368) -- 0:00:45 273500 -- [-1257.116] (-1258.711) (-1258.417) (-1258.310) * [-1256.924] (-1257.602) (-1258.200) (-1258.706) -- 0:00:45 274000 -- [-1257.976] (-1257.851) (-1258.416) (-1259.617) * (-1258.911) (-1256.114) [-1256.410] (-1257.661) -- 0:00:45 274500 -- [-1257.665] (-1264.680) (-1258.344) (-1261.475) * (-1259.110) [-1256.961] (-1258.533) (-1257.686) -- 0:00:44 275000 -- (-1259.072) (-1259.550) [-1259.458] (-1258.154) * (-1263.147) (-1257.793) [-1262.931] (-1259.088) -- 0:00:47 Average standard deviation of split frequencies: 0.014992 275500 -- (-1258.644) (-1257.758) (-1259.021) [-1257.897] * (-1264.035) [-1256.785] (-1259.759) (-1256.814) -- 0:00:47 276000 -- [-1257.834] (-1258.613) (-1257.527) (-1257.283) * (-1261.407) (-1257.360) [-1256.871] (-1257.098) -- 0:00:47 276500 -- (-1256.913) (-1257.158) (-1257.978) [-1262.055] * (-1259.152) (-1258.159) (-1256.555) [-1257.492] -- 0:00:47 277000 -- (-1258.621) (-1257.381) [-1259.184] (-1258.816) * (-1258.420) (-1256.925) [-1256.572] (-1261.719) -- 0:00:46 277500 -- [-1257.756] (-1258.357) (-1258.718) (-1256.606) * (-1259.749) (-1259.102) [-1260.987] (-1263.308) -- 0:00:46 278000 -- (-1263.289) (-1259.299) [-1258.280] (-1259.092) * (-1259.293) (-1260.523) [-1265.354] (-1259.397) -- 0:00:46 278500 -- (-1260.448) (-1257.835) (-1258.685) [-1257.671] * (-1258.435) (-1260.173) [-1257.413] (-1257.080) -- 0:00:46 279000 -- (-1262.292) [-1257.272] (-1258.995) (-1260.526) * (-1258.034) (-1258.167) [-1257.104] (-1256.946) -- 0:00:46 279500 -- (-1259.596) (-1257.562) (-1259.639) [-1258.301] * (-1260.899) (-1258.167) [-1258.677] (-1258.084) -- 0:00:46 280000 -- (-1259.071) [-1259.133] (-1259.926) (-1258.271) * (-1258.723) (-1258.400) (-1259.020) [-1258.203] -- 0:00:46 Average standard deviation of split frequencies: 0.015293 280500 -- (-1256.691) (-1258.131) [-1258.104] (-1261.554) * (-1259.723) [-1258.353] (-1256.104) (-1256.618) -- 0:00:46 281000 -- [-1258.978] (-1257.093) (-1257.917) (-1261.537) * [-1258.228] (-1256.040) (-1260.015) (-1256.068) -- 0:00:46 281500 -- (-1260.178) (-1256.998) [-1258.230] (-1257.221) * (-1258.399) (-1256.260) (-1260.540) [-1256.422] -- 0:00:45 282000 -- (-1260.321) (-1257.159) [-1259.162] (-1257.226) * [-1258.851] (-1256.260) (-1257.960) (-1256.231) -- 0:00:45 282500 -- (-1257.295) [-1257.553] (-1258.388) (-1257.760) * (-1260.056) (-1256.260) [-1258.405] (-1256.375) -- 0:00:45 283000 -- [-1257.885] (-1257.371) (-1257.647) (-1257.777) * (-1261.769) [-1256.272] (-1260.233) (-1260.896) -- 0:00:45 283500 -- (-1268.018) (-1257.842) [-1256.225] (-1258.880) * (-1260.270) (-1260.892) (-1260.858) [-1258.165] -- 0:00:45 284000 -- (-1259.320) (-1258.472) (-1258.833) [-1258.112] * (-1259.261) [-1257.049] (-1257.995) (-1258.303) -- 0:00:45 284500 -- (-1258.667) (-1258.704) (-1258.159) [-1257.867] * (-1258.834) (-1257.889) [-1257.709] (-1258.883) -- 0:00:45 285000 -- (-1260.695) (-1258.470) [-1257.964] (-1257.895) * (-1258.250) (-1257.727) [-1256.706] (-1260.883) -- 0:00:45 Average standard deviation of split frequencies: 0.015615 285500 -- (-1259.043) [-1258.304] (-1258.527) (-1258.714) * (-1256.258) (-1258.667) (-1257.285) [-1258.519] -- 0:00:45 286000 -- (-1260.959) (-1257.757) [-1258.708] (-1258.686) * [-1258.640] (-1261.521) (-1258.959) (-1260.248) -- 0:00:44 286500 -- [-1256.452] (-1259.459) (-1257.163) (-1259.234) * (-1257.017) (-1258.526) [-1257.159] (-1258.413) -- 0:00:44 287000 -- (-1258.070) [-1256.384] (-1258.789) (-1263.576) * (-1256.508) [-1258.191] (-1258.907) (-1258.450) -- 0:00:44 287500 -- [-1260.012] (-1261.098) (-1261.094) (-1259.225) * [-1257.987] (-1260.889) (-1258.106) (-1257.874) -- 0:00:44 288000 -- (-1260.833) (-1259.402) [-1261.982] (-1258.886) * (-1256.502) (-1257.347) [-1261.108] (-1259.375) -- 0:00:44 288500 -- (-1256.441) [-1257.249] (-1258.615) (-1256.280) * (-1258.029) (-1256.743) (-1259.571) [-1258.775] -- 0:00:44 289000 -- (-1258.692) (-1257.815) (-1263.216) [-1256.355] * (-1256.328) (-1257.119) [-1260.562] (-1256.466) -- 0:00:44 289500 -- (-1256.492) (-1258.653) (-1260.550) [-1256.896] * (-1261.648) [-1257.693] (-1258.498) (-1258.850) -- 0:00:44 290000 -- [-1257.366] (-1258.466) (-1258.958) (-1256.074) * (-1258.074) [-1258.784] (-1259.865) (-1260.038) -- 0:00:44 Average standard deviation of split frequencies: 0.014767 290500 -- (-1259.425) (-1257.277) (-1257.065) [-1256.808] * (-1258.990) (-1257.349) [-1259.466] (-1259.204) -- 0:00:43 291000 -- (-1257.786) (-1258.477) (-1256.720) [-1256.324] * (-1258.308) (-1260.089) (-1259.392) [-1258.629] -- 0:00:46 291500 -- (-1256.767) (-1258.854) [-1256.211] (-1257.659) * [-1258.288] (-1256.857) (-1259.074) (-1258.618) -- 0:00:46 292000 -- [-1256.677] (-1260.877) (-1257.387) (-1263.296) * (-1259.731) (-1257.374) [-1259.311] (-1260.650) -- 0:00:46 292500 -- (-1260.085) (-1257.490) (-1256.521) [-1258.485] * [-1258.588] (-1259.086) (-1257.672) (-1259.154) -- 0:00:45 293000 -- [-1258.444] (-1256.286) (-1257.038) (-1257.896) * (-1258.600) (-1258.085) (-1259.644) [-1260.007] -- 0:00:45 293500 -- [-1256.103] (-1256.606) (-1258.927) (-1261.544) * (-1263.142) (-1256.739) (-1258.203) [-1260.453] -- 0:00:45 294000 -- [-1259.858] (-1256.964) (-1258.236) (-1256.850) * (-1258.982) [-1257.135] (-1259.160) (-1260.822) -- 0:00:45 294500 -- (-1259.728) [-1257.258] (-1257.213) (-1257.965) * (-1256.500) [-1256.173] (-1257.647) (-1257.555) -- 0:00:45 295000 -- (-1260.578) (-1259.940) (-1258.023) [-1258.290] * (-1256.505) [-1256.315] (-1258.026) (-1257.858) -- 0:00:45 Average standard deviation of split frequencies: 0.014510 295500 -- (-1260.276) (-1259.052) [-1256.310] (-1259.143) * (-1256.893) (-1261.727) [-1255.905] (-1260.111) -- 0:00:45 296000 -- (-1257.326) [-1258.595] (-1258.892) (-1260.761) * (-1256.533) (-1262.195) (-1255.991) [-1259.560] -- 0:00:45 296500 -- (-1259.316) (-1257.426) [-1257.398] (-1262.826) * (-1256.567) (-1259.869) (-1256.189) [-1257.060] -- 0:00:45 297000 -- [-1257.122] (-1257.194) (-1256.829) (-1256.170) * [-1256.561] (-1261.441) (-1256.482) (-1257.373) -- 0:00:44 297500 -- [-1258.495] (-1259.181) (-1257.090) (-1263.291) * (-1257.742) [-1258.969] (-1256.482) (-1256.679) -- 0:00:44 298000 -- (-1258.091) (-1260.563) (-1257.908) [-1259.421] * [-1257.188] (-1260.866) (-1256.722) (-1258.323) -- 0:00:44 298500 -- (-1257.535) (-1259.468) (-1258.757) [-1257.573] * (-1256.920) (-1258.111) (-1256.716) [-1257.129] -- 0:00:44 299000 -- [-1256.572] (-1256.934) (-1258.550) (-1257.281) * [-1257.642] (-1258.173) (-1258.010) (-1258.787) -- 0:00:44 299500 -- (-1257.516) [-1256.947] (-1258.383) (-1259.366) * (-1260.513) (-1258.142) (-1259.276) [-1258.256] -- 0:00:44 300000 -- [-1262.139] (-1256.528) (-1258.497) (-1259.603) * (-1261.881) [-1259.169] (-1259.927) (-1260.262) -- 0:00:44 Average standard deviation of split frequencies: 0.013240 300500 -- (-1260.351) [-1257.100] (-1257.615) (-1257.743) * [-1256.566] (-1259.352) (-1257.598) (-1264.428) -- 0:00:44 301000 -- (-1260.053) (-1257.459) [-1256.516] (-1261.149) * (-1259.181) (-1258.576) [-1257.824] (-1263.254) -- 0:00:44 301500 -- (-1258.638) (-1257.410) [-1256.632] (-1256.976) * (-1260.127) (-1258.134) (-1262.866) [-1257.206] -- 0:00:44 302000 -- (-1259.558) (-1259.935) (-1256.804) [-1258.189] * [-1256.696] (-1258.518) (-1259.259) (-1256.040) -- 0:00:43 302500 -- (-1258.402) (-1258.471) (-1261.091) [-1259.516] * (-1257.116) (-1261.273) [-1257.481] (-1258.847) -- 0:00:43 303000 -- (-1259.316) (-1258.939) [-1257.568] (-1260.413) * (-1258.181) (-1258.320) (-1256.582) [-1257.755] -- 0:00:43 303500 -- (-1256.972) (-1260.145) (-1257.548) [-1259.486] * (-1257.343) (-1257.592) [-1256.740] (-1259.194) -- 0:00:43 304000 -- (-1257.131) (-1260.494) [-1257.938] (-1258.729) * (-1257.786) [-1257.291] (-1256.755) (-1259.844) -- 0:00:43 304500 -- (-1258.106) (-1261.212) (-1257.685) [-1257.767] * (-1257.445) (-1261.027) [-1257.360] (-1259.743) -- 0:00:43 305000 -- (-1260.801) (-1261.070) [-1261.712] (-1257.933) * [-1256.637] (-1263.419) (-1257.892) (-1263.037) -- 0:00:43 Average standard deviation of split frequencies: 0.012667 305500 -- (-1257.912) (-1258.820) (-1262.444) [-1258.994] * [-1257.397] (-1258.777) (-1258.491) (-1271.418) -- 0:00:43 306000 -- (-1256.807) (-1258.429) [-1258.276] (-1259.130) * [-1257.581] (-1258.667) (-1258.193) (-1263.034) -- 0:00:43 306500 -- (-1256.394) [-1258.591] (-1258.457) (-1261.032) * (-1262.674) (-1259.106) [-1257.527] (-1256.687) -- 0:00:45 307000 -- (-1258.160) (-1256.042) (-1257.785) [-1260.887] * (-1257.833) [-1256.742] (-1257.532) (-1259.661) -- 0:00:45 307500 -- (-1257.995) (-1258.590) (-1257.949) [-1257.742] * [-1259.794] (-1256.804) (-1256.598) (-1258.686) -- 0:00:45 308000 -- (-1256.987) [-1257.719] (-1259.896) (-1260.795) * (-1256.438) (-1259.405) (-1258.125) [-1258.213] -- 0:00:44 308500 -- (-1257.383) (-1258.785) [-1258.551] (-1262.471) * (-1256.438) [-1256.443] (-1257.543) (-1257.537) -- 0:00:44 309000 -- (-1256.714) (-1258.769) [-1258.112] (-1259.716) * (-1256.180) (-1258.539) [-1258.690] (-1257.526) -- 0:00:44 309500 -- (-1257.345) (-1260.967) [-1257.233] (-1256.674) * [-1256.180] (-1257.501) (-1256.779) (-1261.714) -- 0:00:44 310000 -- [-1256.596] (-1258.968) (-1257.769) (-1259.802) * (-1255.985) (-1259.718) [-1258.412] (-1259.758) -- 0:00:44 Average standard deviation of split frequencies: 0.011886 310500 -- (-1256.786) (-1258.993) [-1259.046] (-1256.461) * (-1256.846) (-1257.663) (-1257.142) [-1259.380] -- 0:00:44 311000 -- (-1261.981) (-1259.042) (-1259.002) [-1257.232] * [-1256.339] (-1261.343) (-1256.422) (-1257.134) -- 0:00:44 311500 -- (-1260.759) (-1258.492) (-1258.496) [-1256.830] * (-1256.046) (-1258.095) [-1257.326] (-1257.512) -- 0:00:44 312000 -- (-1259.693) [-1257.658] (-1260.255) (-1257.248) * [-1256.852] (-1261.508) (-1257.110) (-1259.646) -- 0:00:44 312500 -- (-1262.235) (-1256.985) (-1257.310) [-1258.915] * (-1259.410) [-1257.781] (-1257.936) (-1260.491) -- 0:00:44 313000 -- (-1260.510) [-1258.046] (-1259.137) (-1258.296) * [-1256.752] (-1260.586) (-1256.849) (-1259.255) -- 0:00:43 313500 -- (-1265.885) [-1258.472] (-1259.481) (-1261.914) * (-1258.622) [-1259.734] (-1256.589) (-1259.354) -- 0:00:43 314000 -- [-1257.809] (-1259.579) (-1259.298) (-1260.010) * (-1258.854) [-1260.939] (-1256.594) (-1258.750) -- 0:00:43 314500 -- (-1258.917) (-1259.409) [-1257.920] (-1260.329) * [-1259.708] (-1261.731) (-1257.143) (-1257.664) -- 0:00:43 315000 -- (-1258.850) (-1258.508) [-1257.534] (-1258.949) * (-1261.072) (-1259.119) [-1256.658] (-1257.241) -- 0:00:43 Average standard deviation of split frequencies: 0.012514 315500 -- [-1258.804] (-1259.978) (-1256.990) (-1258.962) * (-1258.346) (-1259.874) [-1257.001] (-1257.234) -- 0:00:43 316000 -- (-1267.040) (-1258.145) (-1256.987) [-1257.653] * (-1259.909) (-1262.919) (-1259.412) [-1256.680] -- 0:00:43 316500 -- (-1259.975) (-1259.322) [-1256.753] (-1257.083) * [-1258.189] (-1257.743) (-1257.328) (-1258.559) -- 0:00:43 317000 -- (-1258.877) (-1258.356) (-1256.959) [-1263.416] * (-1259.476) [-1258.727] (-1257.240) (-1257.539) -- 0:00:43 317500 -- [-1258.741] (-1256.596) (-1259.098) (-1259.144) * [-1260.027] (-1256.786) (-1257.406) (-1257.537) -- 0:00:42 318000 -- (-1264.122) [-1257.819] (-1258.768) (-1258.014) * (-1259.737) [-1256.529] (-1259.088) (-1258.467) -- 0:00:42 318500 -- (-1258.755) (-1256.714) (-1257.880) [-1259.084] * (-1258.830) [-1257.072] (-1259.916) (-1260.036) -- 0:00:42 319000 -- (-1258.072) (-1259.822) (-1258.905) [-1256.702] * (-1258.217) (-1256.243) [-1261.005] (-1258.119) -- 0:00:42 319500 -- (-1259.723) (-1259.998) [-1259.408] (-1257.237) * (-1258.217) [-1258.147] (-1256.767) (-1257.032) -- 0:00:42 320000 -- (-1257.532) [-1257.033] (-1259.616) (-1257.298) * [-1256.438] (-1258.507) (-1258.652) (-1258.830) -- 0:00:42 Average standard deviation of split frequencies: 0.013231 320500 -- (-1261.953) [-1258.658] (-1261.514) (-1259.529) * (-1256.446) (-1259.216) (-1259.846) [-1257.452] -- 0:00:42 321000 -- (-1258.587) (-1256.872) [-1257.568] (-1256.204) * (-1256.402) [-1258.464] (-1257.608) (-1257.378) -- 0:00:42 321500 -- (-1257.387) (-1259.568) [-1258.312] (-1256.750) * (-1260.731) [-1256.965] (-1258.739) (-1258.889) -- 0:00:42 322000 -- (-1256.612) (-1259.468) [-1259.219] (-1260.072) * (-1258.528) (-1257.138) (-1257.294) [-1257.735] -- 0:00:42 322500 -- (-1258.946) (-1257.059) [-1260.907] (-1259.147) * (-1258.623) [-1259.356] (-1257.353) (-1260.345) -- 0:00:44 323000 -- [-1257.116] (-1256.960) (-1262.247) (-1258.660) * (-1258.313) (-1260.804) (-1260.085) [-1261.433] -- 0:00:44 323500 -- (-1256.606) (-1257.645) [-1259.959] (-1257.324) * (-1259.024) [-1260.381] (-1257.661) (-1258.003) -- 0:00:43 324000 -- (-1256.930) (-1261.150) (-1264.376) [-1258.270] * (-1259.385) (-1260.454) (-1257.837) [-1260.234] -- 0:00:43 324500 -- [-1256.506] (-1259.014) (-1257.795) (-1257.451) * (-1259.249) [-1256.454] (-1257.536) (-1256.277) -- 0:00:43 325000 -- (-1257.884) (-1261.728) [-1258.111] (-1264.260) * (-1256.937) (-1256.614) (-1257.081) [-1259.499] -- 0:00:43 Average standard deviation of split frequencies: 0.012854 325500 -- (-1257.384) (-1259.503) [-1259.142] (-1257.505) * (-1263.163) [-1256.873] (-1257.288) (-1257.517) -- 0:00:43 326000 -- (-1258.025) (-1259.700) (-1258.792) [-1258.536] * (-1259.086) (-1257.936) [-1257.484] (-1257.238) -- 0:00:43 326500 -- (-1259.322) (-1259.459) [-1256.723] (-1257.310) * (-1259.098) (-1256.381) [-1256.236] (-1258.045) -- 0:00:43 327000 -- [-1260.195] (-1258.039) (-1256.805) (-1258.110) * [-1259.524] (-1260.335) (-1257.275) (-1258.326) -- 0:00:43 327500 -- (-1260.377) (-1257.603) (-1256.742) [-1257.821] * (-1256.214) [-1257.830] (-1258.520) (-1259.088) -- 0:00:43 328000 -- (-1259.577) [-1261.051] (-1259.574) (-1259.726) * (-1259.072) (-1257.412) [-1258.744] (-1260.898) -- 0:00:43 328500 -- [-1256.883] (-1257.895) (-1261.637) (-1257.889) * (-1256.956) (-1258.758) [-1257.898] (-1260.327) -- 0:00:42 329000 -- (-1261.043) (-1256.965) (-1258.765) [-1257.239] * (-1257.010) (-1256.973) (-1258.526) [-1257.351] -- 0:00:42 329500 -- (-1261.740) (-1257.752) (-1257.380) [-1257.128] * (-1256.981) [-1257.670] (-1257.027) (-1259.340) -- 0:00:42 330000 -- (-1257.759) (-1256.368) [-1257.859] (-1259.749) * (-1259.749) (-1258.964) (-1256.992) [-1257.097] -- 0:00:42 Average standard deviation of split frequencies: 0.013543 330500 -- (-1257.366) [-1256.666] (-1259.620) (-1260.528) * (-1258.339) (-1258.700) (-1256.925) [-1257.829] -- 0:00:42 331000 -- (-1256.691) [-1257.562] (-1258.666) (-1261.055) * (-1258.452) (-1269.433) [-1256.605] (-1260.873) -- 0:00:42 331500 -- [-1257.727] (-1260.547) (-1259.294) (-1259.775) * (-1257.753) (-1260.259) (-1257.001) [-1258.611] -- 0:00:42 332000 -- (-1256.212) (-1264.492) (-1257.122) [-1257.184] * [-1259.759] (-1259.128) (-1256.186) (-1256.779) -- 0:00:42 332500 -- [-1256.921] (-1258.904) (-1256.431) (-1257.214) * (-1257.118) (-1257.929) [-1256.448] (-1257.519) -- 0:00:42 333000 -- (-1257.461) (-1258.233) [-1257.908] (-1260.303) * (-1257.336) (-1263.148) [-1258.342] (-1259.241) -- 0:00:42 333500 -- (-1259.310) (-1257.416) [-1258.198] (-1259.880) * [-1256.944] (-1259.162) (-1256.804) (-1260.622) -- 0:00:41 334000 -- (-1257.768) (-1260.277) [-1259.267] (-1260.805) * (-1257.239) (-1260.676) (-1259.894) [-1259.251] -- 0:00:41 334500 -- (-1261.128) [-1261.334] (-1259.677) (-1256.950) * (-1259.925) [-1256.182] (-1257.075) (-1258.517) -- 0:00:41 335000 -- [-1260.377] (-1258.529) (-1259.991) (-1257.464) * (-1256.964) (-1256.335) [-1256.646] (-1256.175) -- 0:00:41 Average standard deviation of split frequencies: 0.013562 335500 -- [-1257.968] (-1259.527) (-1257.252) (-1257.611) * (-1259.682) (-1257.711) (-1258.315) [-1257.983] -- 0:00:41 336000 -- (-1257.109) [-1257.793] (-1259.300) (-1258.573) * [-1259.075] (-1257.674) (-1261.032) (-1257.488) -- 0:00:41 336500 -- (-1256.915) (-1258.765) (-1258.981) [-1258.815] * (-1258.776) (-1259.884) [-1257.388] (-1260.308) -- 0:00:41 337000 -- (-1259.438) [-1259.334] (-1258.212) (-1261.718) * (-1260.424) (-1260.007) [-1257.652] (-1260.593) -- 0:00:41 337500 -- (-1258.937) (-1260.328) (-1258.382) [-1257.612] * (-1259.079) (-1257.423) (-1263.492) [-1260.034] -- 0:00:41 338000 -- (-1260.203) (-1260.077) (-1257.364) [-1256.810] * (-1258.931) (-1257.822) [-1256.997] (-1263.539) -- 0:00:43 338500 -- (-1259.410) [-1260.481] (-1257.151) (-1257.789) * (-1257.472) (-1261.943) [-1256.989] (-1262.112) -- 0:00:42 339000 -- (-1257.966) [-1259.687] (-1258.276) (-1258.824) * (-1259.327) [-1259.014] (-1256.969) (-1261.271) -- 0:00:42 339500 -- [-1257.646] (-1259.158) (-1257.953) (-1257.512) * (-1261.132) (-1256.962) [-1257.852] (-1259.469) -- 0:00:42 340000 -- (-1260.640) (-1257.805) (-1257.554) [-1258.025] * (-1258.290) (-1256.259) (-1256.900) [-1259.703] -- 0:00:42 Average standard deviation of split frequencies: 0.013838 340500 -- (-1261.461) (-1259.135) (-1262.356) [-1256.992] * [-1256.635] (-1256.163) (-1257.029) (-1256.734) -- 0:00:42 341000 -- (-1262.025) (-1258.778) [-1256.193] (-1262.699) * (-1260.070) (-1259.561) [-1258.090] (-1258.321) -- 0:00:42 341500 -- (-1257.524) (-1260.004) [-1256.506] (-1262.902) * (-1257.933) (-1257.728) [-1258.654] (-1258.210) -- 0:00:42 342000 -- (-1258.193) [-1261.453] (-1257.372) (-1258.382) * (-1259.805) (-1257.478) [-1259.005] (-1259.676) -- 0:00:42 342500 -- (-1259.242) [-1257.924] (-1256.555) (-1257.716) * [-1258.083] (-1259.979) (-1258.812) (-1263.223) -- 0:00:42 343000 -- (-1258.095) (-1262.963) (-1258.061) [-1259.026] * (-1259.877) (-1257.499) [-1259.214] (-1257.616) -- 0:00:42 343500 -- (-1258.111) (-1258.911) [-1257.196] (-1257.494) * [-1258.312] (-1259.333) (-1256.673) (-1262.037) -- 0:00:42 344000 -- (-1257.962) (-1260.157) (-1259.630) [-1256.902] * (-1259.545) [-1256.792] (-1257.093) (-1260.441) -- 0:00:41 344500 -- (-1260.078) (-1260.616) [-1267.870] (-1258.186) * (-1258.133) (-1256.415) (-1258.456) [-1263.035] -- 0:00:41 345000 -- [-1259.399] (-1258.844) (-1260.034) (-1258.202) * [-1258.898] (-1257.860) (-1257.587) (-1258.607) -- 0:00:41 Average standard deviation of split frequencies: 0.014055 345500 -- (-1259.417) (-1261.202) [-1258.818] (-1265.092) * [-1256.993] (-1258.436) (-1256.290) (-1257.372) -- 0:00:41 346000 -- (-1259.148) [-1259.440] (-1259.722) (-1258.578) * [-1256.323] (-1259.205) (-1256.290) (-1257.323) -- 0:00:41 346500 -- (-1257.859) (-1257.351) (-1262.324) [-1256.877] * [-1257.837] (-1257.786) (-1259.760) (-1259.088) -- 0:00:41 347000 -- (-1257.906) [-1256.608] (-1257.677) (-1256.870) * (-1256.178) (-1257.740) (-1262.997) [-1258.879] -- 0:00:41 347500 -- (-1257.716) (-1259.609) (-1257.510) [-1256.914] * (-1256.823) [-1257.496] (-1258.796) (-1256.866) -- 0:00:41 348000 -- (-1256.424) [-1260.791] (-1256.816) (-1256.792) * (-1260.204) (-1258.284) [-1259.386] (-1256.712) -- 0:00:41 348500 -- [-1257.231] (-1261.000) (-1258.102) (-1257.018) * [-1261.617] (-1257.896) (-1256.973) (-1258.887) -- 0:00:41 349000 -- (-1258.866) (-1258.047) (-1257.569) [-1256.705] * (-1258.695) [-1258.237] (-1258.633) (-1258.351) -- 0:00:41 349500 -- (-1256.454) (-1258.989) [-1257.738] (-1258.002) * (-1259.802) (-1263.092) [-1261.237] (-1259.151) -- 0:00:40 350000 -- (-1257.612) (-1256.907) [-1257.953] (-1259.796) * (-1260.052) (-1256.298) (-1257.725) [-1259.930] -- 0:00:40 Average standard deviation of split frequencies: 0.013070 350500 -- [-1256.672] (-1256.947) (-1261.418) (-1257.259) * (-1257.334) (-1256.315) (-1256.709) [-1257.866] -- 0:00:40 351000 -- (-1259.647) [-1256.676] (-1260.497) (-1257.961) * [-1260.181] (-1257.426) (-1261.260) (-1260.546) -- 0:00:40 351500 -- (-1258.105) (-1257.726) (-1259.206) [-1259.289] * (-1261.739) (-1257.122) [-1257.238] (-1261.313) -- 0:00:40 352000 -- [-1258.806] (-1256.923) (-1256.858) (-1256.243) * (-1260.442) [-1256.394] (-1257.020) (-1259.697) -- 0:00:40 352500 -- [-1260.670] (-1257.657) (-1259.473) (-1256.901) * [-1260.172] (-1260.131) (-1256.355) (-1263.829) -- 0:00:40 353000 -- (-1257.957) [-1259.020] (-1258.428) (-1256.196) * (-1261.952) [-1259.988] (-1258.079) (-1256.067) -- 0:00:40 353500 -- [-1259.005] (-1258.726) (-1258.605) (-1260.448) * [-1258.344] (-1259.960) (-1258.195) (-1257.719) -- 0:00:42 354000 -- (-1257.441) (-1258.118) (-1261.143) [-1257.951] * (-1261.428) (-1258.969) (-1260.003) [-1258.890] -- 0:00:41 354500 -- (-1257.101) [-1258.049] (-1259.872) (-1260.203) * (-1257.861) (-1256.755) [-1258.686] (-1257.632) -- 0:00:41 355000 -- [-1256.661] (-1257.826) (-1259.340) (-1258.512) * (-1257.615) [-1256.150] (-1259.765) (-1257.692) -- 0:00:41 Average standard deviation of split frequencies: 0.013381 355500 -- (-1257.265) [-1257.851] (-1258.423) (-1262.073) * (-1257.678) (-1256.602) [-1260.980] (-1257.702) -- 0:00:41 356000 -- [-1256.149] (-1258.103) (-1259.054) (-1264.320) * [-1256.941] (-1256.466) (-1260.047) (-1256.986) -- 0:00:41 356500 -- (-1259.964) [-1260.957] (-1258.187) (-1266.316) * (-1261.600) [-1256.619] (-1257.355) (-1256.818) -- 0:00:41 357000 -- (-1261.706) (-1256.819) [-1258.198] (-1261.904) * [-1256.353] (-1258.665) (-1260.310) (-1256.320) -- 0:00:41 357500 -- (-1262.008) (-1257.213) (-1257.054) [-1260.098] * (-1267.612) (-1259.727) (-1265.767) [-1256.103] -- 0:00:41 358000 -- (-1259.776) (-1259.440) [-1256.546] (-1258.842) * (-1258.828) (-1257.188) [-1256.457] (-1256.400) -- 0:00:41 358500 -- (-1259.541) [-1256.928] (-1257.588) (-1257.718) * [-1257.611] (-1257.533) (-1256.645) (-1257.536) -- 0:00:41 359000 -- (-1261.143) (-1257.058) [-1257.799] (-1257.250) * (-1257.915) [-1257.881] (-1256.407) (-1257.946) -- 0:00:41 359500 -- [-1256.849] (-1258.208) (-1258.106) (-1258.271) * (-1263.042) (-1257.538) (-1256.767) [-1257.540] -- 0:00:40 360000 -- (-1259.088) [-1256.476] (-1259.268) (-1258.552) * (-1261.157) (-1257.417) (-1256.093) [-1256.616] -- 0:00:40 Average standard deviation of split frequencies: 0.012520 360500 -- [-1258.775] (-1257.102) (-1258.962) (-1264.159) * (-1258.713) [-1258.902] (-1257.651) (-1256.301) -- 0:00:40 361000 -- (-1258.056) (-1260.437) (-1259.827) [-1260.737] * (-1259.676) [-1259.924] (-1260.338) (-1260.405) -- 0:00:40 361500 -- [-1257.177] (-1260.308) (-1257.268) (-1259.919) * (-1259.673) (-1261.263) (-1265.697) [-1259.711] -- 0:00:40 362000 -- (-1257.234) (-1258.580) (-1258.138) [-1257.214] * [-1258.111] (-1258.370) (-1260.460) (-1262.107) -- 0:00:40 362500 -- (-1256.129) [-1258.665] (-1261.262) (-1259.664) * [-1257.318] (-1259.452) (-1256.563) (-1257.421) -- 0:00:40 363000 -- (-1260.978) [-1256.890] (-1258.674) (-1262.635) * (-1258.234) (-1259.332) [-1260.117] (-1260.526) -- 0:00:40 363500 -- [-1263.927] (-1257.326) (-1257.255) (-1257.948) * (-1258.686) [-1258.614] (-1260.638) (-1259.004) -- 0:00:40 364000 -- (-1258.277) (-1256.467) [-1257.231] (-1256.757) * (-1260.218) [-1256.925] (-1259.484) (-1259.408) -- 0:00:40 364500 -- (-1256.730) (-1256.330) [-1258.331] (-1258.147) * (-1259.367) (-1256.657) [-1256.959] (-1260.642) -- 0:00:40 365000 -- [-1256.730] (-1256.331) (-1256.717) (-1257.045) * (-1257.503) [-1257.654] (-1258.127) (-1258.666) -- 0:00:40 Average standard deviation of split frequencies: 0.012202 365500 -- (-1256.730) [-1256.585] (-1265.012) (-1259.377) * (-1256.665) (-1257.409) [-1257.134] (-1259.097) -- 0:00:39 366000 -- (-1257.789) [-1258.023] (-1258.482) (-1258.582) * (-1257.283) (-1257.552) [-1258.644] (-1256.913) -- 0:00:39 366500 -- (-1257.828) (-1261.137) (-1258.675) [-1261.410] * (-1257.328) (-1256.698) [-1257.363] (-1258.996) -- 0:00:39 367000 -- (-1261.217) (-1264.503) [-1258.845] (-1260.803) * (-1260.074) (-1258.202) (-1259.141) [-1257.832] -- 0:00:39 367500 -- (-1258.467) (-1261.070) [-1257.631] (-1257.650) * (-1257.490) [-1258.963] (-1262.046) (-1261.777) -- 0:00:39 368000 -- (-1257.943) (-1259.877) [-1256.966] (-1256.143) * [-1256.325] (-1258.892) (-1263.134) (-1260.925) -- 0:00:39 368500 -- (-1259.264) (-1259.937) (-1256.969) [-1261.681] * (-1258.943) (-1261.309) [-1259.140] (-1257.781) -- 0:00:39 369000 -- [-1260.402] (-1260.737) (-1259.563) (-1257.775) * (-1257.359) [-1256.432] (-1265.025) (-1258.833) -- 0:00:39 369500 -- (-1262.591) [-1257.176] (-1261.769) (-1257.775) * (-1259.144) [-1257.183] (-1260.861) (-1258.350) -- 0:00:40 370000 -- (-1261.115) (-1259.256) (-1258.236) [-1256.915] * [-1259.683] (-1259.616) (-1258.928) (-1256.414) -- 0:00:40 Average standard deviation of split frequencies: 0.012115 370500 -- (-1258.550) (-1259.263) [-1260.333] (-1257.480) * (-1258.441) (-1257.765) [-1260.062] (-1258.699) -- 0:00:40 371000 -- [-1256.396] (-1257.377) (-1260.485) (-1257.070) * (-1257.368) (-1258.579) [-1256.802] (-1260.747) -- 0:00:40 371500 -- (-1257.494) (-1260.368) (-1259.164) [-1257.484] * (-1257.535) (-1257.699) [-1258.227] (-1258.632) -- 0:00:40 372000 -- [-1258.047] (-1258.620) (-1259.143) (-1258.495) * (-1258.858) [-1256.556] (-1256.639) (-1260.552) -- 0:00:40 372500 -- (-1256.472) [-1257.173] (-1259.038) (-1257.967) * (-1258.510) [-1256.554] (-1257.624) (-1258.795) -- 0:00:40 373000 -- (-1256.472) [-1256.511] (-1258.326) (-1257.984) * (-1263.513) (-1258.252) [-1256.551] (-1258.128) -- 0:00:40 373500 -- (-1261.125) (-1260.447) (-1257.608) [-1258.332] * (-1261.594) [-1263.439] (-1257.508) (-1261.459) -- 0:00:40 374000 -- (-1257.507) (-1256.648) [-1258.345] (-1256.595) * [-1258.767] (-1258.226) (-1257.463) (-1262.884) -- 0:00:40 374500 -- (-1258.246) (-1260.871) [-1257.208] (-1257.272) * [-1257.371] (-1262.218) (-1259.205) (-1262.294) -- 0:00:40 375000 -- (-1260.416) [-1260.069] (-1257.520) (-1258.446) * (-1258.047) (-1261.019) (-1259.114) [-1257.563] -- 0:00:40 Average standard deviation of split frequencies: 0.011680 375500 -- [-1262.106] (-1261.445) (-1257.741) (-1257.552) * [-1256.896] (-1262.358) (-1259.223) (-1260.089) -- 0:00:39 376000 -- (-1257.456) (-1258.868) (-1258.323) [-1256.539] * (-1257.637) (-1264.330) [-1257.134] (-1259.533) -- 0:00:39 376500 -- [-1258.280] (-1260.327) (-1258.209) (-1259.595) * (-1256.669) (-1257.752) [-1257.180] (-1258.307) -- 0:00:39 377000 -- (-1257.504) (-1259.607) (-1257.523) [-1256.731] * (-1258.177) [-1258.518] (-1256.989) (-1256.872) -- 0:00:39 377500 -- (-1257.822) [-1258.197] (-1260.950) (-1256.990) * [-1258.562] (-1258.061) (-1257.592) (-1256.959) -- 0:00:39 378000 -- (-1258.196) (-1257.893) [-1257.714] (-1256.919) * (-1261.086) (-1260.779) [-1260.479] (-1262.450) -- 0:00:39 378500 -- [-1259.166] (-1261.608) (-1260.918) (-1256.462) * (-1261.122) (-1257.179) [-1259.162] (-1258.730) -- 0:00:39 379000 -- (-1259.766) (-1258.264) [-1258.573] (-1258.375) * (-1263.503) (-1261.542) [-1259.038] (-1261.420) -- 0:00:39 379500 -- (-1256.668) (-1259.279) [-1257.666] (-1256.170) * [-1257.041] (-1260.024) (-1259.318) (-1259.440) -- 0:00:39 380000 -- (-1261.271) (-1263.351) (-1258.532) [-1256.461] * [-1256.684] (-1260.457) (-1258.168) (-1259.474) -- 0:00:39 Average standard deviation of split frequencies: 0.010939 380500 -- [-1261.271] (-1257.386) (-1260.487) (-1259.338) * (-1257.164) [-1259.626] (-1256.187) (-1259.935) -- 0:00:39 381000 -- (-1259.325) [-1258.708] (-1257.722) (-1258.919) * (-1256.928) [-1258.506] (-1259.607) (-1258.287) -- 0:00:38 381500 -- (-1257.738) (-1260.868) [-1257.190] (-1258.048) * (-1261.260) [-1257.052] (-1261.220) (-1262.088) -- 0:00:38 382000 -- (-1256.601) (-1261.212) (-1260.745) [-1256.747] * [-1256.769] (-1258.144) (-1258.623) (-1258.960) -- 0:00:38 382500 -- (-1259.153) (-1258.199) [-1258.274] (-1260.015) * (-1260.233) (-1259.095) (-1257.346) [-1257.292] -- 0:00:38 383000 -- (-1261.608) (-1256.097) [-1256.649] (-1256.485) * [-1260.113] (-1259.851) (-1260.799) (-1260.450) -- 0:00:38 383500 -- [-1257.992] (-1256.460) (-1255.963) (-1257.979) * (-1258.677) (-1256.653) [-1260.135] (-1258.816) -- 0:00:38 384000 -- (-1259.143) (-1259.953) (-1258.073) [-1259.883] * (-1257.537) (-1257.399) [-1257.314] (-1259.150) -- 0:00:38 384500 -- (-1258.235) (-1256.169) (-1258.080) [-1257.761] * [-1256.538] (-1258.970) (-1257.166) (-1258.638) -- 0:00:38 385000 -- [-1259.685] (-1257.174) (-1258.840) (-1259.788) * (-1259.374) (-1261.066) [-1259.101] (-1263.495) -- 0:00:38 Average standard deviation of split frequencies: 0.010788 385500 -- (-1258.083) (-1259.040) [-1259.082] (-1261.806) * [-1257.627] (-1259.237) (-1259.263) (-1259.948) -- 0:00:38 386000 -- [-1258.654] (-1257.760) (-1258.425) (-1261.176) * [-1259.756] (-1258.470) (-1257.387) (-1258.515) -- 0:00:39 386500 -- (-1258.257) (-1257.431) (-1257.209) [-1258.324] * (-1258.548) (-1257.496) (-1256.997) [-1256.321] -- 0:00:39 387000 -- (-1257.100) (-1257.018) (-1257.180) [-1260.905] * [-1259.778] (-1257.235) (-1258.186) (-1256.178) -- 0:00:39 387500 -- (-1259.022) (-1257.239) [-1256.964] (-1256.828) * (-1259.238) (-1257.750) (-1256.722) [-1256.178] -- 0:00:39 388000 -- (-1261.188) (-1259.358) (-1257.827) [-1257.740] * [-1257.820] (-1257.147) (-1261.340) (-1259.297) -- 0:00:39 388500 -- (-1260.856) [-1259.441] (-1257.677) (-1257.756) * (-1266.240) [-1257.141] (-1264.014) (-1257.429) -- 0:00:39 389000 -- (-1258.793) (-1257.045) (-1258.015) [-1258.362] * (-1261.144) (-1260.394) (-1258.261) [-1257.044] -- 0:00:39 389500 -- (-1258.289) (-1259.291) (-1259.169) [-1257.967] * (-1257.373) [-1256.303] (-1258.299) (-1258.078) -- 0:00:39 390000 -- (-1261.645) (-1259.064) [-1256.613] (-1259.347) * (-1258.504) (-1259.194) (-1258.286) [-1260.377] -- 0:00:39 Average standard deviation of split frequencies: 0.011262 390500 -- (-1257.478) (-1258.102) (-1256.603) [-1256.772] * (-1257.825) [-1261.722] (-1265.107) (-1257.920) -- 0:00:39 391000 -- (-1257.598) (-1257.892) [-1256.963] (-1257.655) * (-1257.429) [-1257.753] (-1257.002) (-1260.262) -- 0:00:38 391500 -- (-1257.611) (-1256.925) [-1258.810] (-1258.056) * (-1257.136) (-1256.852) (-1258.192) [-1256.675] -- 0:00:38 392000 -- (-1257.767) (-1260.383) (-1258.710) [-1257.973] * (-1257.151) [-1257.352] (-1258.890) (-1258.341) -- 0:00:38 392500 -- [-1261.120] (-1259.180) (-1259.300) (-1259.130) * [-1258.398] (-1258.430) (-1258.673) (-1256.740) -- 0:00:38 393000 -- [-1261.032] (-1258.796) (-1257.773) (-1258.327) * (-1257.681) [-1258.277] (-1259.709) (-1257.688) -- 0:00:38 393500 -- (-1258.617) (-1258.855) (-1256.966) [-1258.607] * [-1256.865] (-1258.907) (-1261.752) (-1258.592) -- 0:00:38 394000 -- (-1257.754) (-1259.195) [-1258.514] (-1257.440) * [-1257.217] (-1258.890) (-1258.914) (-1261.044) -- 0:00:38 394500 -- [-1256.699] (-1257.263) (-1258.076) (-1259.184) * (-1259.812) (-1257.561) (-1260.540) [-1262.626] -- 0:00:38 395000 -- (-1258.048) (-1259.095) [-1258.851] (-1257.796) * [-1259.916] (-1259.783) (-1260.529) (-1261.229) -- 0:00:38 Average standard deviation of split frequencies: 0.011134 395500 -- (-1258.707) (-1261.262) [-1257.395] (-1261.693) * (-1260.501) (-1260.478) [-1258.196] (-1260.861) -- 0:00:38 396000 -- (-1257.770) (-1258.332) [-1257.265] (-1257.399) * [-1257.565] (-1259.881) (-1258.615) (-1259.258) -- 0:00:38 396500 -- [-1257.800] (-1259.917) (-1259.068) (-1259.018) * (-1258.199) (-1257.524) (-1257.552) [-1258.923] -- 0:00:38 397000 -- (-1259.356) (-1256.475) (-1257.478) [-1257.164] * (-1258.725) [-1258.286] (-1257.320) (-1259.599) -- 0:00:37 397500 -- (-1258.555) (-1256.517) (-1256.996) [-1260.159] * (-1256.597) (-1262.517) (-1257.443) [-1256.616] -- 0:00:37 398000 -- (-1261.455) [-1262.009] (-1262.832) (-1265.311) * (-1259.214) (-1257.978) [-1258.271] (-1258.049) -- 0:00:37 398500 -- [-1257.504] (-1263.771) (-1259.314) (-1262.411) * (-1258.294) [-1258.562] (-1259.572) (-1257.333) -- 0:00:37 399000 -- (-1258.583) (-1256.803) [-1257.795] (-1260.616) * (-1257.069) (-1259.665) (-1259.379) [-1258.233] -- 0:00:37 399500 -- (-1259.657) (-1256.705) (-1261.120) [-1259.217] * (-1256.985) [-1260.538] (-1257.511) (-1258.591) -- 0:00:37 400000 -- (-1262.423) [-1256.291] (-1261.965) (-1258.049) * (-1255.991) (-1259.197) (-1259.442) [-1259.352] -- 0:00:37 Average standard deviation of split frequencies: 0.011251 400500 -- (-1258.466) [-1259.138] (-1259.631) (-1258.103) * [-1256.356] (-1256.702) (-1258.623) (-1256.188) -- 0:00:37 401000 -- (-1256.535) (-1261.007) (-1257.196) [-1260.197] * [-1258.397] (-1260.833) (-1258.147) (-1256.475) -- 0:00:37 401500 -- (-1260.617) (-1263.125) [-1257.053] (-1258.395) * (-1257.508) (-1257.231) (-1257.833) [-1256.347] -- 0:00:37 402000 -- (-1260.402) (-1262.520) (-1258.483) [-1259.184] * (-1257.378) (-1265.660) [-1261.299] (-1259.005) -- 0:00:38 402500 -- [-1258.188] (-1260.448) (-1260.236) (-1259.350) * (-1261.512) [-1259.914] (-1256.992) (-1256.411) -- 0:00:38 403000 -- (-1259.824) [-1258.261] (-1259.569) (-1256.804) * (-1258.103) (-1258.889) (-1260.851) [-1261.826] -- 0:00:38 403500 -- (-1259.561) [-1256.949] (-1258.065) (-1258.875) * (-1256.455) [-1261.143] (-1256.336) (-1260.181) -- 0:00:38 404000 -- (-1258.056) (-1258.588) [-1257.426] (-1258.684) * (-1256.906) (-1261.258) [-1256.680] (-1261.401) -- 0:00:38 404500 -- (-1256.218) (-1259.126) (-1257.349) [-1257.476] * (-1259.260) (-1257.198) (-1257.083) [-1256.930] -- 0:00:38 405000 -- [-1256.473] (-1259.626) (-1257.295) (-1260.473) * (-1258.957) (-1256.892) (-1255.943) [-1258.087] -- 0:00:38 Average standard deviation of split frequencies: 0.012650 405500 -- (-1256.677) (-1257.362) (-1257.906) [-1260.536] * [-1257.863] (-1257.305) (-1256.451) (-1257.774) -- 0:00:38 406000 -- (-1259.290) (-1256.449) [-1258.212] (-1258.517) * [-1259.120] (-1257.134) (-1256.892) (-1257.399) -- 0:00:38 406500 -- (-1258.207) [-1257.506] (-1257.153) (-1258.434) * (-1257.049) (-1259.795) [-1256.822] (-1257.540) -- 0:00:37 407000 -- (-1260.130) (-1258.705) (-1258.474) [-1257.721] * (-1256.546) (-1257.435) (-1263.249) [-1258.455] -- 0:00:37 407500 -- [-1257.718] (-1258.182) (-1256.834) (-1259.516) * (-1256.525) (-1256.923) (-1257.931) [-1257.543] -- 0:00:37 408000 -- [-1257.175] (-1257.617) (-1257.919) (-1259.967) * (-1257.471) (-1257.603) (-1256.612) [-1259.162] -- 0:00:37 408500 -- [-1257.123] (-1257.850) (-1261.760) (-1259.181) * (-1260.186) (-1257.576) (-1257.113) [-1257.864] -- 0:00:37 409000 -- (-1257.567) [-1256.431] (-1257.794) (-1258.934) * (-1256.545) (-1256.571) [-1259.292] (-1260.786) -- 0:00:37 409500 -- (-1260.901) (-1262.746) [-1261.792] (-1256.769) * (-1257.546) (-1256.398) (-1256.824) [-1259.497] -- 0:00:37 410000 -- (-1260.700) (-1259.079) (-1264.539) [-1259.438] * (-1257.179) (-1256.642) (-1258.891) [-1256.296] -- 0:00:37 Average standard deviation of split frequencies: 0.011074 410500 -- (-1258.587) (-1259.373) (-1262.479) [-1264.080] * (-1258.789) [-1259.201] (-1259.965) (-1257.776) -- 0:00:37 411000 -- [-1258.679] (-1262.917) (-1258.466) (-1258.887) * [-1261.744] (-1258.058) (-1259.169) (-1257.449) -- 0:00:37 411500 -- [-1257.150] (-1259.021) (-1258.615) (-1261.137) * (-1259.023) [-1259.121] (-1259.826) (-1260.025) -- 0:00:37 412000 -- (-1257.573) (-1258.402) (-1258.369) [-1257.891] * [-1257.001] (-1259.966) (-1260.081) (-1260.699) -- 0:00:37 412500 -- [-1258.846] (-1257.412) (-1257.674) (-1256.931) * (-1257.710) (-1261.612) [-1257.797] (-1259.996) -- 0:00:37 413000 -- (-1259.675) [-1258.060] (-1256.892) (-1256.557) * (-1259.967) [-1262.901] (-1261.541) (-1262.039) -- 0:00:36 413500 -- (-1258.096) (-1257.523) (-1261.668) [-1256.553] * [-1258.990] (-1259.799) (-1256.953) (-1257.660) -- 0:00:36 414000 -- [-1259.520] (-1259.018) (-1258.740) (-1257.839) * (-1258.488) [-1260.500] (-1257.903) (-1255.955) -- 0:00:36 414500 -- [-1261.661] (-1260.980) (-1257.954) (-1257.439) * (-1258.396) [-1262.573] (-1258.297) (-1261.004) -- 0:00:36 415000 -- (-1259.469) (-1256.789) [-1259.023] (-1259.889) * (-1258.121) (-1261.792) (-1259.122) [-1258.245] -- 0:00:36 Average standard deviation of split frequencies: 0.011773 415500 -- [-1259.570] (-1258.111) (-1256.908) (-1256.717) * (-1258.121) (-1257.676) (-1259.925) [-1259.554] -- 0:00:36 416000 -- (-1260.816) (-1257.192) (-1257.197) [-1257.128] * (-1258.910) (-1257.970) [-1260.706] (-1262.720) -- 0:00:36 416500 -- (-1257.985) (-1257.177) [-1262.228] (-1257.663) * (-1259.432) (-1258.141) (-1257.950) [-1263.051] -- 0:00:36 417000 -- (-1256.764) [-1258.240] (-1260.489) (-1257.622) * (-1258.507) (-1259.462) (-1259.130) [-1260.564] -- 0:00:36 417500 -- (-1259.120) (-1257.269) [-1257.869] (-1257.489) * (-1257.257) (-1258.208) [-1257.686] (-1259.107) -- 0:00:36 418000 -- [-1258.019] (-1259.795) (-1257.938) (-1257.978) * (-1258.809) [-1257.604] (-1259.187) (-1257.620) -- 0:00:37 418500 -- [-1258.329] (-1256.722) (-1258.783) (-1257.817) * (-1261.187) (-1257.861) (-1258.202) [-1256.248] -- 0:00:37 419000 -- [-1256.429] (-1258.054) (-1256.886) (-1259.217) * (-1263.261) [-1258.648] (-1259.058) (-1257.846) -- 0:00:37 419500 -- (-1260.546) [-1257.544] (-1259.598) (-1258.706) * (-1261.657) [-1256.869] (-1257.932) (-1257.360) -- 0:00:37 420000 -- (-1257.554) [-1256.299] (-1261.141) (-1258.521) * (-1258.323) [-1258.114] (-1257.882) (-1257.005) -- 0:00:37 Average standard deviation of split frequencies: 0.011626 420500 -- (-1258.604) [-1256.269] (-1259.443) (-1257.600) * (-1256.340) (-1257.210) [-1256.672] (-1258.701) -- 0:00:37 421000 -- [-1258.878] (-1257.767) (-1258.065) (-1257.944) * (-1257.987) (-1257.153) [-1256.654] (-1260.759) -- 0:00:37 421500 -- (-1257.165) [-1256.865] (-1258.610) (-1257.251) * (-1259.389) [-1256.951] (-1260.324) (-1261.698) -- 0:00:37 422000 -- [-1258.758] (-1257.716) (-1259.856) (-1258.702) * (-1259.057) (-1257.389) (-1258.562) [-1257.802] -- 0:00:36 422500 -- [-1258.422] (-1256.999) (-1260.171) (-1259.805) * (-1258.336) (-1258.237) [-1256.718] (-1257.125) -- 0:00:36 423000 -- (-1257.616) (-1258.112) [-1258.784] (-1259.377) * [-1257.153] (-1257.103) (-1257.332) (-1257.324) -- 0:00:36 423500 -- (-1260.130) (-1259.682) [-1257.619] (-1256.933) * (-1256.856) [-1258.277] (-1257.423) (-1256.994) -- 0:00:36 424000 -- (-1260.556) [-1257.831] (-1261.109) (-1256.605) * (-1258.682) (-1258.110) (-1258.735) [-1258.367] -- 0:00:36 424500 -- (-1259.103) (-1259.788) [-1259.476] (-1256.828) * (-1258.127) [-1259.357] (-1259.234) (-1258.349) -- 0:00:36 425000 -- [-1257.618] (-1261.696) (-1257.193) (-1256.543) * (-1258.897) (-1257.513) [-1260.977] (-1258.341) -- 0:00:36 Average standard deviation of split frequencies: 0.010943 425500 -- (-1258.826) (-1257.473) [-1257.792] (-1256.858) * (-1262.601) (-1256.924) (-1257.061) [-1256.569] -- 0:00:36 426000 -- (-1257.298) (-1256.988) (-1256.654) [-1261.898] * [-1256.056] (-1256.470) (-1258.845) (-1257.755) -- 0:00:36 426500 -- [-1261.291] (-1257.255) (-1260.310) (-1261.573) * (-1258.175) (-1256.919) [-1258.421] (-1257.763) -- 0:00:36 427000 -- (-1259.918) (-1256.856) (-1257.821) [-1259.697] * [-1257.434] (-1262.256) (-1256.241) (-1261.170) -- 0:00:36 427500 -- (-1257.448) (-1258.076) (-1256.792) [-1257.792] * (-1258.134) [-1260.874] (-1257.329) (-1260.452) -- 0:00:36 428000 -- (-1257.929) (-1257.974) [-1257.157] (-1258.266) * (-1256.378) (-1256.918) (-1256.890) [-1256.899] -- 0:00:36 428500 -- [-1257.981] (-1259.276) (-1258.463) (-1258.728) * (-1256.339) (-1258.424) (-1262.713) [-1258.058] -- 0:00:36 429000 -- (-1256.166) (-1258.909) (-1258.532) [-1257.657] * (-1259.078) (-1258.425) (-1259.016) [-1256.996] -- 0:00:35 429500 -- (-1260.482) (-1258.264) (-1258.714) [-1257.082] * [-1258.628] (-1258.915) (-1261.367) (-1259.812) -- 0:00:35 430000 -- (-1256.891) (-1259.731) (-1258.312) [-1257.155] * (-1259.166) (-1261.591) (-1257.910) [-1261.290] -- 0:00:35 Average standard deviation of split frequencies: 0.010399 430500 -- (-1256.860) [-1261.110] (-1258.590) (-1260.010) * (-1258.629) [-1258.660] (-1263.881) (-1259.876) -- 0:00:35 431000 -- (-1259.406) [-1257.573] (-1258.787) (-1258.488) * [-1257.194] (-1261.650) (-1259.740) (-1259.599) -- 0:00:35 431500 -- (-1264.335) (-1257.674) (-1258.388) [-1256.875] * (-1259.418) [-1259.959] (-1259.121) (-1257.431) -- 0:00:35 432000 -- (-1260.990) (-1258.820) (-1260.133) [-1257.757] * (-1256.422) [-1259.576] (-1258.801) (-1258.088) -- 0:00:35 432500 -- (-1260.746) [-1258.315] (-1256.452) (-1258.628) * (-1256.271) [-1258.160] (-1256.359) (-1259.525) -- 0:00:35 433000 -- (-1258.945) (-1258.480) (-1260.840) [-1256.965] * [-1260.374] (-1258.749) (-1258.409) (-1257.190) -- 0:00:35 433500 -- (-1261.670) [-1257.293] (-1260.840) (-1260.060) * (-1257.243) [-1260.590] (-1258.708) (-1256.940) -- 0:00:35 434000 -- (-1258.827) [-1260.678] (-1257.557) (-1257.976) * [-1257.539] (-1259.580) (-1257.434) (-1257.873) -- 0:00:36 434500 -- (-1261.866) (-1257.708) [-1257.445] (-1258.607) * (-1257.057) (-1256.883) (-1259.527) [-1258.547] -- 0:00:36 435000 -- [-1258.756] (-1258.377) (-1261.679) (-1262.085) * [-1257.057] (-1256.853) (-1256.952) (-1259.785) -- 0:00:36 Average standard deviation of split frequencies: 0.011194 435500 -- (-1259.992) (-1257.328) (-1262.162) [-1258.491] * (-1257.143) [-1256.435] (-1257.385) (-1258.703) -- 0:00:36 436000 -- [-1258.336] (-1256.903) (-1260.118) (-1257.108) * (-1262.064) (-1256.340) [-1256.366] (-1257.887) -- 0:00:36 436500 -- (-1257.370) (-1261.130) (-1258.088) [-1258.938] * (-1257.693) (-1257.395) [-1258.682] (-1260.624) -- 0:00:36 437000 -- [-1256.470] (-1260.094) (-1258.461) (-1261.123) * (-1258.708) (-1256.354) [-1259.266] (-1258.969) -- 0:00:36 437500 -- (-1257.937) (-1260.140) (-1255.905) [-1258.230] * (-1257.217) (-1260.191) [-1258.604] (-1258.417) -- 0:00:36 438000 -- (-1256.469) [-1258.924] (-1256.419) (-1257.294) * (-1257.315) [-1257.832] (-1258.100) (-1262.367) -- 0:00:35 438500 -- (-1255.936) (-1259.462) [-1257.228] (-1260.728) * (-1259.931) (-1256.582) [-1258.401] (-1260.895) -- 0:00:35 439000 -- (-1257.820) (-1261.623) (-1259.203) [-1257.903] * (-1258.512) (-1261.239) [-1260.082] (-1263.871) -- 0:00:35 439500 -- [-1257.550] (-1264.339) (-1259.537) (-1260.634) * (-1256.520) (-1257.485) (-1259.141) [-1258.695] -- 0:00:35 440000 -- (-1260.541) (-1259.464) [-1260.367] (-1260.730) * (-1257.446) [-1256.779] (-1258.587) (-1260.529) -- 0:00:35 Average standard deviation of split frequencies: 0.010949 440500 -- (-1255.983) (-1259.277) (-1259.874) [-1259.748] * (-1256.597) (-1259.423) (-1258.875) [-1258.176] -- 0:00:35 441000 -- (-1256.109) (-1256.740) (-1258.620) [-1260.872] * [-1257.082] (-1259.790) (-1258.753) (-1258.529) -- 0:00:35 441500 -- [-1256.109] (-1258.557) (-1257.884) (-1256.384) * (-1256.234) [-1257.116] (-1256.589) (-1257.957) -- 0:00:35 442000 -- (-1256.263) [-1260.259] (-1268.252) (-1256.187) * (-1258.030) (-1257.358) (-1256.718) [-1260.887] -- 0:00:35 442500 -- [-1256.382] (-1256.806) (-1272.058) (-1256.849) * (-1257.136) (-1259.857) (-1256.437) [-1260.448] -- 0:00:35 443000 -- (-1261.749) [-1257.454] (-1260.279) (-1259.244) * (-1256.130) [-1259.362] (-1258.327) (-1257.987) -- 0:00:35 443500 -- (-1257.306) [-1256.558] (-1261.357) (-1260.908) * (-1260.080) [-1256.555] (-1261.396) (-1257.432) -- 0:00:35 444000 -- (-1258.931) [-1256.791] (-1256.820) (-1262.973) * (-1256.679) (-1257.208) (-1257.645) [-1258.413] -- 0:00:35 444500 -- [-1257.662] (-1256.652) (-1258.234) (-1258.398) * [-1260.475] (-1257.813) (-1257.951) (-1260.297) -- 0:00:34 445000 -- (-1256.536) [-1256.629] (-1258.287) (-1260.990) * (-1257.823) [-1257.737] (-1257.192) (-1256.683) -- 0:00:34 Average standard deviation of split frequencies: 0.011129 445500 -- (-1262.055) (-1260.074) [-1258.332] (-1261.169) * (-1262.873) [-1259.347] (-1256.654) (-1257.440) -- 0:00:34 446000 -- [-1260.522] (-1259.688) (-1257.476) (-1262.115) * (-1259.805) [-1258.048] (-1260.286) (-1259.959) -- 0:00:34 446500 -- (-1259.089) (-1259.789) [-1256.918] (-1263.393) * [-1261.919] (-1258.365) (-1263.524) (-1260.702) -- 0:00:34 447000 -- (-1264.556) (-1258.963) (-1256.990) [-1260.417] * [-1256.706] (-1261.146) (-1258.642) (-1257.501) -- 0:00:34 447500 -- (-1264.329) (-1260.958) [-1256.987] (-1259.134) * (-1261.194) (-1256.751) [-1257.244] (-1256.658) -- 0:00:34 448000 -- (-1262.677) (-1257.789) [-1256.554] (-1259.132) * (-1257.843) [-1258.025] (-1260.364) (-1256.622) -- 0:00:34 448500 -- (-1256.912) (-1256.590) (-1257.719) [-1262.246] * (-1256.818) [-1258.336] (-1257.679) (-1257.111) -- 0:00:34 449000 -- [-1257.335] (-1258.285) (-1256.492) (-1258.430) * (-1259.316) (-1257.936) (-1256.486) [-1256.724] -- 0:00:34 449500 -- (-1259.796) [-1257.636] (-1257.144) (-1258.100) * (-1259.575) [-1263.059] (-1257.063) (-1257.476) -- 0:00:34 450000 -- (-1261.075) [-1257.729] (-1257.697) (-1259.086) * (-1257.245) (-1259.361) (-1258.064) [-1257.144] -- 0:00:34 Average standard deviation of split frequencies: 0.010829 450500 -- (-1261.420) (-1259.213) [-1258.218] (-1260.090) * [-1257.463] (-1262.294) (-1259.209) (-1258.374) -- 0:00:35 451000 -- (-1261.895) (-1260.482) (-1261.830) [-1258.590] * [-1257.536] (-1258.741) (-1257.169) (-1259.214) -- 0:00:35 451500 -- (-1257.343) (-1259.533) (-1261.668) [-1258.623] * (-1257.779) (-1261.123) [-1260.583] (-1258.529) -- 0:00:35 452000 -- (-1256.963) (-1262.658) [-1257.607] (-1259.162) * (-1261.893) (-1256.348) [-1257.848] (-1256.546) -- 0:00:35 452500 -- [-1257.195] (-1258.802) (-1259.299) (-1258.183) * (-1260.757) (-1256.103) [-1259.443] (-1257.249) -- 0:00:35 453000 -- [-1257.195] (-1259.539) (-1260.836) (-1261.701) * [-1258.091] (-1258.054) (-1258.784) (-1259.816) -- 0:00:35 453500 -- (-1260.234) (-1257.786) (-1258.755) [-1257.489] * (-1267.508) [-1258.874] (-1259.124) (-1256.763) -- 0:00:34 454000 -- (-1261.743) (-1258.815) (-1257.902) [-1256.948] * (-1257.966) [-1258.885] (-1259.614) (-1258.778) -- 0:00:34 454500 -- (-1256.860) (-1258.598) (-1257.109) [-1258.713] * (-1258.334) (-1260.222) (-1262.045) [-1261.507] -- 0:00:34 455000 -- [-1257.877] (-1258.706) (-1256.228) (-1256.180) * [-1259.273] (-1261.429) (-1264.078) (-1259.723) -- 0:00:34 Average standard deviation of split frequencies: 0.011242 455500 -- (-1257.295) (-1258.134) [-1257.841] (-1256.749) * (-1256.359) (-1257.315) (-1256.759) [-1259.600] -- 0:00:34 456000 -- (-1259.045) [-1258.903] (-1262.017) (-1257.475) * (-1256.819) (-1256.847) [-1257.546] (-1258.857) -- 0:00:34 456500 -- [-1256.504] (-1260.590) (-1264.663) (-1259.044) * (-1257.330) (-1258.058) [-1258.319] (-1257.916) -- 0:00:34 457000 -- (-1260.603) (-1258.721) [-1256.860] (-1260.894) * (-1257.158) [-1256.909] (-1261.284) (-1257.320) -- 0:00:34 457500 -- (-1258.003) (-1258.391) [-1256.737] (-1257.239) * (-1257.919) (-1259.911) (-1256.871) [-1256.474] -- 0:00:34 458000 -- (-1257.379) (-1258.041) [-1256.609] (-1260.425) * (-1259.389) (-1259.568) (-1261.781) [-1256.326] -- 0:00:34 458500 -- (-1258.952) (-1256.690) [-1257.945] (-1259.567) * (-1258.834) (-1259.304) (-1258.254) [-1256.790] -- 0:00:34 459000 -- (-1256.811) [-1256.179] (-1261.898) (-1257.686) * (-1256.862) [-1256.747] (-1256.599) (-1257.266) -- 0:00:34 459500 -- (-1257.546) (-1256.171) (-1258.897) [-1257.163] * (-1261.023) (-1256.742) [-1259.532] (-1259.272) -- 0:00:34 460000 -- [-1258.593] (-1258.908) (-1258.902) (-1257.138) * (-1257.665) [-1257.120] (-1257.100) (-1256.474) -- 0:00:34 Average standard deviation of split frequencies: 0.011738 460500 -- [-1257.052] (-1261.849) (-1257.869) (-1257.026) * (-1256.773) (-1259.218) [-1258.753] (-1256.977) -- 0:00:33 461000 -- (-1260.839) (-1259.005) (-1257.580) [-1256.816] * (-1258.870) (-1257.510) (-1257.396) [-1262.136] -- 0:00:33 461500 -- [-1256.940] (-1256.742) (-1257.343) (-1258.000) * (-1259.004) [-1257.715] (-1259.611) (-1264.017) -- 0:00:33 462000 -- (-1257.004) (-1257.352) [-1257.380] (-1258.326) * (-1258.931) [-1256.879] (-1262.350) (-1258.940) -- 0:00:33 462500 -- (-1257.807) (-1257.306) [-1259.947] (-1256.600) * [-1257.948] (-1256.990) (-1270.925) (-1258.081) -- 0:00:33 463000 -- (-1257.969) (-1257.161) [-1256.977] (-1256.759) * (-1257.730) (-1257.458) (-1266.455) [-1257.715] -- 0:00:33 463500 -- (-1260.562) [-1259.414] (-1257.248) (-1261.060) * (-1257.740) [-1266.310] (-1265.991) (-1256.771) -- 0:00:33 464000 -- (-1258.027) (-1257.782) [-1256.224] (-1257.012) * (-1259.397) (-1258.279) (-1265.002) [-1256.060] -- 0:00:33 464500 -- (-1256.873) (-1259.564) (-1257.592) [-1257.154] * (-1259.465) [-1258.854] (-1262.157) (-1257.347) -- 0:00:33 465000 -- (-1259.893) (-1257.890) (-1256.719) [-1257.557] * (-1260.870) (-1259.478) (-1257.620) [-1258.906] -- 0:00:33 Average standard deviation of split frequencies: 0.012080 465500 -- (-1260.551) (-1257.911) [-1256.940] (-1259.113) * [-1259.572] (-1262.797) (-1259.637) (-1257.807) -- 0:00:33 466000 -- (-1258.382) [-1259.037] (-1256.448) (-1256.744) * (-1258.579) [-1258.344] (-1258.708) (-1259.727) -- 0:00:33 466500 -- (-1258.062) [-1257.188] (-1258.158) (-1257.955) * (-1259.678) [-1260.383] (-1257.386) (-1258.430) -- 0:00:34 467000 -- (-1259.624) [-1257.440] (-1256.220) (-1257.470) * (-1256.739) (-1258.711) (-1259.660) [-1257.127] -- 0:00:34 467500 -- (-1260.459) (-1257.357) [-1256.478] (-1257.186) * (-1259.806) [-1259.179] (-1259.388) (-1259.378) -- 0:00:34 468000 -- (-1266.402) [-1259.718] (-1257.661) (-1258.823) * (-1257.380) (-1257.921) [-1259.071] (-1258.743) -- 0:00:34 468500 -- [-1259.463] (-1256.782) (-1258.454) (-1256.110) * (-1258.269) (-1259.185) [-1262.996] (-1261.845) -- 0:00:34 469000 -- (-1265.001) [-1257.339] (-1257.965) (-1256.588) * (-1257.319) (-1257.023) (-1258.424) [-1259.834] -- 0:00:33 469500 -- (-1262.823) (-1257.322) (-1257.727) [-1258.612] * (-1258.369) (-1256.550) [-1258.244] (-1258.211) -- 0:00:33 470000 -- (-1259.948) (-1258.280) (-1257.976) [-1259.375] * (-1259.822) [-1259.806] (-1264.114) (-1260.094) -- 0:00:33 Average standard deviation of split frequencies: 0.011783 470500 -- (-1257.815) (-1257.069) [-1260.372] (-1263.980) * (-1260.593) (-1260.671) (-1259.448) [-1258.365] -- 0:00:33 471000 -- (-1260.663) [-1256.564] (-1256.476) (-1256.951) * (-1257.311) (-1262.912) [-1259.029] (-1256.878) -- 0:00:33 471500 -- [-1258.185] (-1256.197) (-1256.572) (-1256.679) * (-1257.514) (-1259.041) (-1256.310) [-1257.257] -- 0:00:33 472000 -- [-1260.335] (-1257.080) (-1257.599) (-1256.717) * (-1261.317) (-1259.321) (-1257.311) [-1259.075] -- 0:00:33 472500 -- (-1259.159) (-1256.713) [-1257.599] (-1256.170) * [-1257.993] (-1258.988) (-1259.066) (-1255.993) -- 0:00:33 473000 -- (-1257.893) (-1256.569) (-1260.741) [-1257.624] * (-1258.123) [-1260.081] (-1259.619) (-1258.908) -- 0:00:33 473500 -- (-1266.153) (-1256.266) (-1264.669) [-1256.734] * (-1259.069) [-1257.088] (-1261.638) (-1259.756) -- 0:00:33 474000 -- (-1259.359) (-1258.837) (-1257.583) [-1256.449] * (-1256.894) (-1260.682) [-1256.948] (-1260.127) -- 0:00:33 474500 -- (-1260.220) (-1264.510) (-1257.792) [-1256.817] * (-1256.216) (-1257.262) [-1258.581] (-1259.360) -- 0:00:33 475000 -- (-1258.355) (-1259.760) [-1261.822] (-1259.588) * (-1256.292) (-1260.274) (-1257.725) [-1258.011] -- 0:00:33 Average standard deviation of split frequencies: 0.011302 475500 -- [-1259.334] (-1258.922) (-1256.712) (-1259.325) * (-1256.993) [-1261.164] (-1256.351) (-1256.814) -- 0:00:33 476000 -- [-1259.569] (-1259.339) (-1258.821) (-1259.530) * (-1256.841) [-1257.164] (-1260.201) (-1261.253) -- 0:00:33 476500 -- (-1259.438) [-1258.853] (-1259.817) (-1263.492) * [-1257.183] (-1258.330) (-1259.468) (-1258.273) -- 0:00:32 477000 -- (-1259.954) (-1257.130) [-1259.259] (-1259.691) * [-1257.347] (-1257.027) (-1258.311) (-1256.610) -- 0:00:32 477500 -- (-1261.810) (-1256.699) (-1258.136) [-1259.694] * [-1259.697] (-1260.142) (-1260.075) (-1256.666) -- 0:00:32 478000 -- (-1265.772) [-1257.150] (-1258.158) (-1258.386) * (-1258.410) [-1258.329] (-1259.553) (-1257.342) -- 0:00:32 478500 -- (-1260.832) (-1267.365) [-1256.765] (-1257.222) * (-1259.697) (-1260.121) [-1259.597] (-1258.450) -- 0:00:32 479000 -- (-1259.634) (-1259.787) [-1256.901] (-1263.080) * (-1259.697) (-1263.839) (-1258.878) [-1258.992] -- 0:00:32 479500 -- (-1257.387) (-1258.459) [-1258.880] (-1260.080) * [-1259.965] (-1259.026) (-1258.769) (-1259.356) -- 0:00:32 480000 -- (-1260.381) (-1256.621) (-1258.822) [-1259.667] * (-1259.957) (-1258.936) [-1255.851] (-1257.083) -- 0:00:32 Average standard deviation of split frequencies: 0.011076 480500 -- (-1258.854) (-1258.311) (-1261.609) [-1257.105] * (-1259.090) (-1258.358) (-1256.975) [-1259.134] -- 0:00:32 481000 -- [-1262.854] (-1256.510) (-1258.825) (-1256.615) * (-1261.476) (-1256.868) [-1257.236] (-1257.048) -- 0:00:32 481500 -- [-1259.063] (-1256.244) (-1259.201) (-1256.656) * (-1259.274) (-1261.443) (-1269.006) [-1257.330] -- 0:00:32 482000 -- (-1257.174) (-1257.177) [-1257.959] (-1256.698) * (-1257.928) (-1261.240) (-1258.849) [-1259.503] -- 0:00:33 482500 -- [-1258.584] (-1257.454) (-1258.530) (-1258.242) * (-1258.506) (-1259.373) (-1257.911) [-1258.430] -- 0:00:33 483000 -- [-1257.652] (-1257.171) (-1258.696) (-1259.150) * (-1260.631) (-1262.051) (-1260.891) [-1257.783] -- 0:00:33 483500 -- (-1257.653) (-1258.121) (-1261.983) [-1258.539] * (-1261.666) (-1258.185) (-1259.717) [-1258.877] -- 0:00:33 484000 -- (-1258.169) (-1258.011) [-1258.449] (-1256.078) * (-1255.947) (-1259.926) [-1256.739] (-1256.689) -- 0:00:33 484500 -- (-1259.796) [-1259.222] (-1256.435) (-1256.279) * (-1256.135) (-1257.170) [-1256.667] (-1257.800) -- 0:00:32 485000 -- (-1257.505) [-1257.278] (-1258.588) (-1257.146) * (-1256.891) (-1256.911) [-1256.671] (-1257.477) -- 0:00:32 Average standard deviation of split frequencies: 0.011411 485500 -- (-1259.606) [-1258.936] (-1257.949) (-1259.667) * (-1256.198) (-1256.584) (-1256.615) [-1257.338] -- 0:00:32 486000 -- (-1262.996) (-1258.200) [-1256.415] (-1260.529) * (-1260.116) (-1259.834) (-1258.639) [-1257.657] -- 0:00:32 486500 -- [-1258.405] (-1259.402) (-1256.635) (-1258.756) * (-1261.160) (-1256.991) [-1259.525] (-1260.890) -- 0:00:32 487000 -- (-1265.111) [-1256.786] (-1256.969) (-1257.105) * (-1258.109) [-1256.820] (-1266.240) (-1260.309) -- 0:00:32 487500 -- (-1260.096) (-1260.476) [-1257.575] (-1257.464) * (-1261.199) [-1256.817] (-1261.206) (-1261.272) -- 0:00:32 488000 -- (-1258.504) (-1258.381) (-1257.562) [-1256.945] * (-1261.357) (-1259.580) (-1263.130) [-1257.004] -- 0:00:32 488500 -- [-1258.098] (-1259.568) (-1259.491) (-1258.972) * (-1261.717) (-1260.698) [-1260.174] (-1256.800) -- 0:00:32 489000 -- (-1259.138) (-1257.046) [-1257.732] (-1259.382) * (-1262.252) (-1259.785) [-1260.359] (-1257.320) -- 0:00:32 489500 -- (-1256.228) (-1259.804) (-1258.111) [-1257.702] * (-1260.840) (-1261.452) (-1259.860) [-1260.622] -- 0:00:32 490000 -- (-1257.061) (-1256.340) (-1257.849) [-1256.351] * (-1257.307) [-1259.311] (-1261.482) (-1258.772) -- 0:00:32 Average standard deviation of split frequencies: 0.011416 490500 -- (-1258.022) (-1260.256) (-1257.811) [-1256.533] * (-1261.910) (-1262.285) [-1257.864] (-1259.270) -- 0:00:32 491000 -- (-1258.173) (-1259.873) (-1258.607) [-1257.711] * (-1259.065) (-1260.150) [-1258.297] (-1258.778) -- 0:00:32 491500 -- (-1259.087) (-1260.047) (-1264.957) [-1257.976] * (-1256.348) (-1258.134) [-1259.193] (-1258.880) -- 0:00:32 492000 -- (-1257.994) (-1257.778) (-1259.746) [-1258.142] * [-1258.222] (-1257.666) (-1257.507) (-1256.574) -- 0:00:32 492500 -- [-1256.156] (-1258.770) (-1256.089) (-1258.916) * (-1256.887) (-1259.321) [-1258.063] (-1257.462) -- 0:00:31 493000 -- [-1260.565] (-1258.903) (-1258.087) (-1257.807) * (-1263.409) (-1258.428) (-1258.398) [-1258.991] -- 0:00:31 493500 -- (-1258.314) [-1257.997] (-1257.151) (-1256.861) * (-1259.719) (-1261.018) (-1257.785) [-1257.169] -- 0:00:31 494000 -- (-1259.533) (-1259.629) [-1258.362] (-1258.239) * (-1258.554) (-1256.425) [-1258.507] (-1257.167) -- 0:00:31 494500 -- (-1259.717) [-1261.714] (-1260.909) (-1260.482) * [-1258.248] (-1258.103) (-1258.038) (-1262.597) -- 0:00:31 495000 -- (-1256.175) (-1258.410) [-1259.956] (-1257.187) * (-1256.942) (-1258.429) [-1256.171] (-1261.324) -- 0:00:31 Average standard deviation of split frequencies: 0.011461 495500 -- (-1256.929) (-1257.159) [-1257.386] (-1256.839) * [-1258.304] (-1258.941) (-1258.875) (-1263.918) -- 0:00:31 496000 -- (-1257.354) [-1258.139] (-1258.442) (-1257.160) * (-1256.548) (-1257.336) [-1259.994] (-1262.622) -- 0:00:31 496500 -- [-1256.606] (-1258.562) (-1259.167) (-1258.535) * (-1262.915) [-1257.051] (-1259.465) (-1258.010) -- 0:00:31 497000 -- (-1257.105) (-1258.538) (-1256.702) [-1259.369] * [-1259.333] (-1257.727) (-1260.437) (-1259.213) -- 0:00:32 497500 -- (-1263.189) (-1257.165) (-1259.371) [-1258.029] * (-1261.853) (-1257.218) [-1259.207] (-1257.406) -- 0:00:32 498000 -- [-1258.012] (-1260.222) (-1259.905) (-1261.165) * (-1257.447) [-1257.375] (-1259.205) (-1259.492) -- 0:00:32 498500 -- (-1257.268) [-1260.500] (-1258.758) (-1257.595) * [-1257.244] (-1257.328) (-1258.201) (-1257.230) -- 0:00:32 499000 -- (-1257.389) (-1262.390) [-1258.686] (-1258.333) * (-1259.698) [-1256.747] (-1257.795) (-1259.996) -- 0:00:32 499500 -- (-1258.634) (-1257.043) (-1257.188) [-1257.287] * (-1257.757) (-1257.183) (-1257.107) [-1257.017] -- 0:00:32 500000 -- [-1257.268] (-1257.547) (-1257.885) (-1258.415) * (-1258.868) (-1257.692) [-1257.672] (-1259.737) -- 0:00:32 Average standard deviation of split frequencies: 0.011243 500500 -- (-1256.496) (-1258.396) [-1257.410] (-1256.069) * [-1258.487] (-1258.229) (-1257.975) (-1260.571) -- 0:00:31 501000 -- (-1262.859) (-1258.446) [-1258.135] (-1256.849) * [-1259.395] (-1259.503) (-1257.923) (-1262.245) -- 0:00:31 501500 -- (-1256.717) (-1256.349) (-1259.889) [-1257.285] * [-1256.516] (-1256.887) (-1258.087) (-1259.081) -- 0:00:31 502000 -- [-1258.896] (-1258.541) (-1260.360) (-1259.042) * [-1257.235] (-1256.738) (-1259.445) (-1257.446) -- 0:00:31 502500 -- (-1256.943) (-1260.482) (-1257.270) [-1256.824] * (-1259.951) (-1258.739) (-1260.905) [-1257.551] -- 0:00:31 503000 -- (-1256.282) (-1258.136) (-1256.773) [-1260.053] * (-1257.087) [-1259.559] (-1260.475) (-1258.170) -- 0:00:31 503500 -- (-1256.876) (-1259.234) (-1257.911) [-1260.053] * (-1258.396) [-1258.131] (-1257.811) (-1258.502) -- 0:00:31 504000 -- (-1260.259) [-1257.763] (-1257.764) (-1258.024) * (-1256.504) [-1256.965] (-1259.572) (-1260.765) -- 0:00:31 504500 -- (-1264.800) [-1256.196] (-1258.440) (-1256.998) * (-1256.533) (-1261.660) [-1260.928] (-1257.048) -- 0:00:31 505000 -- [-1260.198] (-1259.570) (-1261.937) (-1259.597) * [-1257.834] (-1259.985) (-1256.961) (-1256.911) -- 0:00:31 Average standard deviation of split frequencies: 0.011180 505500 -- (-1256.492) (-1259.646) [-1258.003] (-1257.083) * (-1258.450) [-1257.342] (-1259.947) (-1260.091) -- 0:00:31 506000 -- [-1257.016] (-1258.609) (-1258.404) (-1259.065) * (-1257.731) (-1258.943) (-1256.869) [-1258.248] -- 0:00:31 506500 -- (-1257.925) (-1258.180) (-1258.117) [-1258.804] * (-1256.488) [-1258.426] (-1261.290) (-1258.817) -- 0:00:31 507000 -- (-1257.943) (-1257.943) [-1256.757] (-1259.084) * [-1257.203] (-1258.851) (-1260.828) (-1258.216) -- 0:00:31 507500 -- (-1257.801) [-1256.876] (-1258.469) (-1260.302) * [-1257.061] (-1258.026) (-1260.437) (-1257.500) -- 0:00:31 508000 -- (-1257.432) [-1257.162] (-1258.790) (-1260.189) * (-1256.865) (-1258.467) (-1260.011) [-1257.354] -- 0:00:30 508500 -- (-1256.674) (-1257.030) [-1259.209] (-1258.296) * (-1260.394) (-1257.797) (-1261.522) [-1257.423] -- 0:00:30 509000 -- (-1257.625) [-1257.067] (-1256.690) (-1259.326) * (-1256.834) (-1257.019) (-1257.029) [-1259.533] -- 0:00:30 509500 -- (-1259.098) [-1260.272] (-1256.809) (-1258.147) * [-1263.335] (-1259.026) (-1258.921) (-1257.925) -- 0:00:30 510000 -- (-1258.756) [-1257.846] (-1260.128) (-1257.782) * (-1257.270) [-1260.803] (-1257.749) (-1258.677) -- 0:00:30 Average standard deviation of split frequencies: 0.011132 510500 -- (-1256.803) [-1259.396] (-1257.527) (-1258.124) * (-1256.944) [-1263.833] (-1263.010) (-1259.518) -- 0:00:30 511000 -- [-1257.376] (-1258.310) (-1258.449) (-1257.155) * (-1256.620) (-1258.293) (-1260.087) [-1259.168] -- 0:00:30 511500 -- (-1257.113) (-1259.739) [-1257.914] (-1258.140) * (-1256.492) (-1259.673) (-1257.268) [-1257.144] -- 0:00:30 512000 -- [-1258.760] (-1267.425) (-1258.922) (-1259.673) * (-1256.796) [-1260.016] (-1257.590) (-1256.604) -- 0:00:30 512500 -- [-1258.639] (-1264.133) (-1258.375) (-1258.918) * (-1262.262) [-1258.713] (-1257.607) (-1259.307) -- 0:00:31 513000 -- (-1259.921) (-1258.709) [-1256.571] (-1257.032) * (-1262.990) (-1258.791) (-1259.793) [-1257.996] -- 0:00:31 513500 -- (-1258.631) (-1257.527) (-1259.950) [-1256.572] * [-1257.629] (-1257.420) (-1259.791) (-1259.942) -- 0:00:31 514000 -- (-1259.410) (-1263.560) [-1261.295] (-1258.724) * (-1261.200) (-1258.999) (-1261.113) [-1258.560] -- 0:00:31 514500 -- (-1261.248) (-1260.110) [-1258.517] (-1261.675) * (-1257.350) (-1258.962) (-1259.751) [-1259.237] -- 0:00:31 515000 -- (-1260.537) (-1260.116) [-1256.154] (-1262.671) * (-1257.353) (-1257.657) [-1256.784] (-1257.774) -- 0:00:31 Average standard deviation of split frequencies: 0.011178 515500 -- (-1258.169) (-1257.955) [-1257.473] (-1258.236) * [-1258.285] (-1257.631) (-1257.511) (-1259.330) -- 0:00:31 516000 -- (-1258.010) [-1258.651] (-1256.145) (-1260.454) * (-1257.280) (-1256.927) [-1258.626] (-1258.617) -- 0:00:30 516500 -- (-1259.075) [-1257.035] (-1261.375) (-1260.381) * [-1257.951] (-1257.718) (-1257.185) (-1256.818) -- 0:00:30 517000 -- (-1260.054) (-1258.853) [-1258.504] (-1261.401) * [-1257.285] (-1258.545) (-1257.468) (-1258.029) -- 0:00:30 517500 -- (-1259.230) (-1256.919) [-1257.247] (-1258.389) * (-1259.415) [-1257.322] (-1256.733) (-1257.061) -- 0:00:30 518000 -- (-1256.208) [-1259.455] (-1257.093) (-1259.095) * (-1260.185) (-1259.341) [-1256.733] (-1258.789) -- 0:00:30 518500 -- (-1257.079) (-1260.596) [-1257.559] (-1257.562) * (-1262.578) (-1259.401) [-1257.495] (-1264.330) -- 0:00:30 519000 -- (-1259.856) (-1257.979) (-1259.220) [-1257.129] * (-1261.560) [-1258.345] (-1260.029) (-1260.117) -- 0:00:30 519500 -- (-1266.222) [-1260.104] (-1260.178) (-1258.415) * (-1259.232) (-1258.345) (-1263.037) [-1258.584] -- 0:00:30 520000 -- (-1260.309) [-1261.745] (-1258.685) (-1261.379) * [-1257.331] (-1259.661) (-1262.772) (-1257.511) -- 0:00:30 Average standard deviation of split frequencies: 0.010492 520500 -- (-1259.970) [-1261.813] (-1261.345) (-1259.347) * (-1257.790) [-1256.284] (-1260.966) (-1256.380) -- 0:00:30 521000 -- (-1258.602) (-1260.200) [-1258.882] (-1261.029) * (-1257.866) (-1257.378) [-1257.858] (-1258.351) -- 0:00:30 521500 -- (-1259.548) (-1258.917) [-1257.099] (-1256.886) * (-1262.653) [-1259.839] (-1258.916) (-1257.201) -- 0:00:30 522000 -- (-1256.906) (-1258.017) [-1261.619] (-1257.205) * (-1261.004) (-1256.718) [-1258.862] (-1259.658) -- 0:00:30 522500 -- (-1256.978) [-1257.311] (-1261.332) (-1258.695) * (-1258.745) (-1256.848) (-1257.741) [-1257.529] -- 0:00:30 523000 -- (-1258.052) (-1257.461) [-1261.591] (-1260.044) * (-1263.645) [-1257.802] (-1259.152) (-1259.383) -- 0:00:30 523500 -- (-1258.038) [-1259.314] (-1260.855) (-1258.733) * (-1258.974) (-1258.259) (-1257.940) [-1258.501] -- 0:00:30 524000 -- [-1258.476] (-1260.188) (-1259.423) (-1258.916) * (-1256.821) (-1259.140) (-1256.513) [-1256.058] -- 0:00:29 524500 -- [-1258.954] (-1260.443) (-1263.947) (-1259.566) * [-1257.162] (-1259.301) (-1257.288) (-1256.911) -- 0:00:29 525000 -- (-1258.308) (-1257.682) [-1259.988] (-1256.451) * (-1261.811) (-1257.621) (-1260.653) [-1256.329] -- 0:00:29 Average standard deviation of split frequencies: 0.010702 525500 -- [-1257.321] (-1261.188) (-1261.686) (-1258.204) * (-1262.748) (-1257.064) (-1258.572) [-1256.266] -- 0:00:29 526000 -- (-1257.321) (-1261.129) [-1259.911] (-1256.464) * (-1257.093) (-1256.602) (-1261.116) [-1256.826] -- 0:00:29 526500 -- (-1258.795) (-1257.050) (-1259.621) [-1256.397] * [-1256.087] (-1256.588) (-1258.518) (-1259.803) -- 0:00:29 527000 -- (-1262.929) [-1256.869] (-1259.567) (-1257.350) * (-1256.834) (-1256.323) (-1256.928) [-1261.772] -- 0:00:29 527500 -- (-1258.525) (-1257.707) (-1259.149) [-1257.397] * [-1256.678] (-1257.036) (-1259.497) (-1258.327) -- 0:00:29 528000 -- (-1257.388) (-1257.836) [-1256.438] (-1258.299) * (-1256.376) [-1256.580] (-1256.677) (-1258.203) -- 0:00:29 528500 -- (-1257.086) (-1258.043) [-1256.375] (-1260.175) * [-1257.738] (-1260.823) (-1257.311) (-1258.869) -- 0:00:30 529000 -- [-1256.614] (-1261.935) (-1256.128) (-1258.988) * (-1261.130) (-1261.223) (-1261.000) [-1256.730] -- 0:00:30 529500 -- (-1256.367) (-1256.308) [-1256.449] (-1257.166) * [-1257.780] (-1258.895) (-1263.373) (-1258.571) -- 0:00:30 530000 -- [-1256.524] (-1258.387) (-1256.540) (-1257.145) * (-1257.678) (-1256.767) (-1257.049) [-1256.980] -- 0:00:30 Average standard deviation of split frequencies: 0.010399 530500 -- (-1258.042) [-1260.963] (-1259.276) (-1258.824) * (-1256.947) [-1256.924] (-1257.363) (-1257.490) -- 0:00:30 531000 -- (-1257.195) [-1261.348] (-1260.821) (-1256.484) * (-1257.411) [-1256.454] (-1257.470) (-1256.740) -- 0:00:30 531500 -- (-1262.880) [-1257.213] (-1261.712) (-1261.003) * [-1259.421] (-1256.953) (-1259.641) (-1259.429) -- 0:00:29 532000 -- (-1260.128) [-1256.845] (-1259.691) (-1260.632) * (-1258.626) (-1259.575) [-1263.594] (-1256.266) -- 0:00:29 532500 -- (-1259.823) [-1256.632] (-1259.983) (-1260.586) * (-1260.687) (-1257.116) (-1258.391) [-1257.190] -- 0:00:29 533000 -- (-1258.182) [-1257.453] (-1262.075) (-1259.388) * [-1257.077] (-1256.818) (-1258.685) (-1257.583) -- 0:00:29 533500 -- (-1258.132) (-1258.847) (-1258.349) [-1256.598] * (-1258.865) (-1258.408) (-1258.776) [-1257.379] -- 0:00:29 534000 -- (-1256.551) [-1260.927] (-1256.950) (-1257.842) * (-1258.326) (-1262.300) [-1260.308] (-1256.702) -- 0:00:29 534500 -- (-1257.343) (-1258.471) (-1261.538) [-1258.497] * [-1257.798] (-1258.109) (-1260.087) (-1256.842) -- 0:00:29 535000 -- (-1258.969) [-1259.951] (-1259.363) (-1259.871) * [-1262.038] (-1258.150) (-1258.231) (-1257.097) -- 0:00:29 Average standard deviation of split frequencies: 0.009933 535500 -- (-1259.467) [-1260.337] (-1259.993) (-1258.905) * (-1259.691) [-1258.511] (-1256.300) (-1257.700) -- 0:00:29 536000 -- (-1262.421) (-1261.522) [-1257.402] (-1257.045) * (-1259.412) (-1261.820) [-1256.360] (-1257.370) -- 0:00:29 536500 -- (-1256.347) (-1258.688) (-1257.356) [-1257.994] * [-1256.276] (-1257.304) (-1256.201) (-1257.599) -- 0:00:29 537000 -- (-1257.858) (-1259.486) [-1258.118] (-1258.460) * (-1256.029) (-1258.076) [-1255.942] (-1257.822) -- 0:00:29 537500 -- (-1258.825) (-1258.129) [-1256.812] (-1260.255) * (-1255.912) [-1257.786] (-1258.298) (-1256.829) -- 0:00:29 538000 -- (-1259.684) [-1256.812] (-1256.638) (-1259.132) * [-1256.571] (-1261.568) (-1268.753) (-1256.442) -- 0:00:29 538500 -- (-1258.061) (-1256.355) (-1256.889) [-1257.529] * (-1258.590) [-1260.482] (-1264.308) (-1256.384) -- 0:00:29 539000 -- (-1258.048) (-1257.365) (-1259.335) [-1259.221] * (-1259.847) (-1257.398) [-1256.068] (-1262.514) -- 0:00:29 539500 -- (-1257.524) (-1257.980) [-1258.737] (-1259.261) * (-1257.091) (-1258.408) [-1257.115] (-1259.934) -- 0:00:29 540000 -- (-1257.256) [-1256.398] (-1257.279) (-1259.626) * (-1260.453) (-1257.587) (-1256.581) [-1258.983] -- 0:00:28 Average standard deviation of split frequencies: 0.010360 540500 -- (-1261.216) [-1256.886] (-1257.392) (-1261.592) * [-1257.077] (-1258.494) (-1257.225) (-1258.048) -- 0:00:28 541000 -- (-1258.887) [-1256.214] (-1256.856) (-1263.347) * (-1258.171) [-1259.801] (-1259.643) (-1259.323) -- 0:00:28 541500 -- [-1256.853] (-1263.842) (-1256.520) (-1261.900) * [-1257.649] (-1257.983) (-1258.314) (-1260.830) -- 0:00:28 542000 -- (-1256.853) (-1260.251) [-1258.229] (-1259.378) * (-1256.463) [-1258.858] (-1262.578) (-1258.819) -- 0:00:28 542500 -- [-1256.555] (-1262.211) (-1257.023) (-1258.387) * (-1257.126) (-1261.019) [-1260.920] (-1258.849) -- 0:00:28 543000 -- [-1257.300] (-1259.278) (-1257.125) (-1256.974) * (-1259.065) (-1259.448) (-1261.561) [-1258.415] -- 0:00:28 543500 -- (-1259.106) (-1256.243) (-1257.120) [-1260.272] * (-1258.111) [-1257.718] (-1260.598) (-1258.360) -- 0:00:28 544000 -- (-1260.135) (-1258.308) [-1257.785] (-1261.646) * (-1258.072) (-1258.804) [-1259.713] (-1260.628) -- 0:00:28 544500 -- (-1258.708) (-1257.590) (-1258.275) [-1259.727] * (-1256.319) [-1257.056] (-1261.936) (-1259.708) -- 0:00:29 545000 -- (-1259.568) (-1257.323) [-1257.107] (-1256.540) * (-1262.248) (-1260.840) [-1257.788] (-1259.726) -- 0:00:29 Average standard deviation of split frequencies: 0.011122 545500 -- [-1258.205] (-1259.322) (-1259.243) (-1259.816) * (-1260.778) [-1258.621] (-1259.380) (-1260.938) -- 0:00:29 546000 -- (-1257.923) (-1259.445) [-1261.074] (-1259.323) * (-1258.067) (-1256.755) [-1258.976] (-1261.149) -- 0:00:29 546500 -- (-1256.646) (-1259.258) (-1258.076) [-1258.464] * (-1259.247) (-1258.189) (-1261.199) [-1256.547] -- 0:00:29 547000 -- [-1257.026] (-1258.435) (-1257.874) (-1256.597) * (-1256.753) [-1257.473] (-1258.311) (-1257.964) -- 0:00:28 547500 -- (-1258.134) (-1257.683) (-1258.236) [-1256.593] * (-1256.622) (-1258.148) [-1258.623] (-1263.440) -- 0:00:28 548000 -- (-1257.575) (-1257.560) (-1258.511) [-1256.586] * (-1258.093) (-1258.075) (-1256.930) [-1259.994] -- 0:00:28 548500 -- [-1256.366] (-1256.641) (-1256.413) (-1256.651) * (-1259.477) (-1256.397) (-1256.267) [-1257.470] -- 0:00:28 549000 -- (-1256.081) (-1256.910) (-1258.390) [-1260.653] * (-1256.806) (-1256.734) [-1256.684] (-1260.131) -- 0:00:28 549500 -- (-1256.259) (-1261.005) [-1262.557] (-1261.760) * (-1257.697) [-1258.490] (-1258.398) (-1258.559) -- 0:00:28 550000 -- (-1257.089) (-1257.210) (-1258.703) [-1257.453] * (-1258.309) (-1257.984) (-1261.916) [-1259.670] -- 0:00:28 Average standard deviation of split frequencies: 0.011381 550500 -- (-1258.921) (-1256.271) [-1260.164] (-1258.818) * (-1259.657) (-1257.275) (-1259.958) [-1258.849] -- 0:00:28 551000 -- (-1257.829) [-1260.789] (-1259.994) (-1261.079) * [-1257.606] (-1258.435) (-1260.845) (-1265.660) -- 0:00:28 551500 -- (-1257.762) [-1258.116] (-1257.086) (-1258.188) * (-1258.119) (-1257.278) [-1259.231] (-1259.676) -- 0:00:28 552000 -- (-1258.209) (-1258.566) [-1257.588] (-1259.136) * (-1258.249) (-1256.024) [-1258.224] (-1258.884) -- 0:00:28 552500 -- (-1256.704) [-1257.242] (-1257.677) (-1256.481) * (-1256.302) (-1257.668) [-1258.524] (-1259.061) -- 0:00:28 553000 -- [-1257.246] (-1257.498) (-1260.038) (-1257.049) * (-1256.973) (-1258.452) [-1259.471] (-1261.069) -- 0:00:28 553500 -- (-1261.549) (-1259.887) [-1257.136] (-1258.089) * (-1258.099) [-1259.859] (-1260.806) (-1259.407) -- 0:00:28 554000 -- (-1260.493) (-1258.325) (-1258.583) [-1257.090] * [-1261.161] (-1263.605) (-1259.517) (-1261.520) -- 0:00:28 554500 -- [-1257.561] (-1257.451) (-1260.818) (-1257.558) * (-1257.994) [-1258.177] (-1258.851) (-1258.521) -- 0:00:28 555000 -- (-1259.989) [-1257.269] (-1258.838) (-1261.187) * [-1259.539] (-1258.510) (-1258.894) (-1259.396) -- 0:00:28 Average standard deviation of split frequencies: 0.010972 555500 -- (-1258.579) [-1256.912] (-1258.385) (-1260.773) * (-1260.193) (-1258.297) (-1259.226) [-1258.063] -- 0:00:28 556000 -- [-1258.306] (-1257.074) (-1257.756) (-1260.059) * (-1256.671) (-1260.501) (-1258.390) [-1258.127] -- 0:00:27 556500 -- (-1256.888) (-1256.450) (-1257.617) [-1256.972] * [-1258.026] (-1258.026) (-1257.947) (-1258.242) -- 0:00:27 557000 -- (-1256.131) (-1256.874) (-1256.473) [-1258.321] * [-1257.091] (-1257.634) (-1256.989) (-1258.897) -- 0:00:27 557500 -- (-1255.984) [-1256.549] (-1257.549) (-1259.343) * [-1257.126] (-1257.959) (-1260.698) (-1257.718) -- 0:00:27 558000 -- (-1258.524) (-1260.649) (-1258.049) [-1257.892] * [-1256.074] (-1256.948) (-1260.988) (-1258.306) -- 0:00:27 558500 -- (-1257.655) (-1258.214) [-1259.126] (-1258.437) * [-1257.343] (-1259.403) (-1260.764) (-1256.266) -- 0:00:27 559000 -- (-1256.332) [-1257.375] (-1256.910) (-1258.345) * (-1257.644) (-1259.304) (-1261.976) [-1258.134] -- 0:00:27 559500 -- (-1258.103) (-1256.895) [-1258.186] (-1260.890) * [-1258.858] (-1261.643) (-1261.937) (-1258.792) -- 0:00:27 560000 -- (-1257.081) (-1257.838) (-1258.288) [-1258.677] * (-1258.097) [-1258.702] (-1258.723) (-1258.384) -- 0:00:27 Average standard deviation of split frequencies: 0.011029 560500 -- [-1256.933] (-1256.508) (-1262.419) (-1258.441) * (-1259.886) [-1259.919] (-1257.680) (-1259.751) -- 0:00:28 561000 -- (-1256.818) (-1256.131) (-1257.627) [-1257.802] * [-1260.525] (-1258.933) (-1261.315) (-1258.763) -- 0:00:28 561500 -- (-1256.687) (-1261.744) [-1259.328] (-1259.175) * (-1258.281) (-1257.882) (-1262.125) [-1258.935] -- 0:00:28 562000 -- (-1256.833) [-1258.375] (-1259.191) (-1256.971) * (-1260.038) (-1258.279) (-1257.054) [-1260.321] -- 0:00:28 562500 -- (-1257.404) (-1260.233) (-1260.655) [-1256.800] * [-1256.693] (-1255.987) (-1262.255) (-1259.412) -- 0:00:28 563000 -- [-1257.928] (-1257.166) (-1259.453) (-1257.461) * (-1256.845) [-1256.848] (-1261.035) (-1261.267) -- 0:00:27 563500 -- (-1259.038) [-1256.628] (-1259.127) (-1257.850) * (-1258.435) (-1257.698) (-1258.295) [-1257.713] -- 0:00:27 564000 -- (-1262.175) (-1257.921) [-1257.619] (-1257.407) * (-1263.547) (-1259.110) (-1259.983) [-1256.845] -- 0:00:27 564500 -- (-1260.385) [-1256.683] (-1257.589) (-1261.262) * (-1257.807) (-1257.842) (-1257.898) [-1257.126] -- 0:00:27 565000 -- (-1257.513) (-1256.813) [-1257.646] (-1256.712) * (-1263.664) (-1256.292) [-1256.409] (-1257.863) -- 0:00:27 Average standard deviation of split frequencies: 0.010827 565500 -- [-1258.536] (-1258.631) (-1258.214) (-1257.776) * (-1263.091) (-1257.981) (-1257.127) [-1258.393] -- 0:00:27 566000 -- (-1261.780) (-1259.279) [-1257.746] (-1257.361) * (-1256.906) (-1260.043) (-1256.993) [-1257.025] -- 0:00:27 566500 -- (-1260.041) (-1256.333) [-1256.134] (-1258.707) * (-1258.355) (-1257.221) [-1256.325] (-1257.031) -- 0:00:27 567000 -- (-1257.414) (-1256.460) (-1263.227) [-1257.128] * [-1258.110] (-1257.729) (-1259.865) (-1257.870) -- 0:00:27 567500 -- (-1259.807) [-1255.916] (-1259.704) (-1256.890) * (-1259.361) (-1256.713) (-1259.118) [-1257.475] -- 0:00:27 568000 -- (-1256.889) [-1257.032] (-1259.421) (-1265.260) * (-1257.500) (-1259.879) [-1256.530] (-1258.013) -- 0:00:27 568500 -- (-1259.090) [-1258.921] (-1260.109) (-1257.027) * [-1256.973] (-1260.014) (-1257.998) (-1258.513) -- 0:00:27 569000 -- (-1257.663) (-1260.329) (-1256.584) [-1258.878] * (-1257.231) (-1257.810) [-1259.200] (-1258.351) -- 0:00:27 569500 -- [-1256.665] (-1262.634) (-1256.736) (-1260.331) * (-1256.269) [-1257.542] (-1261.547) (-1258.704) -- 0:00:27 570000 -- [-1256.006] (-1258.678) (-1257.135) (-1256.310) * (-1257.642) (-1257.213) (-1260.607) [-1256.313] -- 0:00:27 Average standard deviation of split frequencies: 0.010885 570500 -- (-1257.322) [-1257.395] (-1258.575) (-1258.285) * [-1258.381] (-1258.910) (-1259.041) (-1260.381) -- 0:00:27 571000 -- (-1257.913) (-1259.399) [-1257.282] (-1257.890) * (-1259.388) [-1259.686] (-1260.022) (-1261.998) -- 0:00:27 571500 -- (-1258.204) (-1262.914) (-1258.897) [-1257.783] * (-1259.780) [-1257.186] (-1257.839) (-1257.133) -- 0:00:26 572000 -- (-1259.146) [-1257.257] (-1263.146) (-1257.108) * (-1259.463) (-1262.816) (-1257.475) [-1259.282] -- 0:00:26 572500 -- [-1256.841] (-1262.098) (-1263.668) (-1257.140) * (-1258.317) (-1256.961) [-1257.469] (-1256.864) -- 0:00:26 573000 -- (-1257.054) [-1260.332] (-1269.123) (-1257.896) * (-1262.733) (-1256.946) [-1261.285] (-1259.077) -- 0:00:26 573500 -- (-1257.308) [-1257.235] (-1259.563) (-1258.291) * [-1257.609] (-1258.417) (-1261.771) (-1260.476) -- 0:00:26 574000 -- (-1257.841) [-1256.877] (-1257.487) (-1256.886) * [-1256.109] (-1259.355) (-1261.484) (-1258.837) -- 0:00:26 574500 -- (-1258.471) (-1262.473) [-1257.757] (-1260.334) * (-1256.168) (-1257.068) (-1260.747) [-1258.044] -- 0:00:26 575000 -- (-1264.891) (-1257.669) (-1257.204) [-1258.465] * [-1256.574] (-1260.963) (-1260.309) (-1261.138) -- 0:00:26 Average standard deviation of split frequencies: 0.010013 575500 -- [-1260.901] (-1257.186) (-1258.656) (-1257.112) * (-1259.674) (-1258.264) [-1258.388] (-1258.422) -- 0:00:26 576000 -- (-1258.136) (-1257.022) (-1256.676) [-1259.936] * (-1258.486) (-1257.601) [-1260.290] (-1257.260) -- 0:00:26 576500 -- (-1256.964) (-1257.870) (-1257.887) [-1258.113] * (-1258.408) [-1257.592] (-1261.744) (-1265.373) -- 0:00:27 577000 -- [-1259.251] (-1257.933) (-1259.516) (-1260.574) * (-1263.402) [-1261.537] (-1257.599) (-1261.303) -- 0:00:27 577500 -- (-1261.648) [-1258.794] (-1259.554) (-1260.389) * (-1261.957) (-1258.385) (-1258.164) [-1259.797] -- 0:00:27 578000 -- [-1261.809] (-1260.815) (-1258.297) (-1261.178) * [-1259.103] (-1258.097) (-1256.791) (-1258.874) -- 0:00:27 578500 -- (-1257.005) (-1256.982) [-1258.187] (-1257.730) * [-1261.593] (-1257.890) (-1256.307) (-1264.084) -- 0:00:26 579000 -- [-1256.966] (-1256.803) (-1256.919) (-1257.418) * [-1257.999] (-1257.237) (-1255.963) (-1258.758) -- 0:00:26 579500 -- (-1257.377) [-1257.170] (-1258.079) (-1259.207) * [-1258.270] (-1257.820) (-1260.139) (-1261.338) -- 0:00:26 580000 -- (-1257.082) (-1256.558) (-1260.878) [-1258.241] * (-1260.571) (-1261.185) (-1259.865) [-1258.795] -- 0:00:26 Average standard deviation of split frequencies: 0.009551 580500 -- [-1260.554] (-1257.172) (-1261.906) (-1260.967) * (-1259.426) (-1260.438) (-1257.184) [-1258.760] -- 0:00:26 581000 -- (-1259.243) (-1257.261) (-1260.995) [-1265.940] * (-1259.011) (-1261.200) [-1259.683] (-1256.979) -- 0:00:26 581500 -- [-1259.765] (-1257.227) (-1258.885) (-1258.036) * (-1258.872) (-1259.785) [-1256.961] (-1260.175) -- 0:00:26 582000 -- (-1258.480) [-1256.352] (-1258.736) (-1258.214) * (-1260.153) [-1258.755] (-1260.446) (-1257.232) -- 0:00:26 582500 -- (-1259.475) (-1256.772) [-1257.463] (-1257.130) * (-1259.076) (-1258.075) [-1260.094] (-1259.049) -- 0:00:26 583000 -- (-1262.507) (-1260.577) [-1257.989] (-1261.375) * (-1256.938) (-1261.145) [-1258.700] (-1256.975) -- 0:00:26 583500 -- (-1258.575) [-1263.656] (-1256.946) (-1258.777) * (-1257.571) (-1259.446) [-1257.416] (-1258.800) -- 0:00:26 584000 -- (-1259.006) (-1261.136) (-1256.863) [-1257.737] * [-1259.812] (-1256.972) (-1261.159) (-1257.401) -- 0:00:26 584500 -- (-1260.326) (-1258.601) [-1260.662] (-1257.601) * (-1257.152) [-1258.542] (-1259.428) (-1259.653) -- 0:00:26 585000 -- (-1262.217) [-1257.345] (-1257.109) (-1257.101) * (-1257.942) [-1258.738] (-1257.906) (-1257.890) -- 0:00:26 Average standard deviation of split frequencies: 0.009151 585500 -- [-1261.092] (-1258.211) (-1259.312) (-1259.741) * (-1261.850) (-1260.238) (-1257.324) [-1257.094] -- 0:00:26 586000 -- (-1256.204) (-1257.641) (-1257.669) [-1256.977] * (-1257.660) [-1259.182] (-1258.850) (-1261.512) -- 0:00:26 586500 -- (-1258.349) (-1258.514) (-1262.861) [-1261.145] * [-1256.198] (-1260.455) (-1259.929) (-1258.031) -- 0:00:26 587000 -- (-1257.297) [-1256.703] (-1260.557) (-1259.451) * (-1257.233) (-1260.442) [-1260.394] (-1258.604) -- 0:00:26 587500 -- (-1263.966) (-1256.429) (-1257.707) [-1256.450] * (-1260.034) [-1257.073] (-1257.578) (-1257.759) -- 0:00:25 588000 -- (-1262.314) [-1258.369] (-1259.360) (-1257.865) * (-1258.308) [-1257.319] (-1257.714) (-1260.822) -- 0:00:25 588500 -- (-1261.193) [-1259.080] (-1257.145) (-1262.348) * (-1257.970) (-1256.905) [-1261.896] (-1258.487) -- 0:00:25 589000 -- [-1265.600] (-1259.559) (-1257.255) (-1259.728) * (-1256.785) [-1257.009] (-1261.035) (-1261.071) -- 0:00:25 589500 -- (-1263.626) (-1256.498) (-1262.696) [-1262.336] * [-1257.775] (-1257.343) (-1263.011) (-1258.320) -- 0:00:25 590000 -- (-1258.538) [-1257.009] (-1258.845) (-1260.479) * [-1264.367] (-1256.725) (-1265.071) (-1256.377) -- 0:00:25 Average standard deviation of split frequencies: 0.009677 590500 -- [-1256.196] (-1257.086) (-1263.930) (-1258.748) * (-1261.120) (-1256.571) [-1259.192] (-1256.363) -- 0:00:25 591000 -- (-1256.196) (-1259.951) [-1257.219] (-1259.377) * (-1257.287) (-1260.628) (-1260.465) [-1256.356] -- 0:00:25 591500 -- [-1256.662] (-1260.516) (-1256.409) (-1257.142) * (-1258.255) [-1261.174] (-1257.188) (-1260.466) -- 0:00:25 592000 -- (-1258.227) [-1257.252] (-1256.797) (-1257.983) * [-1256.755] (-1259.421) (-1257.452) (-1259.661) -- 0:00:25 592500 -- [-1258.268] (-1260.210) (-1256.523) (-1256.722) * (-1257.366) (-1261.758) [-1256.800] (-1260.337) -- 0:00:26 593000 -- [-1256.976] (-1258.876) (-1257.290) (-1257.286) * (-1256.870) (-1258.632) [-1258.476] (-1259.332) -- 0:00:26 593500 -- [-1256.653] (-1263.255) (-1256.621) (-1257.815) * (-1257.012) (-1259.798) (-1258.488) [-1259.219] -- 0:00:26 594000 -- (-1258.657) (-1261.730) (-1257.766) [-1257.887] * (-1257.316) (-1258.687) (-1259.474) [-1256.829] -- 0:00:25 594500 -- [-1257.528] (-1257.225) (-1256.774) (-1257.817) * (-1256.983) (-1256.335) [-1257.869] (-1259.870) -- 0:00:25 595000 -- (-1262.476) (-1257.941) (-1260.397) [-1258.151] * [-1259.361] (-1258.427) (-1263.533) (-1258.662) -- 0:00:25 Average standard deviation of split frequencies: 0.009640 595500 -- (-1256.587) (-1257.745) [-1258.483] (-1258.530) * (-1259.682) (-1259.344) (-1262.124) [-1256.901] -- 0:00:25 596000 -- (-1256.791) [-1256.614] (-1259.662) (-1257.247) * (-1266.384) (-1259.351) (-1260.342) [-1261.949] -- 0:00:25 596500 -- (-1256.872) [-1257.795] (-1260.350) (-1258.160) * (-1257.728) (-1257.417) [-1257.331] (-1257.373) -- 0:00:25 597000 -- (-1259.590) (-1256.260) (-1258.178) [-1259.403] * (-1261.481) (-1256.734) [-1257.156] (-1259.352) -- 0:00:25 597500 -- (-1259.531) (-1256.990) (-1258.427) [-1257.695] * (-1257.405) (-1257.013) (-1261.430) [-1257.892] -- 0:00:25 598000 -- (-1257.106) [-1256.683] (-1257.501) (-1257.859) * (-1255.930) (-1260.539) [-1260.072] (-1261.320) -- 0:00:25 598500 -- (-1260.513) (-1256.212) [-1258.316] (-1259.246) * (-1260.238) (-1262.599) (-1258.224) [-1258.771] -- 0:00:25 599000 -- (-1261.949) [-1257.697] (-1258.125) (-1258.435) * (-1258.240) (-1259.415) (-1256.734) [-1257.755] -- 0:00:25 599500 -- (-1259.242) (-1257.815) [-1257.290] (-1258.776) * (-1261.185) (-1256.888) (-1256.328) [-1257.757] -- 0:00:25 600000 -- (-1256.635) [-1257.820] (-1256.865) (-1258.978) * (-1260.290) (-1257.251) (-1260.867) [-1256.967] -- 0:00:25 Average standard deviation of split frequencies: 0.010153 600500 -- (-1258.924) [-1261.109] (-1258.197) (-1262.611) * (-1260.304) (-1257.985) (-1257.626) [-1260.681] -- 0:00:25 601000 -- (-1258.245) (-1256.084) [-1257.630] (-1260.278) * (-1257.792) [-1257.902] (-1259.888) (-1266.653) -- 0:00:25 601500 -- [-1259.218] (-1258.459) (-1259.332) (-1259.731) * (-1259.148) (-1259.641) [-1257.190] (-1263.185) -- 0:00:25 602000 -- [-1257.357] (-1259.193) (-1258.093) (-1260.662) * (-1261.315) [-1263.435] (-1256.872) (-1258.855) -- 0:00:25 602500 -- (-1257.030) (-1260.597) [-1257.510] (-1260.569) * (-1257.389) (-1257.900) [-1257.171] (-1258.794) -- 0:00:25 603000 -- (-1256.350) (-1258.432) [-1257.512] (-1256.815) * (-1257.616) (-1259.392) [-1257.687] (-1257.631) -- 0:00:25 603500 -- (-1259.297) (-1259.389) (-1257.695) [-1256.923] * (-1263.294) (-1258.247) (-1256.262) [-1258.478] -- 0:00:24 604000 -- (-1261.229) [-1257.081] (-1258.433) (-1259.586) * (-1260.376) (-1257.626) [-1256.304] (-1262.346) -- 0:00:24 604500 -- (-1257.515) (-1264.336) [-1256.939] (-1257.051) * [-1256.729] (-1257.635) (-1256.043) (-1260.465) -- 0:00:24 605000 -- [-1256.259] (-1261.770) (-1258.920) (-1259.161) * (-1258.454) (-1256.090) (-1257.759) [-1262.787] -- 0:00:24 Average standard deviation of split frequencies: 0.009289 605500 -- (-1257.530) [-1258.125] (-1260.169) (-1257.652) * (-1263.954) [-1257.958] (-1259.733) (-1257.923) -- 0:00:24 606000 -- (-1257.458) [-1261.338] (-1258.227) (-1256.666) * [-1259.978] (-1259.159) (-1257.882) (-1262.084) -- 0:00:24 606500 -- (-1256.960) [-1260.281] (-1257.979) (-1256.417) * [-1258.986] (-1257.043) (-1257.863) (-1256.656) -- 0:00:24 607000 -- [-1257.120] (-1258.043) (-1257.980) (-1257.503) * (-1262.996) (-1257.315) (-1257.193) [-1256.292] -- 0:00:24 607500 -- (-1259.861) [-1257.859] (-1260.705) (-1261.354) * [-1259.494] (-1258.407) (-1257.363) (-1258.110) -- 0:00:24 608000 -- (-1259.544) (-1257.409) (-1258.191) [-1260.052] * (-1261.799) (-1259.027) (-1257.864) [-1258.269] -- 0:00:24 608500 -- [-1257.096] (-1257.598) (-1258.394) (-1257.296) * (-1256.542) (-1257.152) (-1257.312) [-1256.257] -- 0:00:25 609000 -- (-1259.249) (-1260.127) (-1257.313) [-1258.530] * (-1258.296) (-1257.582) [-1256.587] (-1257.664) -- 0:00:25 609500 -- (-1257.202) [-1256.874] (-1257.310) (-1257.983) * (-1257.264) (-1256.325) [-1258.079] (-1257.957) -- 0:00:24 610000 -- (-1256.469) (-1258.649) [-1257.376] (-1257.495) * (-1257.044) [-1257.793] (-1259.760) (-1258.619) -- 0:00:24 Average standard deviation of split frequencies: 0.009854 610500 -- (-1257.462) (-1257.918) [-1257.058] (-1256.503) * (-1258.914) (-1260.871) [-1257.249] (-1257.584) -- 0:00:24 611000 -- [-1256.850] (-1261.853) (-1259.188) (-1256.871) * [-1258.004] (-1258.464) (-1256.794) (-1258.580) -- 0:00:24 611500 -- (-1256.371) (-1258.143) (-1257.711) [-1257.914] * (-1256.661) (-1258.173) (-1259.346) [-1257.948] -- 0:00:24 612000 -- [-1257.714] (-1258.613) (-1257.244) (-1260.722) * [-1257.018] (-1267.006) (-1256.229) (-1258.539) -- 0:00:24 612500 -- (-1257.466) (-1262.099) [-1256.705] (-1257.109) * [-1261.107] (-1259.270) (-1257.006) (-1258.021) -- 0:00:24 613000 -- (-1257.904) (-1258.466) (-1257.854) [-1260.218] * [-1260.160] (-1256.943) (-1257.005) (-1258.486) -- 0:00:24 613500 -- [-1259.297] (-1259.370) (-1256.490) (-1257.051) * [-1257.620] (-1258.884) (-1257.184) (-1257.693) -- 0:00:24 614000 -- (-1257.828) (-1259.086) [-1256.894] (-1259.453) * (-1262.407) [-1257.248] (-1258.795) (-1257.309) -- 0:00:24 614500 -- [-1257.370] (-1258.131) (-1258.230) (-1256.707) * (-1257.641) (-1257.319) (-1257.655) [-1257.716] -- 0:00:24 615000 -- (-1256.618) (-1258.891) [-1259.031] (-1256.557) * (-1258.266) (-1257.952) (-1260.668) [-1256.403] -- 0:00:24 Average standard deviation of split frequencies: 0.009633 615500 -- [-1256.449] (-1261.209) (-1259.193) (-1256.407) * (-1256.764) (-1260.942) [-1257.006] (-1262.201) -- 0:00:24 616000 -- [-1257.019] (-1257.125) (-1261.135) (-1257.525) * (-1256.886) (-1257.760) (-1259.593) [-1262.354] -- 0:00:24 616500 -- (-1257.464) (-1258.347) (-1259.810) [-1258.699] * [-1259.012] (-1260.281) (-1255.967) (-1257.595) -- 0:00:24 617000 -- (-1257.930) [-1259.286] (-1261.007) (-1259.270) * (-1264.052) (-1257.741) [-1261.384] (-1258.241) -- 0:00:24 617500 -- (-1259.446) (-1258.017) (-1261.496) [-1259.086] * (-1256.449) [-1257.773] (-1258.993) (-1256.996) -- 0:00:24 618000 -- (-1262.239) [-1257.605] (-1258.090) (-1256.355) * [-1256.687] (-1261.581) (-1258.460) (-1265.177) -- 0:00:24 618500 -- (-1257.580) (-1264.397) (-1259.955) [-1261.362] * [-1259.456] (-1258.292) (-1258.293) (-1259.609) -- 0:00:24 619000 -- (-1257.262) (-1260.853) [-1260.005] (-1261.963) * (-1259.245) [-1259.284] (-1258.283) (-1258.879) -- 0:00:24 619500 -- (-1257.833) [-1258.549] (-1260.172) (-1258.377) * [-1257.325] (-1261.426) (-1257.445) (-1257.387) -- 0:00:23 620000 -- (-1258.003) (-1259.172) [-1265.111] (-1257.485) * (-1262.828) (-1260.686) (-1256.522) [-1257.305] -- 0:00:23 Average standard deviation of split frequencies: 0.008980 620500 -- (-1263.027) [-1257.356] (-1258.545) (-1257.567) * (-1258.182) (-1256.361) (-1258.316) [-1258.188] -- 0:00:23 621000 -- (-1258.274) [-1259.070] (-1258.434) (-1257.096) * (-1256.416) (-1258.266) [-1258.398] (-1257.004) -- 0:00:23 621500 -- [-1260.930] (-1260.591) (-1258.126) (-1260.507) * [-1256.373] (-1260.614) (-1257.078) (-1259.735) -- 0:00:23 622000 -- (-1258.001) [-1257.517] (-1256.813) (-1261.961) * (-1260.233) (-1260.511) (-1257.866) [-1259.688] -- 0:00:23 622500 -- (-1257.729) (-1257.335) (-1257.607) [-1263.316] * (-1260.046) [-1262.103] (-1257.410) (-1259.722) -- 0:00:23 623000 -- (-1257.065) (-1258.961) (-1261.828) [-1258.770] * (-1260.368) (-1257.470) [-1257.994] (-1261.425) -- 0:00:23 623500 -- [-1256.836] (-1260.610) (-1259.352) (-1261.506) * (-1259.346) (-1259.753) (-1257.480) [-1263.295] -- 0:00:23 624000 -- (-1257.000) (-1257.882) (-1261.088) [-1260.573] * (-1258.253) (-1259.394) (-1260.030) [-1260.112] -- 0:00:23 624500 -- [-1258.690] (-1256.797) (-1258.036) (-1257.819) * [-1257.427] (-1260.627) (-1260.360) (-1259.932) -- 0:00:24 625000 -- [-1259.802] (-1257.362) (-1262.402) (-1263.543) * (-1259.570) [-1260.300] (-1259.906) (-1260.850) -- 0:00:24 Average standard deviation of split frequencies: 0.008195 625500 -- (-1259.420) (-1261.216) (-1258.927) [-1257.157] * (-1257.421) (-1261.722) (-1260.526) [-1260.999] -- 0:00:23 626000 -- (-1259.834) (-1260.374) (-1261.174) [-1258.992] * (-1258.337) [-1259.808] (-1262.277) (-1264.024) -- 0:00:23 626500 -- (-1263.045) [-1261.935] (-1259.426) (-1259.413) * (-1257.176) (-1258.132) [-1258.372] (-1262.238) -- 0:00:23 627000 -- (-1262.859) (-1258.741) [-1259.269] (-1259.575) * (-1259.939) (-1259.668) [-1261.707] (-1258.646) -- 0:00:23 627500 -- (-1259.053) (-1257.874) (-1260.257) [-1257.936] * (-1261.858) (-1262.834) [-1256.945] (-1256.615) -- 0:00:23 628000 -- (-1258.558) (-1257.647) [-1261.824] (-1257.436) * [-1261.707] (-1262.272) (-1262.821) (-1258.437) -- 0:00:23 628500 -- (-1257.903) (-1260.063) (-1260.232) [-1258.222] * [-1258.732] (-1257.321) (-1261.942) (-1258.262) -- 0:00:23 629000 -- (-1257.247) [-1258.942] (-1256.904) (-1258.781) * (-1257.329) [-1257.316] (-1257.301) (-1268.098) -- 0:00:23 629500 -- (-1256.795) [-1261.772] (-1257.437) (-1262.260) * (-1258.680) (-1261.658) [-1257.341] (-1263.047) -- 0:00:23 630000 -- (-1257.643) (-1258.356) (-1259.536) [-1263.460] * (-1260.571) [-1258.879] (-1256.553) (-1260.492) -- 0:00:23 Average standard deviation of split frequencies: 0.008354 630500 -- (-1256.088) [-1258.219] (-1256.323) (-1263.052) * (-1260.106) (-1257.721) [-1256.674] (-1260.091) -- 0:00:23 631000 -- (-1259.849) [-1258.028] (-1257.084) (-1259.703) * [-1260.384] (-1260.185) (-1258.331) (-1259.390) -- 0:00:23 631500 -- (-1259.981) (-1259.827) (-1256.943) [-1256.775] * [-1259.199] (-1259.315) (-1257.559) (-1257.098) -- 0:00:23 632000 -- [-1260.279] (-1259.108) (-1258.797) (-1257.346) * (-1260.108) (-1264.430) [-1258.269] (-1258.683) -- 0:00:23 632500 -- [-1259.499] (-1257.711) (-1266.620) (-1262.472) * (-1260.450) (-1257.345) [-1262.065] (-1259.040) -- 0:00:23 633000 -- (-1257.542) [-1257.014] (-1259.431) (-1258.029) * [-1257.155] (-1259.393) (-1258.803) (-1259.211) -- 0:00:23 633500 -- (-1258.313) [-1256.602] (-1257.544) (-1258.944) * (-1257.156) (-1264.204) [-1256.198] (-1256.828) -- 0:00:23 634000 -- [-1259.021] (-1256.864) (-1258.301) (-1258.836) * (-1256.223) (-1257.586) (-1261.461) [-1258.165] -- 0:00:23 634500 -- (-1258.287) (-1261.149) (-1261.001) [-1258.887] * (-1266.890) (-1257.927) [-1258.626] (-1257.700) -- 0:00:23 635000 -- (-1257.316) (-1263.611) (-1257.706) [-1256.731] * (-1263.496) (-1257.059) (-1259.746) [-1256.162] -- 0:00:22 Average standard deviation of split frequencies: 0.008022 635500 -- (-1257.257) [-1260.115] (-1265.229) (-1258.949) * (-1258.417) (-1259.650) [-1259.500] (-1258.570) -- 0:00:22 636000 -- (-1256.540) (-1260.251) (-1263.691) [-1259.496] * (-1258.241) [-1259.276] (-1257.778) (-1257.342) -- 0:00:22 636500 -- (-1257.349) [-1261.407] (-1258.494) (-1257.928) * (-1258.134) (-1258.071) (-1260.213) [-1257.779] -- 0:00:22 637000 -- (-1257.962) (-1259.263) [-1257.898] (-1258.322) * (-1258.490) (-1263.396) (-1258.448) [-1256.225] -- 0:00:22 637500 -- (-1257.270) (-1257.001) (-1259.553) [-1259.861] * (-1257.842) (-1256.498) (-1258.515) [-1258.103] -- 0:00:22 638000 -- (-1260.875) (-1257.790) (-1262.720) [-1258.513] * [-1258.855] (-1256.254) (-1257.736) (-1257.068) -- 0:00:22 638500 -- (-1256.867) (-1256.512) [-1259.133] (-1258.183) * [-1258.708] (-1259.279) (-1261.409) (-1257.566) -- 0:00:22 639000 -- [-1257.766] (-1258.971) (-1256.241) (-1259.377) * (-1263.380) (-1262.892) (-1256.562) [-1257.278] -- 0:00:22 639500 -- [-1256.332] (-1265.948) (-1257.591) (-1259.150) * (-1258.865) (-1259.274) [-1256.962] (-1258.740) -- 0:00:22 640000 -- (-1256.317) (-1258.636) [-1257.435] (-1259.491) * (-1256.546) (-1257.583) [-1256.591] (-1257.226) -- 0:00:22 Average standard deviation of split frequencies: 0.008180 640500 -- [-1257.227] (-1258.101) (-1257.034) (-1261.804) * [-1256.985] (-1259.564) (-1257.607) (-1259.250) -- 0:00:23 641000 -- (-1260.729) (-1259.747) [-1258.917] (-1264.021) * (-1263.374) [-1260.903] (-1257.308) (-1261.813) -- 0:00:22 641500 -- (-1257.353) [-1259.445] (-1261.151) (-1260.489) * (-1259.491) (-1259.792) (-1262.280) [-1257.375] -- 0:00:22 642000 -- (-1257.565) (-1260.408) [-1258.686] (-1256.114) * (-1260.371) (-1258.819) [-1262.228] (-1257.623) -- 0:00:22 642500 -- (-1258.299) (-1257.533) [-1258.831] (-1257.796) * (-1260.644) (-1256.853) (-1258.115) [-1257.972] -- 0:00:22 643000 -- (-1259.599) [-1256.415] (-1258.748) (-1259.632) * (-1256.699) (-1256.458) [-1256.231] (-1258.791) -- 0:00:22 643500 -- [-1259.142] (-1257.628) (-1259.685) (-1258.170) * (-1256.787) (-1257.588) [-1257.534] (-1256.656) -- 0:00:22 644000 -- (-1260.090) [-1258.481] (-1264.652) (-1261.103) * (-1258.409) (-1258.305) (-1260.202) [-1256.265] -- 0:00:22 644500 -- (-1256.855) (-1260.415) [-1261.291] (-1260.996) * (-1259.395) [-1257.744] (-1259.112) (-1263.215) -- 0:00:22 645000 -- (-1256.336) [-1257.492] (-1260.218) (-1256.849) * (-1262.189) [-1257.008] (-1258.600) (-1262.545) -- 0:00:22 Average standard deviation of split frequencies: 0.007727 645500 -- (-1261.418) (-1259.072) [-1261.217] (-1260.705) * [-1257.054] (-1260.685) (-1259.907) (-1264.438) -- 0:00:22 646000 -- (-1259.288) [-1259.353] (-1260.251) (-1257.316) * [-1257.220] (-1256.888) (-1260.202) (-1261.288) -- 0:00:22 646500 -- [-1256.811] (-1259.314) (-1262.111) (-1257.331) * [-1258.012] (-1257.050) (-1258.835) (-1262.218) -- 0:00:22 647000 -- (-1259.629) [-1256.343] (-1256.387) (-1263.697) * [-1257.202] (-1258.302) (-1259.404) (-1258.141) -- 0:00:22 647500 -- (-1257.155) (-1259.002) (-1256.446) [-1259.096] * (-1256.815) (-1260.481) (-1259.075) [-1259.336] -- 0:00:22 648000 -- (-1258.546) (-1259.151) [-1256.497] (-1257.054) * (-1256.504) (-1258.029) (-1258.066) [-1258.832] -- 0:00:22 648500 -- [-1258.600] (-1257.336) (-1256.325) (-1260.284) * (-1255.982) (-1256.513) (-1257.836) [-1258.512] -- 0:00:22 649000 -- (-1258.147) (-1260.569) [-1256.861] (-1258.140) * (-1264.373) (-1257.804) (-1258.403) [-1257.564] -- 0:00:22 649500 -- (-1258.713) (-1256.523) (-1256.152) [-1258.134] * [-1264.310] (-1258.996) (-1259.244) (-1259.075) -- 0:00:22 650000 -- (-1258.364) (-1259.522) [-1259.868] (-1259.783) * (-1257.882) [-1258.996] (-1259.874) (-1258.215) -- 0:00:22 Average standard deviation of split frequencies: 0.007671 650500 -- (-1259.704) (-1258.105) [-1257.168] (-1262.150) * (-1258.237) (-1261.707) (-1257.140) [-1257.746] -- 0:00:22 651000 -- (-1257.819) [-1256.735] (-1258.310) (-1262.199) * [-1260.256] (-1258.916) (-1258.524) (-1258.643) -- 0:00:21 651500 -- [-1259.068] (-1256.546) (-1259.060) (-1261.102) * (-1260.638) (-1259.128) [-1259.312] (-1260.982) -- 0:00:21 652000 -- (-1260.182) [-1256.069] (-1269.616) (-1260.869) * (-1257.612) (-1261.894) (-1261.507) [-1257.377] -- 0:00:21 652500 -- (-1259.490) [-1258.976] (-1264.603) (-1261.819) * (-1259.204) [-1259.726] (-1258.834) (-1256.687) -- 0:00:21 653000 -- (-1261.512) [-1258.479] (-1260.255) (-1256.854) * (-1257.426) (-1256.814) [-1261.436] (-1256.053) -- 0:00:21 653500 -- (-1258.764) [-1257.946] (-1257.763) (-1262.205) * (-1256.706) [-1260.751] (-1258.740) (-1260.288) -- 0:00:21 654000 -- [-1257.886] (-1257.797) (-1256.882) (-1260.230) * [-1257.478] (-1258.730) (-1261.035) (-1261.777) -- 0:00:21 654500 -- (-1259.876) (-1256.512) (-1256.814) [-1259.033] * [-1256.221] (-1259.508) (-1256.683) (-1269.163) -- 0:00:21 655000 -- (-1257.705) [-1256.941] (-1256.881) (-1262.543) * [-1256.438] (-1260.286) (-1257.008) (-1257.351) -- 0:00:21 Average standard deviation of split frequencies: 0.008116 655500 -- [-1261.195] (-1258.685) (-1257.887) (-1260.128) * (-1258.108) (-1258.479) (-1257.254) [-1257.630] -- 0:00:21 656000 -- (-1257.790) (-1258.746) [-1257.448] (-1257.276) * [-1258.001] (-1257.257) (-1261.009) (-1258.657) -- 0:00:21 656500 -- (-1257.928) (-1257.653) [-1259.478] (-1258.148) * [-1257.238] (-1257.530) (-1261.434) (-1256.268) -- 0:00:21 657000 -- (-1256.518) (-1263.735) [-1263.961] (-1261.363) * [-1257.825] (-1259.468) (-1262.694) (-1260.169) -- 0:00:21 657500 -- (-1257.733) (-1256.422) [-1256.795] (-1259.131) * [-1256.510] (-1256.463) (-1259.517) (-1257.979) -- 0:00:21 658000 -- (-1258.990) [-1256.806] (-1260.470) (-1260.126) * (-1257.873) (-1258.733) (-1258.246) [-1257.257] -- 0:00:21 658500 -- (-1257.808) [-1256.736] (-1259.988) (-1258.358) * [-1258.114] (-1260.473) (-1260.195) (-1260.419) -- 0:00:21 659000 -- [-1257.547] (-1259.476) (-1258.828) (-1261.696) * (-1261.192) (-1259.075) (-1259.951) [-1256.996] -- 0:00:21 659500 -- (-1257.059) (-1257.768) [-1258.338] (-1258.950) * [-1259.371] (-1259.421) (-1261.085) (-1259.338) -- 0:00:21 660000 -- (-1260.695) (-1256.554) (-1257.389) [-1258.343] * [-1258.673] (-1259.155) (-1262.083) (-1256.998) -- 0:00:21 Average standard deviation of split frequencies: 0.007765 660500 -- (-1258.341) [-1256.754] (-1261.648) (-1260.490) * (-1261.128) (-1258.455) [-1257.820] (-1259.325) -- 0:00:21 661000 -- (-1261.658) (-1258.979) (-1258.875) [-1260.474] * [-1257.413] (-1258.229) (-1258.076) (-1258.191) -- 0:00:21 661500 -- (-1255.881) (-1259.180) [-1257.300] (-1259.204) * [-1256.196] (-1259.197) (-1257.019) (-1258.190) -- 0:00:21 662000 -- [-1257.898] (-1256.305) (-1255.913) (-1259.073) * (-1256.983) (-1260.700) (-1257.722) [-1261.232] -- 0:00:21 662500 -- (-1257.961) (-1259.468) [-1257.952] (-1260.571) * [-1257.568] (-1256.923) (-1260.962) (-1259.632) -- 0:00:21 663000 -- (-1259.347) [-1258.583] (-1260.316) (-1260.669) * (-1261.002) (-1256.324) [-1258.057] (-1260.444) -- 0:00:21 663500 -- (-1259.492) [-1260.638] (-1256.759) (-1257.886) * (-1257.315) [-1257.321] (-1256.665) (-1260.080) -- 0:00:21 664000 -- (-1256.297) (-1260.578) [-1257.856] (-1262.026) * [-1258.252] (-1257.791) (-1258.343) (-1259.889) -- 0:00:21 664500 -- [-1258.967] (-1259.610) (-1259.321) (-1261.089) * (-1258.770) [-1259.700] (-1257.852) (-1258.785) -- 0:00:21 665000 -- (-1257.699) (-1260.662) [-1257.191] (-1266.808) * [-1256.345] (-1257.989) (-1259.064) (-1257.355) -- 0:00:21 Average standard deviation of split frequencies: 0.007911 665500 -- (-1257.800) (-1260.564) [-1260.143] (-1257.891) * (-1256.431) (-1258.927) [-1260.720] (-1262.587) -- 0:00:21 666000 -- (-1258.923) (-1260.281) (-1256.430) [-1256.349] * (-1258.180) [-1263.681] (-1259.427) (-1259.710) -- 0:00:21 666500 -- [-1256.985] (-1259.624) (-1258.216) (-1256.368) * (-1261.311) (-1258.220) (-1257.815) [-1257.234] -- 0:00:21 667000 -- (-1259.963) (-1258.299) (-1264.709) [-1258.633] * (-1258.071) (-1256.837) (-1257.432) [-1257.761] -- 0:00:20 667500 -- (-1258.816) (-1257.089) [-1256.527] (-1257.706) * [-1257.290] (-1258.965) (-1257.925) (-1258.209) -- 0:00:20 668000 -- (-1257.015) (-1259.342) (-1256.424) [-1257.809] * (-1258.238) (-1257.141) [-1258.101] (-1266.195) -- 0:00:20 668500 -- [-1257.636] (-1257.186) (-1259.112) (-1258.109) * (-1262.813) [-1257.099] (-1257.388) (-1262.862) -- 0:00:20 669000 -- (-1256.860) [-1257.907] (-1258.944) (-1257.259) * (-1263.844) [-1258.730] (-1259.135) (-1259.164) -- 0:00:20 669500 -- (-1260.456) (-1258.248) (-1257.660) [-1257.250] * [-1266.903] (-1258.470) (-1258.723) (-1257.596) -- 0:00:20 670000 -- (-1261.200) (-1257.569) (-1259.786) [-1256.931] * [-1257.175] (-1257.309) (-1257.428) (-1258.140) -- 0:00:20 Average standard deviation of split frequencies: 0.008269 670500 -- (-1260.070) (-1256.925) [-1260.088] (-1256.313) * (-1257.153) (-1262.407) (-1259.225) [-1259.009] -- 0:00:20 671000 -- [-1259.176] (-1262.561) (-1260.886) (-1256.608) * (-1257.654) (-1258.389) [-1257.433] (-1261.722) -- 0:00:20 671500 -- (-1257.216) [-1257.887] (-1260.690) (-1260.094) * (-1257.557) (-1259.189) [-1257.744] (-1257.828) -- 0:00:20 672000 -- [-1257.169] (-1258.989) (-1259.453) (-1258.086) * (-1261.984) (-1257.864) [-1257.169] (-1257.131) -- 0:00:20 672500 -- (-1255.970) [-1258.460] (-1257.905) (-1257.107) * [-1257.529] (-1259.882) (-1257.349) (-1260.554) -- 0:00:20 673000 -- (-1257.824) (-1257.004) (-1257.101) [-1256.326] * (-1258.200) (-1258.626) (-1257.205) [-1256.936] -- 0:00:20 673500 -- (-1257.245) (-1256.862) [-1258.837] (-1263.282) * (-1257.227) (-1259.058) [-1257.211] (-1260.108) -- 0:00:20 674000 -- (-1257.073) (-1258.527) (-1258.659) [-1265.830] * (-1257.635) (-1260.668) (-1261.481) [-1260.000] -- 0:00:20 674500 -- (-1257.982) [-1258.572] (-1256.577) (-1258.877) * (-1257.709) (-1260.743) (-1257.290) [-1259.529] -- 0:00:20 675000 -- (-1258.556) (-1260.112) (-1256.933) [-1258.081] * [-1257.858] (-1256.842) (-1259.793) (-1259.235) -- 0:00:20 Average standard deviation of split frequencies: 0.007630 675500 -- [-1261.720] (-1258.782) (-1256.693) (-1258.232) * [-1256.869] (-1257.773) (-1264.368) (-1259.643) -- 0:00:20 676000 -- (-1258.586) (-1257.166) [-1256.610] (-1259.398) * [-1256.969] (-1257.904) (-1256.111) (-1257.588) -- 0:00:20 676500 -- (-1260.445) (-1257.166) (-1258.532) [-1258.726] * (-1258.064) [-1258.516] (-1256.259) (-1258.077) -- 0:00:20 677000 -- (-1258.411) [-1256.306] (-1261.748) (-1259.923) * (-1257.474) (-1258.936) [-1256.403] (-1256.443) -- 0:00:20 677500 -- (-1259.807) [-1257.820] (-1258.840) (-1259.285) * (-1256.570) [-1260.219] (-1257.873) (-1257.937) -- 0:00:20 678000 -- (-1257.998) [-1258.299] (-1258.043) (-1257.151) * (-1257.949) (-1260.620) [-1259.198] (-1260.544) -- 0:00:20 678500 -- (-1258.407) (-1257.608) [-1257.649] (-1259.699) * [-1262.363] (-1258.633) (-1258.963) (-1258.252) -- 0:00:20 679000 -- (-1260.885) (-1256.282) (-1257.190) [-1258.142] * (-1260.009) [-1261.736] (-1258.288) (-1258.404) -- 0:00:20 679500 -- (-1256.593) [-1256.359] (-1256.631) (-1258.637) * (-1257.231) (-1265.860) [-1257.435] (-1257.724) -- 0:00:20 680000 -- (-1258.346) (-1261.563) [-1259.184] (-1260.280) * (-1258.116) (-1257.084) (-1261.146) [-1258.334] -- 0:00:20 Average standard deviation of split frequencies: 0.007089 680500 -- (-1259.342) (-1257.678) [-1257.880] (-1258.914) * (-1256.767) (-1259.795) [-1257.671] (-1257.481) -- 0:00:20 681000 -- (-1257.511) (-1257.538) [-1256.470] (-1257.504) * (-1257.371) (-1257.417) [-1257.081] (-1258.157) -- 0:00:20 681500 -- (-1257.571) (-1257.428) [-1256.565] (-1259.317) * (-1257.485) [-1258.514] (-1256.405) (-1256.880) -- 0:00:20 682000 -- (-1260.837) (-1256.444) [-1257.472] (-1263.928) * [-1256.465] (-1256.564) (-1259.132) (-1259.919) -- 0:00:20 682500 -- [-1257.136] (-1260.427) (-1256.391) (-1262.230) * (-1260.242) [-1256.969] (-1256.919) (-1259.037) -- 0:00:20 683000 -- (-1262.879) (-1256.796) (-1256.486) [-1259.937] * (-1258.447) (-1258.172) (-1259.047) [-1259.075] -- 0:00:19 683500 -- (-1257.591) (-1259.680) [-1258.774] (-1260.389) * (-1258.639) (-1256.094) [-1256.056] (-1257.442) -- 0:00:19 684000 -- (-1256.860) (-1261.953) [-1258.195] (-1258.839) * [-1256.194] (-1256.638) (-1258.880) (-1257.268) -- 0:00:19 684500 -- (-1258.948) (-1257.804) [-1258.485] (-1257.676) * (-1260.634) [-1258.965] (-1259.720) (-1258.053) -- 0:00:19 685000 -- (-1257.855) (-1259.060) [-1257.603] (-1257.666) * (-1257.667) (-1258.452) [-1257.321] (-1259.550) -- 0:00:19 Average standard deviation of split frequencies: 0.007276 685500 -- [-1257.366] (-1259.988) (-1257.657) (-1259.390) * (-1265.740) [-1258.294] (-1259.927) (-1261.991) -- 0:00:19 686000 -- (-1259.843) (-1260.083) (-1260.435) [-1260.288] * (-1259.149) [-1259.945] (-1258.344) (-1261.195) -- 0:00:19 686500 -- (-1256.858) [-1257.942] (-1261.230) (-1257.574) * (-1261.470) (-1257.539) (-1264.384) [-1260.522] -- 0:00:19 687000 -- (-1258.012) [-1259.017] (-1257.734) (-1257.972) * (-1256.715) (-1258.198) (-1257.681) [-1260.984] -- 0:00:19 687500 -- (-1260.379) (-1256.761) (-1256.545) [-1260.388] * (-1263.776) (-1258.442) [-1256.415] (-1257.382) -- 0:00:19 688000 -- (-1259.937) [-1258.773] (-1257.555) (-1257.522) * (-1258.386) [-1259.229] (-1258.674) (-1257.134) -- 0:00:19 688500 -- (-1261.988) [-1259.475] (-1260.304) (-1260.210) * [-1259.834] (-1256.956) (-1262.247) (-1260.178) -- 0:00:19 689000 -- (-1257.961) (-1258.005) [-1257.856] (-1257.763) * (-1258.050) [-1259.572] (-1259.192) (-1259.787) -- 0:00:19 689500 -- (-1258.032) (-1258.041) (-1257.792) [-1258.884] * [-1258.038] (-1259.984) (-1258.957) (-1264.882) -- 0:00:19 690000 -- (-1256.102) [-1257.621] (-1257.984) (-1258.232) * [-1257.550] (-1257.298) (-1258.724) (-1258.003) -- 0:00:19 Average standard deviation of split frequencies: 0.007668 690500 -- [-1256.616] (-1256.950) (-1256.886) (-1261.065) * [-1261.396] (-1258.666) (-1265.448) (-1260.431) -- 0:00:19 691000 -- [-1258.392] (-1262.764) (-1258.324) (-1260.512) * [-1257.741] (-1257.225) (-1259.458) (-1261.170) -- 0:00:19 691500 -- (-1256.030) (-1257.832) (-1256.573) [-1256.129] * [-1258.748] (-1257.680) (-1258.887) (-1262.339) -- 0:00:19 692000 -- [-1256.656] (-1257.881) (-1257.889) (-1260.843) * (-1259.698) (-1256.834) (-1258.575) [-1256.376] -- 0:00:19 692500 -- (-1258.642) (-1257.266) (-1259.445) [-1261.109] * (-1257.664) [-1257.520] (-1257.809) (-1256.661) -- 0:00:19 693000 -- (-1257.712) [-1256.572] (-1258.505) (-1260.219) * (-1260.497) (-1263.001) (-1262.384) [-1257.106] -- 0:00:19 693500 -- (-1258.545) (-1257.979) [-1258.484] (-1256.953) * (-1257.457) (-1260.744) (-1263.960) [-1257.520] -- 0:00:19 694000 -- (-1257.044) [-1257.578] (-1258.128) (-1258.055) * (-1258.077) (-1258.814) [-1258.224] (-1267.338) -- 0:00:19 694500 -- (-1256.669) (-1256.574) [-1256.911] (-1256.338) * [-1256.574] (-1259.474) (-1258.806) (-1265.990) -- 0:00:19 695000 -- [-1256.669] (-1257.360) (-1260.140) (-1257.887) * (-1256.897) [-1260.702] (-1260.238) (-1261.542) -- 0:00:19 Average standard deviation of split frequencies: 0.007331 695500 -- (-1262.984) (-1258.049) [-1256.601] (-1258.498) * (-1258.954) (-1257.101) (-1262.856) [-1260.127] -- 0:00:19 696000 -- (-1266.929) (-1262.867) (-1258.452) [-1256.372] * (-1261.480) [-1257.397] (-1257.180) (-1257.965) -- 0:00:19 696500 -- (-1269.163) (-1259.886) (-1261.009) [-1256.754] * (-1256.770) [-1258.733] (-1256.745) (-1258.867) -- 0:00:19 697000 -- (-1266.641) (-1262.320) [-1258.127] (-1256.276) * [-1256.949] (-1260.790) (-1257.273) (-1257.970) -- 0:00:19 697500 -- (-1259.007) (-1260.000) (-1257.186) [-1256.487] * (-1257.738) (-1257.135) (-1257.041) [-1258.406] -- 0:00:19 698000 -- [-1258.953] (-1258.330) (-1258.140) (-1256.414) * (-1259.514) (-1257.651) [-1256.647] (-1262.051) -- 0:00:19 698500 -- (-1260.884) [-1256.929] (-1259.425) (-1257.711) * [-1258.965] (-1259.069) (-1256.598) (-1256.934) -- 0:00:18 699000 -- (-1262.521) [-1260.804] (-1259.700) (-1257.742) * (-1257.674) (-1258.676) [-1257.026] (-1256.400) -- 0:00:18 699500 -- (-1259.039) [-1257.900] (-1258.807) (-1259.322) * (-1258.914) (-1258.081) [-1261.481] (-1259.858) -- 0:00:18 700000 -- (-1261.470) (-1263.502) (-1257.382) [-1257.142] * [-1257.655] (-1257.282) (-1260.917) (-1257.807) -- 0:00:18 Average standard deviation of split frequencies: 0.007022 700500 -- [-1258.693] (-1262.645) (-1257.919) (-1258.415) * (-1256.502) [-1256.133] (-1258.076) (-1259.372) -- 0:00:18 701000 -- (-1260.933) (-1257.429) [-1256.197] (-1258.273) * (-1256.502) (-1259.155) (-1258.594) [-1257.529] -- 0:00:18 701500 -- (-1256.931) (-1266.897) [-1257.918] (-1258.685) * (-1257.427) [-1258.682] (-1258.255) (-1261.944) -- 0:00:18 702000 -- (-1261.031) [-1260.970] (-1257.720) (-1259.470) * (-1258.738) (-1258.544) (-1257.951) [-1264.458] -- 0:00:18 702500 -- [-1256.908] (-1259.208) (-1258.723) (-1264.354) * (-1258.265) [-1257.533] (-1258.001) (-1262.091) -- 0:00:18 703000 -- (-1256.884) (-1259.391) (-1257.516) [-1259.726] * [-1257.699] (-1256.656) (-1256.470) (-1260.326) -- 0:00:18 703500 -- (-1259.981) (-1264.653) [-1256.049] (-1258.172) * (-1260.451) [-1257.347] (-1256.625) (-1258.139) -- 0:00:18 704000 -- (-1258.502) [-1257.741] (-1256.424) (-1256.104) * [-1259.160] (-1260.198) (-1256.561) (-1260.434) -- 0:00:18 704500 -- [-1257.210] (-1256.766) (-1259.951) (-1258.758) * [-1258.728] (-1258.927) (-1260.731) (-1259.338) -- 0:00:18 705000 -- (-1257.222) [-1261.780] (-1256.932) (-1259.066) * (-1257.233) (-1257.020) (-1260.244) [-1257.168] -- 0:00:18 Average standard deviation of split frequencies: 0.006991 705500 -- (-1257.607) (-1260.037) [-1256.000] (-1259.712) * (-1256.640) (-1258.868) (-1257.851) [-1257.130] -- 0:00:18 706000 -- (-1257.239) (-1259.449) [-1256.064] (-1258.856) * (-1256.640) (-1256.778) [-1258.489] (-1257.182) -- 0:00:18 706500 -- (-1256.382) (-1260.564) [-1255.919] (-1259.331) * (-1256.784) (-1257.250) [-1259.977] (-1258.342) -- 0:00:18 707000 -- (-1256.823) (-1260.699) (-1259.872) [-1261.453] * (-1256.226) [-1258.841] (-1258.356) (-1258.115) -- 0:00:18 707500 -- (-1257.406) [-1258.725] (-1258.628) (-1259.970) * (-1257.129) (-1258.758) [-1257.774] (-1259.192) -- 0:00:18 708000 -- [-1256.989] (-1259.863) (-1259.195) (-1256.416) * (-1256.525) [-1263.400] (-1260.778) (-1258.458) -- 0:00:18 708500 -- (-1259.038) (-1257.046) (-1257.623) [-1255.965] * (-1257.309) (-1260.632) [-1257.676] (-1258.264) -- 0:00:18 709000 -- (-1258.571) [-1257.066] (-1262.681) (-1258.471) * (-1255.938) (-1261.677) (-1257.676) [-1256.489] -- 0:00:18 709500 -- [-1258.387] (-1263.080) (-1257.710) (-1259.552) * (-1257.139) [-1257.779] (-1258.700) (-1256.400) -- 0:00:18 710000 -- [-1258.210] (-1259.862) (-1256.677) (-1256.493) * (-1257.293) [-1257.583] (-1257.338) (-1257.040) -- 0:00:18 Average standard deviation of split frequencies: 0.007297 710500 -- [-1258.318] (-1258.862) (-1257.004) (-1258.264) * (-1256.697) (-1256.681) [-1260.274] (-1256.602) -- 0:00:18 711000 -- (-1259.670) [-1256.479] (-1259.564) (-1256.791) * (-1257.090) [-1257.541] (-1259.015) (-1259.103) -- 0:00:18 711500 -- [-1258.095] (-1257.686) (-1262.444) (-1260.014) * (-1257.547) (-1257.723) [-1259.544] (-1257.475) -- 0:00:18 712000 -- (-1258.501) (-1258.735) (-1257.429) [-1257.690] * (-1257.868) [-1256.976] (-1257.241) (-1261.032) -- 0:00:18 712500 -- (-1256.707) (-1259.640) (-1256.325) [-1258.889] * (-1256.949) [-1258.704] (-1257.189) (-1257.557) -- 0:00:18 713000 -- (-1259.987) [-1256.209] (-1257.568) (-1259.045) * (-1258.174) (-1256.658) (-1256.271) [-1262.387] -- 0:00:18 713500 -- (-1256.345) (-1256.617) [-1259.282] (-1258.993) * (-1257.376) [-1260.453] (-1259.378) (-1257.702) -- 0:00:18 714000 -- [-1256.387] (-1257.162) (-1258.280) (-1256.303) * (-1262.221) (-1256.141) [-1257.006] (-1258.053) -- 0:00:18 714500 -- (-1260.716) (-1258.749) (-1258.403) [-1258.040] * (-1256.737) (-1258.295) (-1258.405) [-1259.041] -- 0:00:17 715000 -- [-1256.947] (-1258.119) (-1256.685) (-1257.832) * (-1257.225) [-1257.627] (-1261.215) (-1257.540) -- 0:00:17 Average standard deviation of split frequencies: 0.007777 715500 -- (-1256.616) [-1258.944] (-1258.183) (-1257.589) * (-1257.419) [-1257.934] (-1259.535) (-1256.606) -- 0:00:17 716000 -- (-1256.773) (-1263.412) (-1259.221) [-1259.023] * [-1256.184] (-1257.870) (-1256.988) (-1257.013) -- 0:00:17 716500 -- (-1256.358) (-1260.983) (-1260.307) [-1256.561] * [-1256.908] (-1260.035) (-1258.370) (-1256.652) -- 0:00:17 717000 -- (-1257.347) [-1259.412] (-1258.928) (-1256.664) * (-1258.440) (-1261.694) (-1257.807) [-1256.803] -- 0:00:17 717500 -- [-1257.679] (-1262.727) (-1259.354) (-1256.139) * (-1259.219) [-1257.774] (-1258.519) (-1259.153) -- 0:00:17 718000 -- (-1256.058) (-1258.782) [-1258.241] (-1256.139) * (-1257.504) (-1257.094) [-1257.572] (-1259.176) -- 0:00:17 718500 -- (-1258.122) (-1258.132) [-1257.912] (-1256.413) * [-1256.289] (-1258.784) (-1260.511) (-1258.635) -- 0:00:17 719000 -- (-1259.931) [-1259.516] (-1257.370) (-1256.975) * (-1260.914) (-1256.449) (-1258.941) [-1259.153] -- 0:00:17 719500 -- [-1260.517] (-1262.651) (-1257.334) (-1256.633) * (-1258.188) (-1257.432) [-1256.364] (-1261.284) -- 0:00:17 720000 -- (-1256.890) [-1264.598] (-1259.325) (-1258.205) * [-1256.817] (-1264.377) (-1256.428) (-1257.700) -- 0:00:17 Average standard deviation of split frequencies: 0.007890 720500 -- (-1260.743) [-1258.250] (-1257.210) (-1265.429) * (-1258.634) (-1258.151) [-1256.894] (-1255.968) -- 0:00:17 721000 -- (-1258.660) [-1256.564] (-1256.551) (-1265.136) * (-1257.501) (-1266.235) (-1258.854) [-1258.329] -- 0:00:17 721500 -- (-1259.208) [-1257.939] (-1257.255) (-1256.306) * (-1257.025) (-1261.199) [-1257.564] (-1258.525) -- 0:00:17 722000 -- (-1257.054) (-1257.847) [-1257.459] (-1258.295) * [-1258.850] (-1258.664) (-1259.888) (-1260.486) -- 0:00:17 722500 -- (-1259.768) [-1257.834] (-1259.918) (-1260.057) * (-1258.851) (-1263.844) [-1258.358] (-1259.391) -- 0:00:17 723000 -- (-1259.612) [-1258.262] (-1258.065) (-1259.412) * (-1258.730) (-1259.579) (-1257.610) [-1256.778] -- 0:00:17 723500 -- (-1259.217) (-1256.682) (-1260.795) [-1259.221] * (-1262.060) [-1264.067] (-1258.289) (-1258.412) -- 0:00:17 724000 -- (-1261.082) (-1261.264) [-1258.049] (-1259.948) * (-1257.788) (-1266.813) [-1256.813] (-1259.715) -- 0:00:17 724500 -- (-1256.438) [-1258.530] (-1260.920) (-1257.938) * (-1257.812) (-1264.536) (-1257.262) [-1256.081] -- 0:00:17 725000 -- (-1256.879) [-1259.926] (-1256.335) (-1259.348) * (-1262.802) (-1259.058) (-1257.571) [-1259.733] -- 0:00:17 Average standard deviation of split frequencies: 0.007832 725500 -- [-1258.494] (-1259.947) (-1256.181) (-1257.796) * (-1257.704) (-1259.019) (-1258.380) [-1257.783] -- 0:00:17 726000 -- (-1258.450) (-1258.192) [-1257.426] (-1258.253) * (-1257.436) (-1257.822) (-1256.545) [-1257.562] -- 0:00:17 726500 -- (-1263.295) (-1259.455) [-1256.438] (-1257.749) * (-1256.609) (-1258.455) (-1258.577) [-1257.547] -- 0:00:17 727000 -- (-1258.664) [-1261.570] (-1256.636) (-1262.255) * (-1259.029) (-1256.459) [-1257.685] (-1257.710) -- 0:00:17 727500 -- (-1256.832) [-1258.442] (-1256.729) (-1263.103) * (-1256.945) (-1263.009) [-1257.431] (-1260.124) -- 0:00:17 728000 -- (-1257.523) (-1256.953) (-1259.678) [-1260.946] * (-1257.001) [-1257.992] (-1260.155) (-1256.256) -- 0:00:17 728500 -- (-1260.941) (-1257.529) [-1258.746] (-1256.871) * (-1257.911) (-1257.354) (-1258.180) [-1256.646] -- 0:00:17 729000 -- (-1257.559) (-1258.726) [-1258.615] (-1258.113) * (-1261.228) (-1258.133) [-1260.931] (-1256.507) -- 0:00:17 729500 -- (-1257.140) (-1257.407) [-1256.735] (-1257.069) * (-1261.428) [-1257.447] (-1258.382) (-1256.843) -- 0:00:17 730000 -- (-1258.833) (-1256.567) [-1256.765] (-1258.581) * [-1258.754] (-1258.888) (-1258.107) (-1256.643) -- 0:00:17 Average standard deviation of split frequencies: 0.007500 730500 -- (-1257.783) (-1256.592) (-1257.401) [-1258.547] * (-1258.259) (-1264.833) (-1259.364) [-1261.346] -- 0:00:16 731000 -- [-1257.479] (-1257.969) (-1257.539) (-1257.181) * (-1261.975) [-1261.155] (-1258.439) (-1264.065) -- 0:00:16 731500 -- (-1257.355) (-1258.239) (-1257.418) [-1257.682] * (-1261.288) [-1257.060] (-1263.905) (-1263.485) -- 0:00:16 732000 -- (-1258.634) (-1257.993) [-1257.691] (-1257.200) * [-1256.835] (-1261.094) (-1257.509) (-1256.825) -- 0:00:16 732500 -- (-1258.603) (-1259.629) (-1257.844) [-1260.289] * (-1258.347) (-1261.745) [-1257.826] (-1258.487) -- 0:00:16 733000 -- (-1256.597) [-1258.207] (-1259.131) (-1259.240) * (-1257.261) [-1257.764] (-1263.321) (-1260.177) -- 0:00:16 733500 -- (-1256.937) (-1257.263) [-1260.122] (-1260.088) * [-1256.475] (-1256.742) (-1261.485) (-1258.914) -- 0:00:16 734000 -- [-1258.434] (-1256.701) (-1259.936) (-1257.711) * [-1256.246] (-1262.076) (-1260.695) (-1256.780) -- 0:00:16 734500 -- (-1260.843) (-1256.983) [-1257.919] (-1258.345) * (-1256.537) (-1256.991) (-1260.644) [-1258.300] -- 0:00:16 735000 -- (-1256.745) [-1257.300] (-1258.339) (-1258.542) * (-1258.746) [-1257.718] (-1258.188) (-1258.600) -- 0:00:16 Average standard deviation of split frequencies: 0.007446 735500 -- [-1258.525] (-1258.652) (-1258.222) (-1257.544) * (-1256.693) (-1257.827) [-1258.011] (-1258.632) -- 0:00:16 736000 -- (-1258.598) (-1256.748) [-1259.716] (-1260.240) * [-1257.405] (-1260.011) (-1257.835) (-1257.775) -- 0:00:16 736500 -- [-1258.641] (-1260.221) (-1258.916) (-1263.415) * [-1259.014] (-1259.984) (-1258.884) (-1258.268) -- 0:00:16 737000 -- (-1257.051) [-1257.340] (-1266.030) (-1260.041) * (-1256.507) (-1258.111) (-1261.113) [-1257.825] -- 0:00:16 737500 -- [-1257.730] (-1258.138) (-1258.554) (-1258.120) * (-1260.230) (-1257.571) (-1262.760) [-1258.499] -- 0:00:16 738000 -- (-1258.367) [-1261.488] (-1256.580) (-1257.304) * (-1257.389) (-1256.544) [-1258.656] (-1259.326) -- 0:00:16 738500 -- (-1260.919) [-1261.841] (-1257.299) (-1258.940) * [-1257.933] (-1258.349) (-1257.635) (-1259.497) -- 0:00:16 739000 -- [-1258.274] (-1256.189) (-1260.466) (-1258.947) * (-1257.471) (-1261.483) (-1257.846) [-1257.433] -- 0:00:16 739500 -- (-1258.891) [-1256.159] (-1261.496) (-1259.651) * [-1260.070] (-1259.395) (-1256.871) (-1263.816) -- 0:00:16 740000 -- (-1258.161) [-1256.932] (-1259.055) (-1257.205) * [-1258.113] (-1257.366) (-1258.462) (-1260.014) -- 0:00:16 Average standard deviation of split frequencies: 0.007319 740500 -- (-1258.090) (-1256.988) (-1261.479) [-1259.761] * (-1261.102) (-1257.478) [-1257.448] (-1262.623) -- 0:00:16 741000 -- (-1258.912) (-1257.187) [-1259.298] (-1256.373) * (-1257.568) [-1259.087] (-1260.530) (-1262.793) -- 0:00:16 741500 -- (-1257.113) (-1258.708) (-1258.327) [-1256.428] * (-1256.662) (-1258.384) (-1264.991) [-1259.152] -- 0:00:16 742000 -- [-1260.247] (-1256.874) (-1260.357) (-1257.779) * (-1264.341) (-1257.078) [-1259.783] (-1258.142) -- 0:00:16 742500 -- (-1258.222) (-1263.405) [-1258.975] (-1257.436) * (-1262.305) (-1257.759) (-1257.143) [-1257.475] -- 0:00:16 743000 -- (-1258.367) (-1260.763) (-1259.638) [-1263.020] * (-1258.578) (-1256.907) (-1256.664) [-1261.184] -- 0:00:16 743500 -- (-1258.959) [-1257.159] (-1256.261) (-1262.652) * (-1255.817) [-1255.989] (-1256.785) (-1259.119) -- 0:00:16 744000 -- [-1257.461] (-1257.182) (-1257.914) (-1259.774) * (-1255.832) (-1257.984) (-1258.822) [-1257.349] -- 0:00:16 744500 -- [-1258.812] (-1262.433) (-1261.730) (-1259.266) * (-1257.940) [-1257.192] (-1257.715) (-1260.816) -- 0:00:16 745000 -- (-1258.335) [-1257.618] (-1261.422) (-1259.250) * [-1259.260] (-1257.622) (-1256.463) (-1258.856) -- 0:00:16 Average standard deviation of split frequencies: 0.007267 745500 -- (-1258.153) (-1259.011) [-1257.848] (-1261.220) * (-1257.177) [-1257.447] (-1256.505) (-1258.522) -- 0:00:16 746000 -- (-1258.810) [-1259.916] (-1258.351) (-1263.727) * (-1257.426) [-1257.123] (-1256.772) (-1264.126) -- 0:00:16 746500 -- [-1258.628] (-1257.378) (-1258.385) (-1258.567) * (-1256.829) [-1259.579] (-1258.073) (-1259.584) -- 0:00:15 747000 -- (-1258.213) (-1257.453) [-1256.883] (-1261.593) * (-1258.326) (-1263.511) (-1259.976) [-1256.593] -- 0:00:15 747500 -- (-1257.917) (-1258.912) (-1261.294) [-1259.685] * (-1257.949) (-1265.425) [-1260.256] (-1256.648) -- 0:00:15 748000 -- [-1258.110] (-1264.318) (-1258.545) (-1258.354) * (-1256.643) (-1257.564) [-1256.759] (-1261.225) -- 0:00:15 748500 -- (-1258.177) (-1258.596) [-1257.093] (-1259.205) * (-1263.199) (-1257.845) [-1258.632] (-1258.683) -- 0:00:15 749000 -- [-1258.154] (-1260.289) (-1261.252) (-1260.937) * (-1257.117) [-1258.523] (-1257.972) (-1259.356) -- 0:00:15 749500 -- [-1257.623] (-1258.736) (-1258.963) (-1259.842) * (-1256.449) [-1257.739] (-1260.380) (-1265.548) -- 0:00:15 750000 -- (-1259.779) (-1257.408) (-1258.822) [-1257.737] * (-1257.536) [-1257.656] (-1261.053) (-1267.508) -- 0:00:15 Average standard deviation of split frequencies: 0.007418 750500 -- (-1258.147) [-1256.428] (-1256.862) (-1258.738) * [-1256.414] (-1257.979) (-1258.441) (-1261.155) -- 0:00:15 751000 -- [-1256.176] (-1259.561) (-1260.348) (-1258.897) * (-1257.492) [-1258.703] (-1261.607) (-1261.463) -- 0:00:15 751500 -- (-1256.966) (-1258.564) (-1257.196) [-1259.041] * (-1257.793) [-1257.423] (-1257.227) (-1260.722) -- 0:00:15 752000 -- (-1262.429) (-1257.049) (-1258.785) [-1259.378] * (-1257.681) [-1260.548] (-1262.092) (-1257.269) -- 0:00:15 752500 -- [-1259.324] (-1257.838) (-1257.304) (-1257.260) * (-1256.578) [-1258.730] (-1257.352) (-1257.062) -- 0:00:15 753000 -- (-1256.825) [-1258.707] (-1256.784) (-1260.905) * [-1256.188] (-1257.905) (-1257.261) (-1257.181) -- 0:00:15 753500 -- (-1259.419) (-1259.916) (-1257.718) [-1258.910] * (-1258.038) [-1257.666] (-1257.709) (-1258.257) -- 0:00:15 754000 -- [-1259.913] (-1260.530) (-1256.438) (-1259.626) * (-1256.593) (-1258.316) [-1256.678] (-1257.792) -- 0:00:15 754500 -- [-1257.197] (-1257.166) (-1258.269) (-1256.711) * (-1257.539) [-1260.479] (-1256.351) (-1260.682) -- 0:00:15 755000 -- (-1262.730) (-1256.960) (-1257.482) [-1258.911] * [-1257.450] (-1261.216) (-1256.703) (-1260.618) -- 0:00:15 Average standard deviation of split frequencies: 0.007444 755500 -- (-1260.039) (-1257.697) (-1257.482) [-1259.690] * (-1256.177) [-1258.050] (-1257.963) (-1261.965) -- 0:00:15 756000 -- [-1255.977] (-1258.431) (-1261.640) (-1260.480) * [-1258.444] (-1257.438) (-1258.792) (-1263.433) -- 0:00:15 756500 -- (-1257.592) (-1257.549) [-1259.218] (-1259.645) * (-1258.675) (-1258.316) [-1260.977] (-1256.533) -- 0:00:15 757000 -- [-1259.059] (-1259.387) (-1258.015) (-1261.553) * (-1259.915) [-1257.936] (-1259.318) (-1257.566) -- 0:00:15 757500 -- (-1259.567) (-1257.137) (-1256.515) [-1261.308] * (-1260.429) (-1258.593) [-1260.340] (-1256.851) -- 0:00:15 758000 -- (-1256.186) (-1258.640) (-1260.858) [-1258.076] * (-1256.523) (-1259.855) [-1257.308] (-1258.811) -- 0:00:15 758500 -- [-1257.067] (-1257.298) (-1258.627) (-1259.266) * (-1257.110) (-1261.468) [-1257.411] (-1259.203) -- 0:00:15 759000 -- (-1258.281) [-1257.298] (-1259.447) (-1259.007) * (-1258.098) (-1258.636) (-1260.832) [-1257.669] -- 0:00:15 759500 -- (-1258.059) (-1259.579) (-1258.338) [-1259.352] * (-1257.871) [-1259.483] (-1260.827) (-1261.295) -- 0:00:15 760000 -- (-1257.636) (-1257.077) (-1256.970) [-1257.888] * (-1256.886) [-1257.992] (-1260.247) (-1257.792) -- 0:00:15 Average standard deviation of split frequencies: 0.007475 760500 -- (-1256.760) [-1258.354] (-1258.812) (-1260.695) * (-1259.729) (-1261.091) [-1259.322] (-1257.054) -- 0:00:15 761000 -- (-1256.515) (-1257.103) (-1258.335) [-1258.428] * [-1256.928] (-1258.815) (-1258.527) (-1256.476) -- 0:00:15 761500 -- (-1256.947) (-1257.853) (-1258.525) [-1257.677] * (-1256.946) [-1257.182] (-1260.161) (-1258.246) -- 0:00:15 762000 -- (-1257.115) [-1259.257] (-1260.642) (-1257.776) * (-1258.824) [-1258.010] (-1261.462) (-1257.647) -- 0:00:14 762500 -- [-1256.574] (-1259.234) (-1258.843) (-1259.508) * (-1258.778) [-1258.583] (-1263.890) (-1257.859) -- 0:00:14 763000 -- (-1260.946) [-1258.320] (-1260.278) (-1257.668) * (-1257.904) (-1256.238) (-1260.465) [-1256.670] -- 0:00:14 763500 -- [-1259.937] (-1258.482) (-1258.214) (-1258.696) * (-1258.571) (-1257.012) (-1258.043) [-1256.517] -- 0:00:14 764000 -- (-1258.903) (-1264.457) (-1256.353) [-1256.233] * (-1256.929) (-1258.274) (-1258.141) [-1257.416] -- 0:00:14 764500 -- (-1259.586) (-1262.422) [-1257.557] (-1256.161) * [-1256.992] (-1257.443) (-1264.045) (-1259.256) -- 0:00:14 765000 -- [-1260.004] (-1258.244) (-1260.222) (-1257.035) * [-1262.499] (-1258.806) (-1260.248) (-1258.798) -- 0:00:14 Average standard deviation of split frequencies: 0.007423 765500 -- (-1258.752) (-1260.438) (-1258.596) [-1257.800] * [-1257.522] (-1257.392) (-1257.277) (-1260.531) -- 0:00:14 766000 -- (-1258.329) [-1259.420] (-1257.420) (-1258.010) * (-1256.978) (-1257.982) (-1258.000) [-1256.516] -- 0:00:14 766500 -- [-1260.596] (-1258.192) (-1259.821) (-1260.383) * (-1258.113) (-1260.010) (-1259.205) [-1258.143] -- 0:00:14 767000 -- (-1261.647) (-1257.747) [-1257.919] (-1260.633) * [-1257.811] (-1261.263) (-1256.820) (-1258.881) -- 0:00:14 767500 -- (-1258.202) (-1259.723) [-1258.140] (-1259.431) * [-1260.048] (-1257.499) (-1261.112) (-1259.637) -- 0:00:14 768000 -- (-1259.222) (-1260.393) [-1257.879] (-1261.751) * (-1267.000) (-1257.841) [-1257.164] (-1260.558) -- 0:00:14 768500 -- (-1259.642) [-1258.047] (-1257.484) (-1258.368) * [-1258.879] (-1260.090) (-1257.833) (-1259.306) -- 0:00:14 769000 -- (-1257.765) [-1260.155] (-1259.932) (-1258.379) * (-1260.248) (-1256.607) [-1257.052] (-1260.135) -- 0:00:14 769500 -- (-1259.751) (-1257.408) (-1258.626) [-1256.461] * (-1259.278) (-1256.295) [-1256.638] (-1259.676) -- 0:00:14 770000 -- (-1256.711) (-1257.683) [-1260.098] (-1257.025) * (-1261.700) (-1259.898) [-1258.178] (-1257.344) -- 0:00:14 Average standard deviation of split frequencies: 0.007111 770500 -- (-1259.283) (-1259.774) [-1259.176] (-1260.158) * [-1261.502] (-1260.024) (-1258.976) (-1262.451) -- 0:00:14 771000 -- (-1257.152) (-1259.748) [-1258.728] (-1257.200) * (-1264.332) (-1257.688) [-1260.997] (-1257.286) -- 0:00:14 771500 -- (-1257.938) (-1264.451) [-1260.698] (-1256.843) * [-1258.851] (-1258.316) (-1256.985) (-1257.095) -- 0:00:14 772000 -- [-1258.792] (-1259.477) (-1257.102) (-1259.019) * (-1260.306) (-1257.626) [-1259.036] (-1257.370) -- 0:00:14 772500 -- [-1259.426] (-1259.038) (-1261.745) (-1258.563) * (-1266.680) (-1258.945) [-1263.843] (-1257.924) -- 0:00:14 773000 -- (-1256.827) [-1260.305] (-1259.032) (-1257.114) * (-1258.941) (-1259.978) (-1259.281) [-1258.070] -- 0:00:14 773500 -- (-1256.866) [-1257.405] (-1262.915) (-1257.794) * (-1257.237) [-1260.522] (-1259.279) (-1258.218) -- 0:00:14 774000 -- (-1259.682) (-1257.635) (-1263.406) [-1257.121] * (-1256.034) [-1260.449] (-1256.933) (-1257.934) -- 0:00:14 774500 -- [-1258.542] (-1259.051) (-1257.172) (-1257.227) * (-1256.320) (-1259.160) (-1257.379) [-1260.477] -- 0:00:14 775000 -- (-1259.311) (-1260.800) (-1257.563) [-1257.000] * (-1256.327) [-1258.673] (-1256.903) (-1259.803) -- 0:00:14 Average standard deviation of split frequencies: 0.007442 775500 -- [-1258.636] (-1258.985) (-1256.921) (-1257.246) * (-1256.826) [-1256.824] (-1258.987) (-1256.928) -- 0:00:14 776000 -- (-1257.441) (-1258.981) (-1256.697) [-1257.067] * (-1259.607) (-1258.023) (-1263.662) [-1258.091] -- 0:00:14 776500 -- (-1258.243) [-1257.491] (-1257.730) (-1257.165) * (-1266.170) (-1259.236) (-1262.532) [-1257.250] -- 0:00:14 777000 -- [-1258.742] (-1258.994) (-1259.325) (-1260.859) * (-1257.696) (-1258.482) (-1257.455) [-1257.220] -- 0:00:14 777500 -- (-1257.308) [-1258.258] (-1259.466) (-1259.808) * (-1261.509) (-1258.292) [-1256.630] (-1257.710) -- 0:00:14 778000 -- (-1262.628) (-1258.237) (-1260.661) [-1257.599] * (-1257.079) (-1260.057) (-1256.127) [-1259.072] -- 0:00:13 778500 -- [-1258.178] (-1260.875) (-1258.717) (-1258.170) * (-1259.865) (-1263.012) [-1256.313] (-1257.163) -- 0:00:13 779000 -- (-1261.271) (-1258.044) [-1258.509] (-1257.980) * [-1258.050] (-1261.158) (-1256.384) (-1257.550) -- 0:00:13 779500 -- (-1260.076) [-1256.238] (-1256.431) (-1259.279) * (-1256.520) (-1255.966) (-1257.567) [-1256.640] -- 0:00:13 780000 -- [-1258.209] (-1265.546) (-1256.213) (-1257.729) * (-1258.160) (-1256.487) (-1260.352) [-1257.597] -- 0:00:13 Average standard deviation of split frequencies: 0.007095 780500 -- [-1257.822] (-1261.841) (-1256.914) (-1260.821) * (-1260.031) [-1256.525] (-1259.968) (-1256.985) -- 0:00:13 781000 -- (-1257.006) (-1259.787) (-1257.499) [-1259.196] * (-1260.562) (-1257.065) [-1258.743] (-1258.634) -- 0:00:13 781500 -- (-1256.788) [-1256.292] (-1259.316) (-1262.803) * (-1260.547) (-1258.666) [-1262.107] (-1259.879) -- 0:00:13 782000 -- (-1257.219) [-1256.301] (-1256.547) (-1259.826) * (-1260.029) [-1259.879] (-1257.762) (-1261.274) -- 0:00:13 782500 -- [-1262.390] (-1260.425) (-1258.255) (-1260.991) * (-1259.216) (-1256.739) (-1257.577) [-1257.252] -- 0:00:13 783000 -- (-1256.109) (-1257.446) [-1258.649] (-1257.363) * [-1258.189] (-1257.211) (-1259.877) (-1258.132) -- 0:00:13 783500 -- [-1256.104] (-1259.497) (-1257.924) (-1257.347) * (-1256.562) (-1263.663) [-1257.556] (-1258.497) -- 0:00:13 784000 -- (-1259.666) (-1257.665) [-1257.457] (-1258.344) * (-1260.390) (-1260.066) (-1258.440) [-1257.791] -- 0:00:13 784500 -- [-1258.889] (-1259.225) (-1261.612) (-1259.381) * (-1264.318) (-1258.534) [-1257.630] (-1258.115) -- 0:00:13 785000 -- (-1259.515) (-1257.591) [-1258.143] (-1259.739) * (-1259.783) (-1258.125) (-1258.466) [-1258.735] -- 0:00:13 Average standard deviation of split frequencies: 0.007160 785500 -- (-1259.518) (-1256.768) [-1258.487] (-1261.489) * (-1258.615) (-1257.922) (-1261.514) [-1258.019] -- 0:00:13 786000 -- (-1263.889) [-1259.246] (-1259.905) (-1258.960) * [-1258.261] (-1260.191) (-1257.402) (-1257.476) -- 0:00:13 786500 -- (-1257.410) [-1258.998] (-1257.651) (-1256.813) * (-1256.579) (-1259.604) [-1256.042] (-1257.712) -- 0:00:13 787000 -- (-1266.403) (-1260.448) (-1256.950) [-1258.819] * (-1256.617) [-1257.759] (-1256.981) (-1257.277) -- 0:00:13 787500 -- (-1262.771) (-1259.330) (-1260.092) [-1260.808] * (-1261.646) (-1256.793) [-1260.485] (-1257.130) -- 0:00:13 788000 -- (-1261.393) [-1259.886] (-1261.017) (-1260.327) * (-1262.045) (-1257.327) [-1262.144] (-1256.741) -- 0:00:13 788500 -- (-1258.669) (-1260.123) (-1260.124) [-1257.635] * (-1261.002) (-1258.975) [-1261.556] (-1256.991) -- 0:00:13 789000 -- (-1256.913) [-1258.972] (-1259.506) (-1257.860) * [-1262.127] (-1257.790) (-1260.105) (-1259.911) -- 0:00:13 789500 -- (-1260.602) (-1268.154) (-1257.300) [-1258.366] * (-1260.092) (-1257.858) [-1258.261] (-1258.164) -- 0:00:13 790000 -- (-1256.714) (-1260.194) (-1259.559) [-1259.847] * [-1258.424] (-1261.000) (-1260.496) (-1263.724) -- 0:00:13 Average standard deviation of split frequencies: 0.007080 790500 -- (-1260.686) (-1259.670) (-1257.602) [-1258.036] * [-1259.586] (-1262.653) (-1258.256) (-1261.706) -- 0:00:13 791000 -- [-1257.550] (-1261.783) (-1257.428) (-1258.732) * (-1256.850) (-1260.714) [-1256.556] (-1261.160) -- 0:00:13 791500 -- (-1258.447) (-1262.574) [-1256.855] (-1264.014) * (-1259.893) (-1257.463) [-1256.633] (-1258.321) -- 0:00:13 792000 -- (-1257.154) (-1257.544) [-1259.277] (-1261.644) * (-1258.036) (-1258.567) (-1256.600) [-1257.876] -- 0:00:13 792500 -- (-1257.230) (-1258.448) [-1257.794] (-1257.000) * [-1258.149] (-1256.709) (-1255.965) (-1258.722) -- 0:00:13 793000 -- (-1266.258) (-1258.575) (-1263.665) [-1256.749] * (-1257.768) [-1256.513] (-1256.949) (-1257.259) -- 0:00:13 793500 -- (-1258.359) (-1259.227) [-1257.274] (-1259.203) * (-1259.794) (-1258.600) (-1257.816) [-1256.779] -- 0:00:13 794000 -- (-1258.202) (-1256.276) [-1256.559] (-1266.553) * (-1263.844) [-1258.753] (-1257.722) (-1260.321) -- 0:00:12 794500 -- (-1258.120) (-1260.070) (-1259.917) [-1256.783] * (-1263.473) [-1257.380] (-1257.552) (-1260.813) -- 0:00:12 795000 -- (-1259.519) (-1260.549) (-1265.970) [-1256.703] * (-1257.208) [-1259.238] (-1259.258) (-1258.521) -- 0:00:12 Average standard deviation of split frequencies: 0.007107 795500 -- [-1256.499] (-1258.534) (-1263.940) (-1256.277) * (-1257.727) [-1261.151] (-1257.144) (-1258.727) -- 0:00:12 796000 -- (-1257.544) (-1261.437) (-1258.050) [-1256.209] * [-1262.982] (-1258.947) (-1260.792) (-1259.128) -- 0:00:12 796500 -- [-1257.386] (-1257.873) (-1258.879) (-1256.795) * [-1258.160] (-1257.613) (-1260.582) (-1258.037) -- 0:00:12 797000 -- (-1261.909) (-1258.155) (-1258.874) [-1258.925] * (-1257.131) (-1259.484) (-1257.625) [-1260.598] -- 0:00:12 797500 -- (-1258.450) (-1256.850) [-1261.021] (-1260.579) * (-1257.247) [-1258.894] (-1259.050) (-1258.677) -- 0:00:12 798000 -- [-1258.032] (-1260.000) (-1256.655) (-1264.849) * [-1257.466] (-1260.260) (-1257.855) (-1261.041) -- 0:00:12 798500 -- [-1256.712] (-1268.427) (-1256.016) (-1259.569) * (-1258.063) (-1266.513) (-1256.562) [-1259.237] -- 0:00:12 799000 -- (-1257.233) [-1259.152] (-1255.993) (-1258.860) * (-1257.873) (-1265.972) (-1256.494) [-1256.759] -- 0:00:12 799500 -- (-1257.766) [-1256.896] (-1257.789) (-1258.840) * (-1258.831) [-1263.858] (-1256.702) (-1258.227) -- 0:00:12 800000 -- (-1258.744) [-1257.258] (-1264.750) (-1257.525) * (-1259.374) (-1258.021) (-1258.895) [-1258.302] -- 0:00:12 Average standard deviation of split frequencies: 0.007212 800500 -- [-1259.263] (-1257.832) (-1260.917) (-1257.220) * (-1260.077) (-1258.650) [-1258.204] (-1259.718) -- 0:00:12 801000 -- (-1258.351) [-1261.284] (-1261.400) (-1257.938) * (-1258.776) (-1257.210) [-1260.543] (-1265.361) -- 0:00:12 801500 -- (-1257.023) (-1258.922) (-1259.323) [-1260.827] * (-1258.589) (-1260.512) (-1260.551) [-1265.270] -- 0:00:12 802000 -- [-1257.981] (-1259.068) (-1259.160) (-1261.058) * (-1258.859) (-1259.043) [-1258.785] (-1264.522) -- 0:00:12 802500 -- (-1257.858) (-1259.027) [-1257.301] (-1259.629) * (-1257.998) [-1256.359] (-1258.016) (-1258.623) -- 0:00:12 803000 -- (-1257.871) (-1258.093) [-1258.285] (-1258.462) * (-1259.273) (-1257.145) (-1257.950) [-1259.438] -- 0:00:12 803500 -- [-1258.361] (-1257.661) (-1267.676) (-1257.337) * (-1256.426) (-1259.410) [-1259.354] (-1257.764) -- 0:00:12 804000 -- [-1258.874] (-1256.730) (-1264.721) (-1257.115) * [-1257.582] (-1257.548) (-1259.194) (-1261.493) -- 0:00:12 804500 -- (-1257.808) [-1258.565] (-1257.727) (-1256.800) * (-1263.856) (-1257.434) [-1257.229] (-1257.645) -- 0:00:12 805000 -- (-1257.406) (-1257.277) [-1257.197] (-1256.631) * (-1257.716) (-1257.421) [-1260.056] (-1260.322) -- 0:00:12 Average standard deviation of split frequencies: 0.007055 805500 -- (-1257.936) [-1256.126] (-1258.045) (-1259.010) * [-1260.149] (-1257.451) (-1260.437) (-1260.226) -- 0:00:12 806000 -- (-1259.058) (-1257.855) (-1259.617) [-1256.778] * [-1263.290] (-1257.372) (-1259.073) (-1260.350) -- 0:00:12 806500 -- (-1257.600) (-1263.313) [-1256.527] (-1258.306) * [-1256.688] (-1259.235) (-1257.703) (-1256.871) -- 0:00:12 807000 -- (-1260.112) (-1260.421) (-1260.508) [-1257.374] * (-1256.509) [-1258.121] (-1259.172) (-1260.654) -- 0:00:12 807500 -- (-1259.139) (-1259.376) [-1260.661] (-1256.967) * (-1259.889) [-1259.394] (-1259.213) (-1259.526) -- 0:00:12 808000 -- [-1256.632] (-1259.101) (-1266.107) (-1258.413) * (-1258.509) [-1256.629] (-1258.237) (-1260.839) -- 0:00:12 808500 -- (-1258.237) (-1256.961) [-1258.706] (-1256.786) * [-1258.206] (-1259.745) (-1257.259) (-1256.737) -- 0:00:12 809000 -- (-1258.967) (-1256.972) [-1255.977] (-1257.107) * [-1257.299] (-1258.938) (-1260.747) (-1258.791) -- 0:00:12 809500 -- (-1258.279) [-1257.123] (-1257.288) (-1256.964) * (-1258.364) (-1258.929) (-1262.110) [-1257.720] -- 0:00:12 810000 -- [-1258.098] (-1258.321) (-1257.361) (-1256.586) * (-1258.687) (-1261.628) (-1259.840) [-1257.663] -- 0:00:11 Average standard deviation of split frequencies: 0.007232 810500 -- (-1260.313) [-1256.540] (-1258.776) (-1256.754) * (-1258.379) [-1258.251] (-1258.533) (-1259.017) -- 0:00:11 811000 -- (-1260.551) [-1256.445] (-1258.374) (-1257.390) * (-1258.031) (-1256.543) [-1259.637] (-1261.393) -- 0:00:11 811500 -- (-1258.567) (-1257.040) [-1257.551] (-1258.560) * [-1259.695] (-1259.009) (-1257.130) (-1258.014) -- 0:00:11 812000 -- (-1258.896) (-1257.476) [-1258.707] (-1258.650) * (-1258.674) [-1257.666] (-1256.221) (-1257.544) -- 0:00:11 812500 -- [-1258.832] (-1259.356) (-1261.349) (-1260.003) * [-1259.299] (-1256.399) (-1258.884) (-1257.690) -- 0:00:11 813000 -- [-1257.595] (-1257.947) (-1257.329) (-1257.936) * (-1258.120) (-1257.474) (-1258.174) [-1258.562] -- 0:00:11 813500 -- (-1258.832) [-1260.143] (-1258.122) (-1257.328) * (-1259.149) (-1258.191) (-1259.159) [-1257.582] -- 0:00:11 814000 -- (-1256.576) (-1260.731) (-1258.905) [-1256.782] * (-1265.212) (-1257.833) (-1261.447) [-1258.673] -- 0:00:11 814500 -- (-1257.661) [-1258.514] (-1256.841) (-1258.596) * [-1258.190] (-1258.665) (-1261.783) (-1258.244) -- 0:00:11 815000 -- (-1259.218) (-1260.448) [-1258.958] (-1258.584) * [-1259.947] (-1257.801) (-1259.213) (-1259.558) -- 0:00:11 Average standard deviation of split frequencies: 0.006932 815500 -- (-1259.354) (-1260.961) (-1260.363) [-1258.224] * (-1259.130) [-1257.238] (-1262.618) (-1256.394) -- 0:00:11 816000 -- (-1259.374) [-1262.651] (-1262.928) (-1260.529) * (-1259.023) [-1263.631] (-1262.767) (-1258.412) -- 0:00:11 816500 -- (-1257.285) (-1257.301) (-1259.763) [-1259.288] * (-1261.119) (-1260.980) (-1261.084) [-1257.133] -- 0:00:11 817000 -- (-1257.441) (-1257.808) (-1259.262) [-1256.814] * [-1257.284] (-1260.641) (-1260.053) (-1257.183) -- 0:00:11 817500 -- (-1258.044) (-1256.368) [-1257.008] (-1260.770) * (-1257.741) (-1259.576) [-1260.506] (-1256.954) -- 0:00:11 818000 -- [-1257.673] (-1261.960) (-1256.984) (-1260.166) * [-1256.459] (-1258.193) (-1257.428) (-1257.307) -- 0:00:11 818500 -- [-1256.911] (-1260.495) (-1260.672) (-1257.207) * (-1258.901) (-1258.226) [-1258.534] (-1257.463) -- 0:00:11 819000 -- (-1259.878) [-1257.692] (-1268.219) (-1256.052) * (-1257.097) (-1260.207) (-1258.680) [-1259.054] -- 0:00:11 819500 -- (-1258.420) (-1258.276) (-1257.986) [-1259.125] * (-1257.396) (-1258.872) [-1256.120] (-1258.319) -- 0:00:11 820000 -- (-1259.419) [-1257.186] (-1258.820) (-1259.607) * [-1257.358] (-1258.602) (-1262.193) (-1256.670) -- 0:00:11 Average standard deviation of split frequencies: 0.006821 820500 -- [-1256.750] (-1257.822) (-1259.355) (-1259.235) * (-1256.957) (-1259.972) (-1258.209) [-1258.007] -- 0:00:11 821000 -- (-1259.392) (-1258.897) (-1257.295) [-1257.870] * (-1256.577) (-1258.706) (-1258.695) [-1257.655] -- 0:00:11 821500 -- [-1259.270] (-1256.819) (-1260.802) (-1262.025) * (-1256.960) [-1257.310] (-1257.801) (-1257.625) -- 0:00:11 822000 -- [-1256.630] (-1257.021) (-1259.623) (-1257.797) * (-1258.615) (-1265.128) (-1259.500) [-1256.592] -- 0:00:11 822500 -- (-1257.079) (-1256.333) (-1257.861) [-1261.085] * [-1257.690] (-1260.219) (-1260.660) (-1256.646) -- 0:00:11 823000 -- [-1257.910] (-1257.923) (-1257.020) (-1260.627) * (-1256.635) [-1259.994] (-1262.872) (-1261.167) -- 0:00:11 823500 -- (-1257.792) (-1256.581) (-1259.384) [-1259.489] * (-1262.080) [-1258.132] (-1261.126) (-1257.731) -- 0:00:11 824000 -- (-1257.965) (-1265.383) [-1260.501] (-1262.695) * [-1257.344] (-1256.954) (-1256.658) (-1259.589) -- 0:00:11 824500 -- (-1261.706) (-1261.986) (-1260.521) [-1260.606] * (-1257.419) (-1258.111) (-1256.830) [-1258.758] -- 0:00:11 825000 -- [-1260.940] (-1258.569) (-1258.212) (-1259.965) * (-1258.969) [-1258.495] (-1257.855) (-1256.749) -- 0:00:11 Average standard deviation of split frequencies: 0.006955 825500 -- (-1262.392) [-1258.396] (-1260.382) (-1258.562) * (-1258.222) (-1259.680) (-1258.278) [-1256.399] -- 0:00:10 826000 -- [-1257.426] (-1257.383) (-1262.173) (-1257.707) * [-1256.659] (-1258.110) (-1257.865) (-1256.421) -- 0:00:10 826500 -- (-1257.014) (-1261.198) [-1258.683] (-1258.132) * (-1258.245) (-1256.251) (-1257.090) [-1257.389] -- 0:00:10 827000 -- (-1258.684) (-1256.388) (-1265.483) [-1255.837] * (-1258.286) (-1256.079) (-1257.850) [-1257.260] -- 0:00:10 827500 -- (-1258.006) [-1258.640] (-1265.294) (-1255.923) * (-1256.167) [-1255.986] (-1258.270) (-1257.788) -- 0:00:10 828000 -- (-1257.340) (-1258.198) (-1257.422) [-1256.384] * (-1258.461) (-1255.985) (-1257.039) [-1258.336] -- 0:00:10 828500 -- [-1257.687] (-1257.264) (-1257.222) (-1256.872) * (-1260.029) (-1257.415) [-1257.562] (-1257.058) -- 0:00:10 829000 -- (-1259.076) [-1256.583] (-1262.910) (-1257.905) * (-1256.819) (-1257.032) (-1256.210) [-1256.485] -- 0:00:10 829500 -- (-1259.983) [-1256.155] (-1259.587) (-1257.863) * [-1257.501] (-1257.230) (-1264.972) (-1257.834) -- 0:00:10 830000 -- (-1261.275) (-1260.223) (-1261.029) [-1262.275] * (-1257.093) (-1260.158) (-1261.692) [-1260.053] -- 0:00:10 Average standard deviation of split frequencies: 0.006704 830500 -- (-1258.108) (-1258.334) (-1259.378) [-1257.675] * (-1257.516) (-1257.790) (-1261.857) [-1257.272] -- 0:00:10 831000 -- (-1257.273) (-1259.631) (-1258.435) [-1259.498] * (-1259.278) (-1257.314) (-1260.725) [-1256.777] -- 0:00:10 831500 -- (-1261.012) (-1259.335) (-1257.237) [-1259.197] * (-1259.425) [-1257.055] (-1259.908) (-1258.293) -- 0:00:10 832000 -- (-1258.223) (-1257.964) [-1257.233] (-1259.639) * [-1260.039] (-1257.256) (-1256.850) (-1260.067) -- 0:00:10 832500 -- [-1259.168] (-1257.076) (-1260.358) (-1261.872) * [-1261.741] (-1257.212) (-1256.903) (-1256.651) -- 0:00:10 833000 -- (-1257.209) (-1258.188) [-1258.124] (-1259.336) * [-1257.264] (-1260.690) (-1258.618) (-1258.947) -- 0:00:10 833500 -- (-1256.570) (-1256.449) [-1258.524] (-1258.540) * [-1257.265] (-1259.405) (-1258.840) (-1257.516) -- 0:00:10 834000 -- (-1258.440) (-1256.327) [-1261.988] (-1257.772) * [-1256.530] (-1258.231) (-1260.259) (-1257.576) -- 0:00:10 834500 -- (-1262.268) (-1258.817) (-1257.459) [-1259.414] * [-1260.364] (-1258.771) (-1263.265) (-1262.848) -- 0:00:10 835000 -- (-1259.304) (-1256.843) (-1257.847) [-1258.121] * (-1262.564) (-1257.902) (-1258.677) [-1258.940] -- 0:00:10 Average standard deviation of split frequencies: 0.006731 835500 -- (-1257.855) (-1257.322) (-1259.105) [-1258.736] * (-1259.785) (-1259.662) [-1257.427] (-1257.404) -- 0:00:10 836000 -- [-1256.297] (-1259.429) (-1257.179) (-1256.455) * (-1259.608) [-1258.713] (-1261.483) (-1257.561) -- 0:00:10 836500 -- (-1258.097) [-1258.224] (-1256.804) (-1256.527) * [-1258.186] (-1257.484) (-1259.310) (-1257.354) -- 0:00:10 837000 -- (-1260.247) (-1258.781) (-1256.835) [-1256.319] * (-1257.678) (-1258.448) [-1262.449] (-1258.029) -- 0:00:10 837500 -- (-1256.456) (-1258.555) [-1257.366] (-1258.237) * [-1258.061] (-1258.879) (-1260.928) (-1258.981) -- 0:00:10 838000 -- (-1256.563) (-1256.762) [-1257.389] (-1258.745) * (-1259.039) [-1258.481] (-1259.728) (-1258.987) -- 0:00:10 838500 -- (-1256.445) (-1256.958) (-1263.098) [-1258.531] * (-1258.298) [-1259.159] (-1260.866) (-1258.147) -- 0:00:10 839000 -- [-1262.536] (-1257.133) (-1257.142) (-1259.086) * [-1258.475] (-1256.610) (-1258.733) (-1258.409) -- 0:00:10 839500 -- (-1260.894) (-1258.222) [-1262.249] (-1257.202) * (-1263.582) (-1256.524) (-1258.377) [-1259.946] -- 0:00:10 840000 -- [-1259.381] (-1257.970) (-1261.723) (-1257.379) * [-1258.029] (-1258.579) (-1259.798) (-1257.555) -- 0:00:10 Average standard deviation of split frequencies: 0.006729 840500 -- [-1258.764] (-1257.128) (-1256.574) (-1256.389) * (-1257.007) (-1258.770) (-1263.617) [-1258.025] -- 0:00:10 841000 -- (-1259.144) (-1256.380) [-1256.427] (-1258.172) * (-1256.363) (-1259.255) (-1256.348) [-1257.472] -- 0:00:10 841500 -- (-1259.828) (-1256.325) [-1257.448] (-1260.678) * [-1257.956] (-1257.082) (-1256.672) (-1259.871) -- 0:00:09 842000 -- (-1258.469) [-1256.968] (-1259.517) (-1258.018) * (-1259.129) (-1260.172) [-1258.274] (-1260.048) -- 0:00:09 842500 -- [-1259.006] (-1256.100) (-1256.320) (-1260.082) * [-1259.857] (-1257.923) (-1256.791) (-1258.098) -- 0:00:09 843000 -- (-1257.570) [-1256.106] (-1259.007) (-1263.595) * (-1258.211) (-1259.381) (-1259.119) [-1258.697] -- 0:00:09 843500 -- (-1256.077) [-1256.518] (-1259.013) (-1259.219) * (-1259.149) (-1259.386) (-1259.044) [-1258.461] -- 0:00:09 844000 -- (-1261.822) [-1257.216] (-1256.790) (-1259.616) * (-1256.840) [-1259.859] (-1260.560) (-1260.380) -- 0:00:09 844500 -- (-1261.096) (-1256.569) [-1256.605] (-1258.616) * (-1257.077) (-1256.228) (-1257.926) [-1260.641] -- 0:00:09 845000 -- (-1265.279) [-1256.620] (-1256.352) (-1260.141) * (-1263.375) [-1257.385] (-1259.862) (-1260.850) -- 0:00:09 Average standard deviation of split frequencies: 0.006478 845500 -- (-1258.105) (-1258.423) [-1257.118] (-1259.389) * (-1260.424) (-1256.069) (-1260.592) [-1259.620] -- 0:00:09 846000 -- (-1259.298) (-1260.536) (-1256.798) [-1256.604] * (-1256.336) (-1257.506) (-1256.881) [-1258.593] -- 0:00:09 846500 -- (-1257.152) (-1263.085) (-1260.546) [-1258.746] * (-1263.213) (-1262.012) [-1256.971] (-1257.037) -- 0:00:09 847000 -- (-1257.860) [-1260.782] (-1257.763) (-1259.181) * (-1259.297) (-1257.528) (-1261.699) [-1257.415] -- 0:00:09 847500 -- (-1261.574) (-1260.812) (-1258.289) [-1259.140] * [-1258.517] (-1257.621) (-1257.412) (-1259.286) -- 0:00:09 848000 -- (-1260.012) [-1256.346] (-1256.548) (-1257.908) * [-1258.241] (-1257.425) (-1260.259) (-1257.519) -- 0:00:09 848500 -- (-1264.013) (-1258.335) (-1262.040) [-1258.122] * (-1265.930) (-1257.143) (-1258.492) [-1257.476] -- 0:00:09 849000 -- [-1260.195] (-1258.162) (-1260.848) (-1257.463) * (-1260.925) (-1257.370) [-1259.444] (-1255.914) -- 0:00:09 849500 -- (-1259.763) (-1258.686) [-1257.039] (-1258.601) * [-1258.546] (-1258.729) (-1260.513) (-1258.230) -- 0:00:09 850000 -- (-1261.957) [-1257.488] (-1256.109) (-1259.924) * [-1257.453] (-1259.424) (-1257.423) (-1261.745) -- 0:00:09 Average standard deviation of split frequencies: 0.006581 850500 -- (-1256.590) (-1257.629) [-1256.110] (-1256.419) * [-1259.250] (-1257.858) (-1257.486) (-1256.146) -- 0:00:09 851000 -- [-1258.626] (-1261.953) (-1256.197) (-1256.979) * (-1260.053) [-1259.238] (-1257.977) (-1257.226) -- 0:00:09 851500 -- (-1257.588) (-1260.334) (-1255.940) [-1257.184] * [-1257.224] (-1268.357) (-1256.599) (-1257.081) -- 0:00:09 852000 -- (-1256.140) (-1256.954) (-1258.901) [-1257.708] * (-1257.097) (-1256.638) [-1256.356] (-1259.446) -- 0:00:09 852500 -- (-1256.828) (-1259.889) [-1257.968] (-1257.926) * (-1259.151) [-1261.154] (-1257.137) (-1257.418) -- 0:00:09 853000 -- (-1258.314) [-1259.795] (-1259.622) (-1260.128) * [-1260.097] (-1257.572) (-1257.622) (-1259.099) -- 0:00:09 853500 -- (-1257.471) (-1257.708) (-1258.407) [-1258.387] * (-1257.795) (-1258.739) (-1259.187) [-1259.688] -- 0:00:09 854000 -- (-1256.978) (-1258.126) (-1260.749) [-1259.037] * (-1258.767) (-1258.991) (-1260.612) [-1259.639] -- 0:00:09 854500 -- (-1261.114) (-1258.325) (-1258.415) [-1259.754] * [-1257.942] (-1259.332) (-1256.239) (-1256.849) -- 0:00:09 855000 -- (-1260.189) (-1258.129) (-1258.447) [-1260.878] * (-1259.783) (-1258.184) [-1257.694] (-1256.981) -- 0:00:09 Average standard deviation of split frequencies: 0.006471 855500 -- (-1260.443) [-1256.611] (-1257.622) (-1258.339) * [-1256.197] (-1257.528) (-1258.271) (-1256.808) -- 0:00:09 856000 -- [-1256.439] (-1258.635) (-1259.791) (-1257.439) * [-1257.388] (-1256.539) (-1257.164) (-1261.242) -- 0:00:09 856500 -- (-1259.192) [-1258.636] (-1259.910) (-1259.304) * (-1257.533) (-1259.181) (-1256.489) [-1259.273] -- 0:00:09 857000 -- (-1264.658) (-1257.967) (-1260.889) [-1257.157] * (-1257.820) (-1256.551) (-1258.919) [-1260.331] -- 0:00:09 857500 -- (-1257.021) (-1259.977) (-1259.968) [-1259.102] * (-1258.662) (-1257.720) [-1257.302] (-1257.855) -- 0:00:08 858000 -- [-1256.169] (-1257.424) (-1257.743) (-1257.409) * [-1257.694] (-1259.145) (-1256.687) (-1260.531) -- 0:00:08 858500 -- (-1256.387) [-1259.766] (-1257.101) (-1259.785) * [-1257.141] (-1259.388) (-1258.140) (-1259.579) -- 0:00:08 859000 -- (-1259.933) (-1257.147) [-1256.878] (-1258.863) * (-1262.209) [-1256.527] (-1259.113) (-1258.470) -- 0:00:08 859500 -- [-1255.980] (-1259.773) (-1257.714) (-1260.644) * (-1258.329) (-1260.142) (-1257.742) [-1258.883] -- 0:00:08 860000 -- (-1257.779) (-1259.211) [-1257.433] (-1257.423) * (-1260.876) (-1257.599) (-1258.153) [-1257.366] -- 0:00:08 Average standard deviation of split frequencies: 0.006504 860500 -- (-1262.832) [-1257.200] (-1258.423) (-1257.818) * (-1257.885) (-1257.709) [-1258.987] (-1258.309) -- 0:00:08 861000 -- (-1261.832) (-1259.382) (-1259.103) [-1259.282] * (-1262.126) (-1257.167) (-1256.254) [-1259.101] -- 0:00:08 861500 -- (-1257.686) [-1262.524] (-1257.243) (-1257.972) * (-1258.064) (-1257.440) (-1256.389) [-1257.553] -- 0:00:08 862000 -- [-1260.295] (-1256.644) (-1258.268) (-1257.338) * [-1258.516] (-1258.694) (-1257.162) (-1259.443) -- 0:00:08 862500 -- (-1255.974) (-1260.462) [-1256.543] (-1256.822) * (-1258.525) [-1258.821] (-1257.368) (-1256.944) -- 0:00:08 863000 -- (-1256.907) [-1258.583] (-1257.619) (-1258.129) * (-1257.278) [-1256.338] (-1257.676) (-1259.685) -- 0:00:08 863500 -- (-1257.482) [-1258.895] (-1258.178) (-1258.121) * (-1260.734) (-1258.761) [-1258.270] (-1259.529) -- 0:00:08 864000 -- (-1259.408) (-1259.237) [-1259.353] (-1257.343) * (-1260.461) (-1260.409) [-1257.861] (-1260.406) -- 0:00:08 864500 -- (-1258.172) (-1257.696) (-1261.363) [-1258.927] * [-1258.833] (-1259.177) (-1259.273) (-1258.856) -- 0:00:08 865000 -- [-1257.613] (-1258.463) (-1261.002) (-1259.683) * (-1257.414) (-1258.279) [-1257.400] (-1259.335) -- 0:00:08 Average standard deviation of split frequencies: 0.006498 865500 -- [-1257.559] (-1260.788) (-1257.780) (-1257.538) * (-1258.005) (-1259.298) (-1257.829) [-1258.036] -- 0:00:08 866000 -- (-1257.344) (-1256.751) (-1258.534) [-1260.129] * (-1257.850) [-1257.961] (-1256.374) (-1257.211) -- 0:00:08 866500 -- [-1256.769] (-1256.905) (-1257.047) (-1259.077) * [-1258.719] (-1258.749) (-1258.084) (-1261.547) -- 0:00:08 867000 -- (-1257.348) (-1256.891) (-1257.595) [-1256.769] * (-1257.582) (-1257.316) [-1258.135] (-1259.363) -- 0:00:08 867500 -- (-1257.261) (-1258.607) [-1257.700] (-1258.655) * (-1258.763) [-1258.149] (-1257.634) (-1258.907) -- 0:00:08 868000 -- (-1261.449) (-1259.137) (-1256.783) [-1257.539] * (-1259.873) (-1257.490) [-1256.950] (-1257.917) -- 0:00:08 868500 -- [-1259.088] (-1261.062) (-1256.995) (-1259.247) * (-1256.862) (-1260.457) (-1256.592) [-1257.656] -- 0:00:08 869000 -- (-1260.939) [-1259.908] (-1258.640) (-1256.679) * (-1262.847) (-1257.683) (-1257.839) [-1260.190] -- 0:00:08 869500 -- [-1258.704] (-1257.833) (-1257.969) (-1258.268) * (-1257.391) (-1256.526) (-1259.544) [-1255.916] -- 0:00:08 870000 -- (-1259.013) (-1258.940) (-1260.716) [-1257.172] * (-1257.740) (-1257.454) (-1256.866) [-1259.274] -- 0:00:08 Average standard deviation of split frequencies: 0.006599 870500 -- (-1258.286) [-1259.324] (-1257.338) (-1258.575) * [-1258.262] (-1257.069) (-1257.773) (-1259.033) -- 0:00:08 871000 -- (-1256.665) (-1260.745) [-1256.356] (-1257.467) * (-1258.219) (-1255.882) [-1261.130] (-1258.744) -- 0:00:08 871500 -- (-1262.036) [-1259.560] (-1257.731) (-1256.515) * [-1258.951] (-1258.609) (-1260.878) (-1260.496) -- 0:00:08 872000 -- [-1263.624] (-1264.448) (-1260.196) (-1261.043) * [-1258.847] (-1257.780) (-1260.207) (-1258.146) -- 0:00:08 872500 -- (-1261.662) (-1262.099) (-1257.055) [-1257.086] * (-1261.524) [-1257.574] (-1261.996) (-1256.709) -- 0:00:08 873000 -- [-1257.569] (-1264.954) (-1258.377) (-1257.602) * (-1257.093) (-1258.743) (-1257.357) [-1258.052] -- 0:00:08 873500 -- (-1260.241) (-1256.555) (-1257.395) [-1258.288] * (-1260.507) (-1258.145) (-1259.126) [-1258.033] -- 0:00:07 874000 -- (-1256.929) [-1256.977] (-1257.490) (-1257.519) * (-1260.911) [-1259.360] (-1258.187) (-1261.302) -- 0:00:07 874500 -- (-1256.646) (-1258.624) (-1257.836) [-1257.388] * (-1258.540) [-1259.213] (-1260.015) (-1261.313) -- 0:00:07 875000 -- [-1260.318] (-1256.947) (-1257.479) (-1257.158) * (-1257.987) (-1264.578) (-1260.707) [-1259.595] -- 0:00:07 Average standard deviation of split frequencies: 0.006794 875500 -- (-1262.611) (-1260.830) [-1258.425] (-1258.562) * [-1258.924] (-1260.428) (-1257.041) (-1262.942) -- 0:00:07 876000 -- [-1259.762] (-1259.248) (-1260.828) (-1260.538) * (-1258.784) (-1260.014) (-1260.239) [-1260.215] -- 0:00:07 876500 -- (-1257.800) [-1263.018] (-1258.142) (-1259.466) * [-1259.530] (-1259.500) (-1258.420) (-1258.022) -- 0:00:07 877000 -- (-1256.551) (-1257.464) (-1257.601) [-1256.263] * (-1263.153) (-1258.764) (-1257.945) [-1260.512] -- 0:00:07 877500 -- (-1256.932) (-1257.285) (-1257.709) [-1260.716] * [-1257.849] (-1258.770) (-1258.273) (-1259.535) -- 0:00:07 878000 -- (-1257.629) (-1260.732) [-1256.464] (-1258.771) * (-1260.325) [-1262.059] (-1257.667) (-1264.725) -- 0:00:07 878500 -- (-1260.260) [-1263.520] (-1260.651) (-1256.966) * (-1261.175) (-1259.377) [-1256.512] (-1258.108) -- 0:00:07 879000 -- (-1259.629) (-1257.156) [-1258.361] (-1257.681) * (-1262.154) (-1261.869) (-1257.138) [-1257.928] -- 0:00:07 879500 -- (-1258.411) (-1261.290) [-1257.796] (-1261.374) * (-1257.889) (-1257.464) (-1258.775) [-1259.932] -- 0:00:07 880000 -- (-1263.437) [-1258.391] (-1257.992) (-1256.789) * (-1257.705) [-1262.115] (-1257.010) (-1258.442) -- 0:00:07 Average standard deviation of split frequencies: 0.006758 880500 -- [-1257.218] (-1257.776) (-1258.517) (-1257.855) * [-1257.551] (-1256.853) (-1256.797) (-1262.602) -- 0:00:07 881000 -- [-1258.425] (-1258.856) (-1257.686) (-1259.630) * (-1257.093) [-1257.009] (-1257.563) (-1259.182) -- 0:00:07 881500 -- (-1256.488) (-1257.322) (-1257.176) [-1256.368] * (-1258.055) (-1260.097) [-1257.341] (-1258.230) -- 0:00:07 882000 -- (-1256.656) (-1258.145) (-1256.133) [-1256.371] * (-1258.311) [-1257.199] (-1259.493) (-1257.646) -- 0:00:07 882500 -- (-1258.196) [-1257.787] (-1256.424) (-1255.975) * (-1258.811) (-1258.481) [-1257.973] (-1257.776) -- 0:00:07 883000 -- (-1257.770) (-1257.452) [-1257.066] (-1257.619) * (-1257.296) (-1257.434) (-1259.182) [-1257.591] -- 0:00:07 883500 -- (-1260.939) (-1257.953) (-1257.517) [-1256.393] * (-1258.987) (-1258.355) [-1256.370] (-1257.467) -- 0:00:07 884000 -- [-1256.637] (-1258.707) (-1257.917) (-1257.084) * (-1257.703) (-1260.407) [-1257.394] (-1256.752) -- 0:00:07 884500 -- (-1257.560) (-1259.534) (-1258.110) [-1257.223] * [-1256.524] (-1256.269) (-1262.861) (-1257.706) -- 0:00:07 885000 -- (-1258.089) (-1259.049) [-1258.711] (-1257.399) * [-1256.422] (-1258.110) (-1258.605) (-1255.885) -- 0:00:07 Average standard deviation of split frequencies: 0.006684 885500 -- (-1258.365) [-1258.520] (-1258.055) (-1257.062) * (-1258.700) (-1258.412) [-1257.609] (-1256.413) -- 0:00:07 886000 -- (-1258.642) [-1257.550] (-1256.540) (-1259.278) * [-1258.871] (-1259.076) (-1258.198) (-1256.599) -- 0:00:07 886500 -- [-1263.120] (-1256.908) (-1256.994) (-1256.213) * (-1256.478) [-1258.709] (-1258.595) (-1259.381) -- 0:00:07 887000 -- (-1258.889) (-1263.087) (-1256.475) [-1256.154] * (-1256.539) [-1259.098] (-1258.137) (-1256.793) -- 0:00:07 887500 -- (-1264.268) (-1258.549) (-1257.575) [-1255.958] * (-1256.457) (-1259.046) (-1258.317) [-1257.869] -- 0:00:07 888000 -- (-1259.942) (-1257.590) [-1257.137] (-1256.381) * (-1256.642) [-1258.890] (-1256.713) (-1258.635) -- 0:00:07 888500 -- (-1257.421) (-1258.811) (-1256.330) [-1256.712] * (-1257.323) (-1258.762) [-1256.891] (-1256.681) -- 0:00:07 889000 -- [-1258.951] (-1266.229) (-1258.008) (-1258.612) * (-1256.751) [-1256.210] (-1258.679) (-1258.191) -- 0:00:06 889500 -- (-1259.966) [-1258.864] (-1259.237) (-1256.337) * (-1257.066) [-1257.749] (-1257.800) (-1258.343) -- 0:00:06 890000 -- (-1257.805) [-1257.273] (-1256.809) (-1257.141) * (-1258.393) [-1261.710] (-1257.604) (-1260.970) -- 0:00:06 Average standard deviation of split frequencies: 0.006517 890500 -- [-1257.019] (-1257.788) (-1258.472) (-1257.643) * (-1258.033) [-1259.314] (-1257.691) (-1257.690) -- 0:00:06 891000 -- [-1257.351] (-1258.095) (-1257.231) (-1260.476) * (-1257.660) (-1265.440) (-1257.049) [-1257.151] -- 0:00:06 891500 -- (-1256.991) (-1257.661) (-1257.687) [-1258.173] * (-1257.274) (-1261.264) [-1259.118] (-1258.737) -- 0:00:06 892000 -- (-1257.448) (-1256.944) [-1257.537] (-1257.945) * (-1258.676) (-1258.951) (-1258.941) [-1258.293] -- 0:00:06 892500 -- (-1258.024) [-1260.031] (-1256.411) (-1259.722) * (-1258.613) (-1259.229) (-1257.967) [-1263.279] -- 0:00:06 893000 -- (-1260.645) (-1260.538) (-1256.920) [-1262.790] * (-1264.452) (-1256.958) [-1257.949] (-1260.480) -- 0:00:06 893500 -- (-1256.494) (-1262.001) [-1256.726] (-1259.454) * [-1256.571] (-1257.827) (-1263.571) (-1258.999) -- 0:00:06 894000 -- (-1256.543) (-1258.822) (-1258.086) [-1258.735] * [-1257.952] (-1256.091) (-1259.896) (-1256.726) -- 0:00:06 894500 -- [-1257.145] (-1260.082) (-1258.801) (-1261.599) * (-1259.259) [-1256.389] (-1258.899) (-1257.244) -- 0:00:06 895000 -- (-1257.223) [-1256.750] (-1259.060) (-1258.392) * (-1256.992) (-1259.120) (-1259.531) [-1259.117] -- 0:00:06 Average standard deviation of split frequencies: 0.006577 895500 -- (-1257.636) (-1256.886) (-1257.330) [-1257.977] * (-1257.997) [-1256.366] (-1263.203) (-1258.115) -- 0:00:06 896000 -- (-1258.697) (-1259.156) [-1256.329] (-1258.888) * (-1256.622) [-1256.092] (-1258.392) (-1258.712) -- 0:00:06 896500 -- (-1259.939) [-1259.880] (-1258.436) (-1258.357) * [-1257.733] (-1258.817) (-1259.994) (-1258.416) -- 0:00:06 897000 -- (-1257.708) (-1261.406) (-1256.733) [-1256.936] * (-1259.428) (-1257.805) (-1259.601) [-1257.290] -- 0:00:06 897500 -- (-1257.428) [-1258.130] (-1259.443) (-1258.139) * (-1257.831) (-1256.885) [-1256.195] (-1256.356) -- 0:00:06 898000 -- [-1256.837] (-1257.588) (-1261.380) (-1260.007) * (-1261.916) [-1258.277] (-1256.078) (-1257.384) -- 0:00:06 898500 -- (-1257.306) (-1256.987) [-1258.423] (-1258.348) * (-1258.974) [-1258.715] (-1258.013) (-1256.588) -- 0:00:06 899000 -- (-1257.071) [-1259.081] (-1258.603) (-1258.102) * [-1259.844] (-1261.720) (-1259.792) (-1260.803) -- 0:00:06 899500 -- [-1260.230] (-1258.346) (-1258.415) (-1257.576) * (-1259.852) (-1259.008) (-1257.288) [-1261.601] -- 0:00:06 900000 -- (-1256.732) (-1259.791) [-1256.320] (-1257.876) * [-1257.468] (-1257.050) (-1257.206) (-1256.698) -- 0:00:06 Average standard deviation of split frequencies: 0.006560 900500 -- (-1261.125) (-1255.998) [-1257.709] (-1259.942) * (-1257.133) (-1257.649) [-1259.107] (-1257.922) -- 0:00:06 901000 -- [-1260.573] (-1259.945) (-1257.191) (-1259.681) * (-1258.062) (-1257.655) [-1258.602] (-1257.313) -- 0:00:06 901500 -- (-1261.481) [-1258.460] (-1257.496) (-1261.606) * [-1257.265] (-1257.650) (-1259.016) (-1259.296) -- 0:00:06 902000 -- (-1258.905) [-1257.546] (-1257.368) (-1257.207) * (-1257.104) (-1256.327) (-1261.529) [-1258.662] -- 0:00:06 902500 -- (-1257.529) [-1261.539] (-1256.836) (-1257.474) * [-1258.122] (-1257.943) (-1256.638) (-1258.726) -- 0:00:06 903000 -- (-1256.895) (-1259.042) [-1257.614] (-1256.934) * (-1259.540) (-1259.382) (-1256.466) [-1256.757] -- 0:00:06 903500 -- [-1256.543] (-1260.673) (-1257.183) (-1256.934) * (-1260.846) [-1256.567] (-1256.276) (-1256.819) -- 0:00:06 904000 -- [-1257.881] (-1262.317) (-1257.067) (-1257.689) * (-1257.129) (-1256.854) [-1257.237] (-1256.734) -- 0:00:06 904500 -- (-1259.132) (-1260.336) (-1257.444) [-1257.117] * [-1258.454] (-1258.528) (-1259.591) (-1257.887) -- 0:00:06 905000 -- (-1256.771) (-1259.433) (-1257.429) [-1257.877] * [-1256.583] (-1261.123) (-1259.743) (-1263.351) -- 0:00:05 Average standard deviation of split frequencies: 0.006764 905500 -- (-1256.382) (-1262.869) [-1256.470] (-1261.163) * (-1257.695) (-1259.284) (-1259.521) [-1256.589] -- 0:00:05 906000 -- (-1257.468) (-1261.700) (-1257.372) [-1259.560] * (-1258.227) (-1259.309) (-1257.505) [-1257.567] -- 0:00:05 906500 -- (-1256.350) (-1259.397) (-1258.277) [-1257.440] * [-1257.464] (-1261.466) (-1257.903) (-1258.742) -- 0:00:05 907000 -- (-1257.848) [-1257.194] (-1257.626) (-1256.785) * [-1258.433] (-1260.611) (-1258.187) (-1261.346) -- 0:00:05 907500 -- (-1261.121) (-1260.566) (-1264.676) [-1257.884] * [-1259.226] (-1258.811) (-1258.751) (-1262.396) -- 0:00:05 908000 -- (-1256.451) [-1263.189] (-1257.393) (-1258.696) * (-1260.882) [-1257.816] (-1257.808) (-1259.210) -- 0:00:05 908500 -- (-1260.193) [-1257.372] (-1263.368) (-1267.862) * (-1258.917) (-1259.916) (-1256.827) [-1261.481] -- 0:00:05 909000 -- (-1260.232) (-1258.939) [-1256.388] (-1259.053) * (-1258.572) (-1257.363) (-1257.927) [-1256.627] -- 0:00:05 909500 -- (-1257.683) (-1259.431) (-1256.696) [-1260.415] * (-1256.573) (-1258.507) (-1259.202) [-1257.191] -- 0:00:05 910000 -- (-1256.597) (-1260.292) (-1261.766) [-1259.540] * (-1257.555) (-1257.921) [-1260.317] (-1259.654) -- 0:00:05 Average standard deviation of split frequencies: 0.006453 910500 -- (-1256.633) [-1256.437] (-1258.584) (-1258.550) * (-1260.494) (-1257.511) (-1259.390) [-1257.931] -- 0:00:05 911000 -- [-1257.853] (-1257.742) (-1256.180) (-1259.050) * [-1257.226] (-1258.790) (-1259.635) (-1259.117) -- 0:00:05 911500 -- (-1258.289) (-1256.566) (-1258.128) [-1258.194] * [-1257.374] (-1262.562) (-1259.052) (-1259.761) -- 0:00:05 912000 -- (-1256.922) (-1259.007) [-1259.393] (-1256.899) * [-1256.683] (-1256.299) (-1259.104) (-1263.134) -- 0:00:05 912500 -- (-1256.463) (-1259.175) [-1257.081] (-1259.959) * (-1257.376) (-1257.297) (-1259.338) [-1257.014] -- 0:00:05 913000 -- (-1257.115) (-1257.221) [-1256.383] (-1256.998) * (-1257.541) [-1258.190] (-1260.656) (-1258.222) -- 0:00:05 913500 -- (-1257.449) [-1256.925] (-1256.799) (-1256.353) * (-1256.908) (-1259.333) (-1259.133) [-1259.208] -- 0:00:05 914000 -- (-1258.649) [-1257.280] (-1258.058) (-1258.413) * (-1257.297) [-1260.156] (-1259.189) (-1257.621) -- 0:00:05 914500 -- (-1258.571) (-1257.629) [-1259.575] (-1258.234) * (-1256.787) (-1258.069) (-1261.203) [-1260.488] -- 0:00:05 915000 -- (-1258.899) (-1257.665) (-1257.758) [-1257.480] * [-1259.843] (-1258.786) (-1262.631) (-1256.721) -- 0:00:05 Average standard deviation of split frequencies: 0.006594 915500 -- (-1257.775) [-1259.762] (-1259.933) (-1260.652) * (-1259.232) (-1257.143) (-1261.040) [-1262.351] -- 0:00:05 916000 -- (-1257.379) [-1259.900] (-1257.822) (-1262.335) * (-1259.669) (-1257.658) (-1261.225) [-1262.324] -- 0:00:05 916500 -- [-1258.319] (-1260.087) (-1259.571) (-1261.043) * (-1259.153) (-1258.373) [-1258.088] (-1258.952) -- 0:00:05 917000 -- (-1257.754) (-1258.124) (-1256.601) [-1258.159] * [-1260.442] (-1263.635) (-1257.743) (-1258.032) -- 0:00:05 917500 -- (-1256.992) (-1259.553) (-1257.431) [-1256.123] * (-1257.287) [-1259.345] (-1256.882) (-1258.780) -- 0:00:05 918000 -- (-1257.422) (-1258.246) (-1256.836) [-1257.065] * (-1259.979) (-1257.437) (-1258.589) [-1256.554] -- 0:00:05 918500 -- (-1262.945) (-1256.944) (-1256.365) [-1256.361] * (-1256.972) (-1257.364) (-1256.779) [-1258.583] -- 0:00:05 919000 -- (-1257.986) (-1256.931) (-1256.523) [-1257.105] * [-1256.822] (-1257.218) (-1260.536) (-1259.142) -- 0:00:05 919500 -- (-1258.308) [-1259.934] (-1256.589) (-1257.272) * (-1256.176) [-1257.091] (-1257.126) (-1257.638) -- 0:00:05 920000 -- [-1257.963] (-1263.228) (-1259.644) (-1257.870) * (-1257.331) (-1260.077) [-1256.726] (-1257.457) -- 0:00:05 Average standard deviation of split frequencies: 0.006304 920500 -- (-1259.773) (-1257.779) [-1257.826] (-1257.875) * (-1257.675) [-1259.433] (-1259.837) (-1258.560) -- 0:00:05 921000 -- [-1258.721] (-1258.638) (-1258.135) (-1258.225) * (-1257.958) (-1260.232) [-1259.489] (-1257.913) -- 0:00:04 921500 -- (-1257.216) (-1258.542) (-1257.756) [-1256.346] * (-1261.962) (-1261.130) [-1260.654] (-1260.953) -- 0:00:04 922000 -- (-1259.920) (-1259.624) [-1257.871] (-1264.317) * [-1258.356] (-1256.214) (-1259.075) (-1259.499) -- 0:00:04 922500 -- (-1256.940) [-1257.751] (-1260.287) (-1258.376) * (-1258.986) (-1256.989) [-1258.789] (-1257.515) -- 0:00:04 923000 -- (-1258.087) [-1265.114] (-1260.617) (-1257.284) * (-1256.278) (-1258.070) [-1259.367] (-1259.552) -- 0:00:04 923500 -- [-1256.519] (-1257.574) (-1259.888) (-1256.322) * (-1260.425) (-1257.425) (-1257.121) [-1258.248] -- 0:00:04 924000 -- (-1258.163) (-1256.915) [-1257.730] (-1258.157) * (-1258.685) (-1256.253) (-1260.308) [-1258.751] -- 0:00:04 924500 -- (-1260.471) (-1259.340) [-1260.658] (-1256.782) * (-1258.970) [-1259.075] (-1261.782) (-1258.180) -- 0:00:04 925000 -- [-1256.577] (-1257.841) (-1260.098) (-1259.102) * [-1259.599] (-1259.738) (-1258.509) (-1256.757) -- 0:00:04 Average standard deviation of split frequencies: 0.006380 925500 -- [-1257.793] (-1258.177) (-1259.496) (-1256.490) * [-1262.745] (-1257.323) (-1261.688) (-1260.380) -- 0:00:04 926000 -- (-1257.789) (-1257.093) (-1259.316) [-1256.982] * [-1258.700] (-1256.704) (-1265.540) (-1260.662) -- 0:00:04 926500 -- (-1260.636) (-1258.407) [-1257.769] (-1257.060) * (-1259.275) (-1257.066) [-1256.942] (-1256.201) -- 0:00:04 927000 -- (-1256.827) [-1259.719] (-1260.660) (-1258.029) * (-1257.092) [-1256.523] (-1261.019) (-1257.178) -- 0:00:04 927500 -- (-1258.980) (-1259.749) [-1258.031] (-1257.902) * (-1258.178) [-1256.355] (-1261.213) (-1257.073) -- 0:00:04 928000 -- (-1256.892) (-1258.912) (-1257.624) [-1256.641] * (-1259.988) (-1256.344) (-1257.661) [-1261.819] -- 0:00:04 928500 -- (-1257.976) (-1256.911) (-1259.583) [-1257.947] * (-1260.502) (-1258.254) [-1261.392] (-1259.380) -- 0:00:04 929000 -- (-1256.193) (-1257.754) (-1257.639) [-1259.395] * (-1257.488) [-1258.005] (-1261.052) (-1259.285) -- 0:00:04 929500 -- [-1255.816] (-1257.931) (-1258.882) (-1260.098) * [-1257.674] (-1260.429) (-1261.640) (-1257.006) -- 0:00:04 930000 -- (-1256.438) [-1259.147] (-1257.244) (-1259.512) * (-1257.063) (-1259.421) (-1260.559) [-1256.962] -- 0:00:04 Average standard deviation of split frequencies: 0.006045 930500 -- (-1257.139) (-1261.696) (-1257.562) [-1257.182] * [-1261.088] (-1257.768) (-1262.409) (-1257.190) -- 0:00:04 931000 -- (-1256.982) (-1261.684) [-1259.618] (-1257.314) * (-1256.001) (-1259.984) (-1264.703) [-1256.662] -- 0:00:04 931500 -- (-1257.330) [-1257.831] (-1259.069) (-1258.365) * [-1256.331] (-1261.207) (-1257.286) (-1258.333) -- 0:00:04 932000 -- (-1259.989) (-1257.568) (-1257.755) [-1266.098] * [-1258.009] (-1256.486) (-1261.710) (-1259.487) -- 0:00:04 932500 -- (-1256.186) [-1256.435] (-1257.294) (-1257.644) * (-1260.853) (-1257.145) [-1260.546] (-1259.448) -- 0:00:04 933000 -- [-1256.176] (-1256.901) (-1257.311) (-1259.650) * (-1260.652) (-1257.118) [-1259.500] (-1256.493) -- 0:00:04 933500 -- (-1258.672) (-1257.257) [-1256.405] (-1258.204) * [-1257.065] (-1257.505) (-1257.771) (-1263.435) -- 0:00:04 934000 -- (-1261.743) (-1258.607) (-1259.369) [-1256.887] * (-1256.252) (-1257.676) [-1257.180] (-1260.935) -- 0:00:04 934500 -- [-1261.192] (-1258.567) (-1258.423) (-1258.962) * (-1259.622) (-1259.488) (-1258.285) [-1259.337] -- 0:00:04 935000 -- (-1262.526) (-1261.750) (-1256.590) [-1260.613] * (-1260.882) (-1259.020) [-1256.941] (-1257.975) -- 0:00:04 Average standard deviation of split frequencies: 0.005607 935500 -- (-1260.792) [-1257.635] (-1258.424) (-1256.545) * (-1258.214) [-1258.029] (-1258.086) (-1258.013) -- 0:00:04 936000 -- (-1258.250) (-1258.660) [-1259.156] (-1258.034) * (-1257.912) (-1258.313) (-1259.210) [-1257.629] -- 0:00:04 936500 -- (-1256.632) [-1258.109] (-1258.876) (-1259.142) * (-1258.026) [-1257.240] (-1259.140) (-1258.090) -- 0:00:04 937000 -- (-1256.521) [-1257.647] (-1257.585) (-1257.672) * [-1257.181] (-1258.212) (-1257.254) (-1268.437) -- 0:00:03 937500 -- (-1257.342) (-1257.137) (-1259.394) [-1256.930] * (-1258.949) (-1261.587) [-1258.062] (-1262.211) -- 0:00:03 938000 -- [-1258.788] (-1257.212) (-1259.769) (-1256.739) * (-1263.029) (-1259.665) [-1260.630] (-1256.575) -- 0:00:03 938500 -- [-1258.013] (-1256.757) (-1257.588) (-1260.289) * (-1261.433) (-1259.407) [-1259.812] (-1256.519) -- 0:00:03 939000 -- (-1258.173) [-1257.682] (-1259.409) (-1256.729) * (-1259.322) [-1257.373] (-1257.273) (-1257.044) -- 0:00:03 939500 -- (-1264.364) (-1257.529) (-1260.768) [-1257.422] * (-1258.334) [-1258.764] (-1257.435) (-1257.236) -- 0:00:03 940000 -- (-1257.376) [-1256.851] (-1258.052) (-1257.897) * (-1257.614) [-1256.221] (-1259.102) (-1256.211) -- 0:00:03 Average standard deviation of split frequencies: 0.005579 940500 -- (-1257.684) (-1261.614) (-1260.600) [-1258.318] * (-1259.616) (-1258.326) (-1260.210) [-1259.156] -- 0:00:03 941000 -- (-1257.025) (-1256.754) (-1259.815) [-1257.921] * (-1260.078) (-1257.908) (-1260.239) [-1258.650] -- 0:00:03 941500 -- [-1262.648] (-1259.436) (-1261.971) (-1257.045) * (-1261.622) (-1257.519) (-1263.611) [-1257.984] -- 0:00:03 942000 -- (-1260.958) (-1258.306) [-1262.563] (-1256.470) * (-1257.945) (-1257.487) (-1258.770) [-1260.866] -- 0:00:03 942500 -- (-1259.451) [-1259.495] (-1258.864) (-1258.528) * [-1259.950] (-1259.090) (-1260.131) (-1256.891) -- 0:00:03 943000 -- (-1261.184) [-1261.631] (-1261.474) (-1258.630) * (-1260.498) [-1259.911] (-1256.067) (-1260.316) -- 0:00:03 943500 -- [-1259.233] (-1263.669) (-1263.786) (-1261.234) * (-1257.743) (-1260.474) (-1260.205) [-1259.564] -- 0:00:03 944000 -- (-1256.851) (-1264.311) [-1258.963] (-1266.775) * (-1258.282) [-1256.440] (-1257.737) (-1258.288) -- 0:00:03 944500 -- (-1258.687) [-1256.884] (-1257.984) (-1260.556) * (-1257.913) [-1258.182] (-1266.450) (-1257.142) -- 0:00:03 945000 -- (-1259.055) (-1257.776) (-1260.023) [-1260.424] * (-1259.926) [-1257.412] (-1256.308) (-1256.764) -- 0:00:03 Average standard deviation of split frequencies: 0.005648 945500 -- (-1261.554) (-1256.826) [-1259.182] (-1259.674) * [-1259.296] (-1256.998) (-1256.430) (-1258.887) -- 0:00:03 946000 -- (-1258.309) (-1256.260) [-1256.772] (-1256.468) * [-1258.878] (-1258.789) (-1256.904) (-1257.607) -- 0:00:03 946500 -- (-1256.278) (-1258.390) [-1258.074] (-1258.792) * (-1257.228) (-1258.690) (-1258.412) [-1257.503] -- 0:00:03 947000 -- [-1257.753] (-1256.508) (-1257.432) (-1259.234) * (-1258.895) (-1256.489) (-1261.098) [-1258.468] -- 0:00:03 947500 -- [-1258.257] (-1259.280) (-1256.368) (-1259.273) * (-1260.604) (-1260.262) (-1261.188) [-1260.260] -- 0:00:03 948000 -- [-1257.997] (-1257.948) (-1259.744) (-1258.486) * (-1261.364) [-1258.979] (-1257.903) (-1258.471) -- 0:00:03 948500 -- (-1257.285) (-1257.173) [-1261.329] (-1258.263) * (-1260.797) (-1259.652) [-1258.002] (-1259.651) -- 0:00:03 949000 -- (-1261.668) [-1258.649] (-1257.239) (-1258.213) * [-1257.453] (-1260.567) (-1259.767) (-1257.873) -- 0:00:03 949500 -- (-1258.996) [-1259.200] (-1257.304) (-1258.375) * (-1260.124) (-1260.253) (-1263.296) [-1258.445] -- 0:00:03 950000 -- (-1258.564) (-1259.723) [-1257.403] (-1258.810) * (-1256.132) [-1257.031] (-1259.805) (-1256.767) -- 0:00:03 Average standard deviation of split frequencies: 0.005554 950500 -- (-1259.726) (-1260.435) (-1257.755) [-1258.915] * (-1256.111) (-1263.589) [-1261.533] (-1259.479) -- 0:00:03 951000 -- (-1257.503) (-1258.293) (-1257.126) [-1258.986] * (-1258.139) (-1256.923) (-1257.939) [-1260.741] -- 0:00:03 951500 -- (-1261.219) (-1258.229) (-1257.086) [-1260.782] * (-1257.929) [-1256.482] (-1258.856) (-1257.291) -- 0:00:03 952000 -- (-1257.770) (-1262.076) [-1259.691] (-1262.080) * [-1256.804] (-1260.344) (-1259.320) (-1258.488) -- 0:00:03 952500 -- (-1257.541) (-1260.044) [-1258.875] (-1256.108) * (-1257.619) (-1257.627) (-1256.469) [-1260.794] -- 0:00:02 953000 -- [-1256.921] (-1259.274) (-1257.392) (-1258.599) * (-1257.046) (-1258.724) (-1257.543) [-1257.788] -- 0:00:02 953500 -- (-1257.024) [-1259.080] (-1260.965) (-1257.475) * (-1257.374) (-1256.036) [-1259.636] (-1256.251) -- 0:00:02 954000 -- (-1257.561) [-1261.363] (-1257.038) (-1258.966) * (-1256.817) (-1262.751) (-1259.709) [-1259.716] -- 0:00:02 954500 -- (-1258.014) (-1260.184) [-1259.094] (-1257.765) * (-1259.276) [-1259.313] (-1258.483) (-1256.917) -- 0:00:02 955000 -- (-1259.124) (-1258.273) [-1256.100] (-1259.047) * (-1257.807) (-1262.121) [-1259.005] (-1256.312) -- 0:00:02 Average standard deviation of split frequencies: 0.005358 955500 -- (-1261.029) (-1257.913) [-1257.219] (-1261.001) * (-1258.130) (-1257.261) (-1258.156) [-1256.228] -- 0:00:02 956000 -- (-1258.231) [-1258.009] (-1256.841) (-1257.799) * (-1256.899) [-1256.419] (-1260.970) (-1256.970) -- 0:00:02 956500 -- (-1256.796) (-1257.572) (-1258.247) [-1256.351] * (-1259.564) (-1257.829) [-1257.644] (-1257.929) -- 0:00:02 957000 -- [-1256.807] (-1258.244) (-1258.785) (-1256.505) * (-1256.551) (-1256.140) (-1259.510) [-1256.488] -- 0:00:02 957500 -- (-1257.813) (-1259.561) [-1257.459] (-1258.089) * [-1255.902] (-1256.417) (-1260.661) (-1256.764) -- 0:00:02 958000 -- (-1259.568) (-1261.867) [-1256.849] (-1257.912) * (-1259.469) (-1257.416) (-1259.654) [-1257.810] -- 0:00:02 958500 -- (-1259.202) [-1259.591] (-1256.978) (-1258.362) * (-1263.565) (-1260.247) [-1259.948] (-1256.766) -- 0:00:02 959000 -- (-1257.674) [-1256.797] (-1256.951) (-1257.881) * (-1260.508) [-1259.575] (-1260.521) (-1257.870) -- 0:00:02 959500 -- (-1257.667) [-1257.809] (-1256.538) (-1258.618) * (-1257.808) (-1259.479) [-1258.311] (-1256.832) -- 0:00:02 960000 -- [-1258.054] (-1257.010) (-1257.347) (-1260.489) * (-1260.676) (-1259.123) [-1258.597] (-1256.969) -- 0:00:02 Average standard deviation of split frequencies: 0.005103 960500 -- [-1261.680] (-1256.570) (-1262.025) (-1260.077) * [-1258.001] (-1261.793) (-1257.754) (-1256.762) -- 0:00:02 961000 -- (-1257.565) (-1256.661) [-1259.967] (-1257.487) * [-1258.276] (-1259.510) (-1257.346) (-1257.850) -- 0:00:02 961500 -- (-1257.027) [-1258.551] (-1263.312) (-1257.125) * (-1259.838) (-1260.193) [-1257.313] (-1260.103) -- 0:00:02 962000 -- (-1257.995) (-1257.872) (-1262.435) [-1255.866] * (-1261.993) [-1257.495] (-1256.700) (-1257.984) -- 0:00:02 962500 -- [-1259.077] (-1257.923) (-1256.128) (-1255.866) * (-1258.782) (-1257.881) (-1263.302) [-1257.899] -- 0:00:02 963000 -- (-1260.995) (-1258.217) (-1259.697) [-1256.850] * (-1260.007) (-1257.437) (-1257.900) [-1258.705] -- 0:00:02 963500 -- (-1258.774) (-1260.129) (-1257.751) [-1257.779] * [-1262.353] (-1259.145) (-1259.568) (-1258.134) -- 0:00:02 964000 -- (-1260.547) (-1258.072) (-1257.542) [-1257.374] * (-1259.333) (-1257.992) [-1259.573] (-1258.372) -- 0:00:02 964500 -- (-1258.530) (-1258.438) [-1256.263] (-1256.511) * (-1260.939) [-1260.551] (-1260.251) (-1257.834) -- 0:00:02 965000 -- (-1257.727) [-1257.489] (-1258.788) (-1257.577) * [-1259.513] (-1256.658) (-1261.716) (-1258.946) -- 0:00:02 Average standard deviation of split frequencies: 0.005368 965500 -- (-1259.128) (-1258.234) (-1259.116) [-1258.296] * (-1261.509) (-1256.897) (-1261.182) [-1256.906] -- 0:00:02 966000 -- (-1258.353) [-1259.161] (-1257.742) (-1258.506) * (-1257.192) (-1257.659) [-1257.458] (-1258.763) -- 0:00:02 966500 -- [-1257.752] (-1256.170) (-1257.359) (-1259.942) * (-1262.904) [-1257.585] (-1256.838) (-1261.857) -- 0:00:02 967000 -- (-1262.116) [-1257.217] (-1262.447) (-1259.920) * (-1261.153) [-1260.514] (-1256.805) (-1257.802) -- 0:00:02 967500 -- (-1260.003) (-1262.814) [-1258.436] (-1259.701) * (-1257.305) [-1257.987] (-1256.994) (-1257.524) -- 0:00:02 968000 -- (-1259.727) (-1262.817) (-1258.425) [-1258.287] * (-1260.112) (-1256.269) (-1256.918) [-1257.415] -- 0:00:02 968500 -- [-1257.532] (-1258.558) (-1259.031) (-1259.522) * (-1258.317) [-1256.464] (-1258.415) (-1259.500) -- 0:00:01 969000 -- [-1257.203] (-1258.638) (-1257.769) (-1256.470) * (-1259.772) [-1257.804] (-1257.136) (-1257.285) -- 0:00:01 969500 -- (-1258.062) (-1259.928) (-1258.445) [-1256.300] * [-1256.221] (-1262.514) (-1256.515) (-1258.901) -- 0:00:01 970000 -- (-1257.020) [-1257.790] (-1257.336) (-1257.039) * [-1256.580] (-1257.183) (-1256.945) (-1260.715) -- 0:00:01 Average standard deviation of split frequencies: 0.005439 970500 -- [-1256.924] (-1257.819) (-1257.531) (-1259.912) * [-1258.191] (-1258.037) (-1257.107) (-1259.308) -- 0:00:01 971000 -- [-1257.189] (-1257.628) (-1258.039) (-1260.231) * [-1258.205] (-1260.097) (-1257.974) (-1262.334) -- 0:00:01 971500 -- (-1257.243) [-1258.246] (-1257.350) (-1257.483) * [-1259.390] (-1257.778) (-1260.765) (-1258.956) -- 0:00:01 972000 -- (-1256.798) (-1257.554) [-1257.924] (-1258.164) * (-1256.725) (-1257.597) [-1259.808] (-1257.157) -- 0:00:01 972500 -- (-1262.349) (-1257.383) [-1257.972] (-1261.017) * (-1257.691) (-1257.937) (-1260.790) [-1259.886] -- 0:00:01 973000 -- (-1258.894) (-1258.074) [-1256.684] (-1258.227) * (-1256.806) (-1256.378) [-1256.790] (-1257.251) -- 0:00:01 973500 -- (-1256.427) (-1258.102) [-1256.424] (-1256.895) * (-1257.546) (-1260.077) (-1257.016) [-1257.551] -- 0:00:01 974000 -- (-1259.788) (-1256.414) (-1257.581) [-1264.127] * (-1260.516) (-1259.998) (-1256.997) [-1258.992] -- 0:00:01 974500 -- (-1263.914) (-1256.959) [-1257.199] (-1260.683) * (-1258.143) (-1260.456) (-1263.376) [-1256.893] -- 0:00:01 975000 -- [-1259.051] (-1259.824) (-1256.843) (-1262.595) * (-1258.560) (-1261.355) (-1260.543) [-1257.143] -- 0:00:01 Average standard deviation of split frequencies: 0.005474 975500 -- (-1258.049) [-1259.158] (-1257.234) (-1258.177) * [-1258.591] (-1257.491) (-1261.998) (-1258.383) -- 0:00:01 976000 -- (-1258.128) (-1259.804) (-1256.555) [-1257.261] * [-1258.686] (-1271.462) (-1256.123) (-1257.405) -- 0:00:01 976500 -- (-1261.479) (-1256.240) (-1257.369) [-1257.034] * (-1257.968) (-1261.958) (-1258.483) [-1257.912] -- 0:00:01 977000 -- (-1257.352) [-1257.558] (-1258.753) (-1260.222) * (-1256.778) (-1258.802) [-1256.393] (-1259.825) -- 0:00:01 977500 -- (-1258.324) (-1258.754) [-1260.476] (-1258.782) * (-1256.804) [-1257.308] (-1259.341) (-1263.486) -- 0:00:01 978000 -- (-1256.729) (-1260.682) [-1257.551] (-1260.423) * [-1256.698] (-1256.673) (-1256.846) (-1257.092) -- 0:00:01 978500 -- (-1262.786) (-1256.550) [-1257.693] (-1258.661) * (-1260.004) (-1263.543) (-1256.175) [-1256.791] -- 0:00:01 979000 -- (-1260.176) (-1258.782) [-1258.709] (-1257.400) * (-1260.732) (-1260.203) (-1257.412) [-1256.848] -- 0:00:01 979500 -- (-1262.767) (-1258.602) [-1259.729] (-1258.986) * [-1258.078] (-1259.300) (-1258.800) (-1257.665) -- 0:00:01 980000 -- (-1258.579) [-1257.970] (-1258.890) (-1256.915) * (-1261.157) [-1259.139] (-1257.109) (-1258.638) -- 0:00:01 Average standard deviation of split frequencies: 0.005448 980500 -- (-1256.135) (-1256.201) [-1257.847] (-1257.920) * (-1258.882) [-1259.471] (-1258.584) (-1258.195) -- 0:00:01 981000 -- (-1260.336) (-1257.420) (-1262.944) [-1257.103] * (-1259.360) (-1257.244) [-1258.917] (-1259.664) -- 0:00:01 981500 -- (-1257.579) (-1260.420) (-1259.330) [-1259.259] * (-1261.456) (-1258.221) [-1259.883] (-1258.568) -- 0:00:01 982000 -- (-1257.567) [-1257.672] (-1259.818) (-1256.909) * (-1257.453) [-1256.569] (-1264.232) (-1256.646) -- 0:00:01 982500 -- (-1257.886) (-1259.898) [-1258.130] (-1260.120) * (-1256.080) (-1261.400) (-1268.540) [-1256.567] -- 0:00:01 983000 -- (-1258.963) (-1259.920) (-1259.556) [-1259.097] * [-1257.594] (-1261.006) (-1262.092) (-1256.244) -- 0:00:01 983500 -- (-1261.471) (-1256.841) [-1256.640] (-1259.943) * (-1256.095) (-1258.029) [-1262.229] (-1259.693) -- 0:00:01 984000 -- (-1257.069) (-1257.092) (-1259.610) [-1256.589] * [-1261.658] (-1259.364) (-1255.910) (-1259.287) -- 0:00:01 984500 -- (-1258.397) [-1256.479] (-1261.226) (-1256.408) * [-1259.393] (-1259.238) (-1260.443) (-1259.575) -- 0:00:00 985000 -- (-1258.261) [-1259.151] (-1256.859) (-1257.620) * (-1256.686) (-1257.640) [-1258.088] (-1262.952) -- 0:00:00 Average standard deviation of split frequencies: 0.005450 985500 -- (-1257.338) (-1259.871) [-1257.204] (-1258.236) * [-1258.586] (-1259.463) (-1257.937) (-1260.116) -- 0:00:00 986000 -- (-1257.782) [-1258.676] (-1261.469) (-1257.175) * (-1257.640) (-1259.074) (-1259.442) [-1256.127] -- 0:00:00 986500 -- (-1258.287) (-1258.175) [-1258.531] (-1258.990) * [-1257.191] (-1257.554) (-1257.315) (-1258.220) -- 0:00:00 987000 -- (-1260.549) (-1260.717) (-1263.692) [-1257.523] * [-1260.311] (-1257.570) (-1256.148) (-1259.463) -- 0:00:00 987500 -- [-1258.003] (-1260.711) (-1259.862) (-1257.493) * (-1258.013) [-1256.353] (-1259.523) (-1261.229) -- 0:00:00 988000 -- (-1257.358) [-1257.215] (-1258.038) (-1260.248) * (-1258.986) [-1257.897] (-1257.130) (-1258.793) -- 0:00:00 988500 -- (-1256.704) (-1256.759) [-1257.271] (-1261.697) * [-1258.760] (-1258.251) (-1262.134) (-1259.722) -- 0:00:00 989000 -- (-1257.590) [-1257.493] (-1256.489) (-1259.174) * (-1261.327) [-1257.784] (-1256.721) (-1256.390) -- 0:00:00 989500 -- [-1262.017] (-1258.790) (-1256.898) (-1257.081) * (-1262.441) (-1259.806) (-1256.646) [-1258.037] -- 0:00:00 990000 -- [-1258.806] (-1258.984) (-1256.994) (-1260.414) * (-1259.622) (-1259.122) (-1258.171) [-1259.263] -- 0:00:00 Average standard deviation of split frequencies: 0.005298 990500 -- [-1260.028] (-1256.690) (-1258.858) (-1258.728) * (-1259.753) (-1259.537) (-1256.842) [-1262.309] -- 0:00:00 991000 -- (-1259.243) (-1257.198) (-1258.067) [-1258.209] * (-1258.357) (-1257.969) [-1258.946] (-1256.644) -- 0:00:00 991500 -- (-1257.067) (-1258.864) [-1256.802] (-1256.421) * (-1257.593) (-1256.832) [-1259.328] (-1256.354) -- 0:00:00 992000 -- (-1256.940) (-1257.599) [-1259.642] (-1258.683) * [-1260.155] (-1257.936) (-1262.657) (-1257.403) -- 0:00:00 992500 -- (-1258.438) (-1257.363) (-1258.713) [-1257.227] * [-1256.760] (-1260.702) (-1258.097) (-1256.907) -- 0:00:00 993000 -- (-1259.773) (-1257.386) (-1256.968) [-1257.901] * (-1256.610) [-1260.521] (-1260.365) (-1257.289) -- 0:00:00 993500 -- (-1258.297) [-1258.082] (-1257.406) (-1258.078) * (-1258.438) (-1260.147) (-1257.550) [-1258.837] -- 0:00:00 994000 -- (-1256.781) [-1256.311] (-1257.003) (-1258.940) * (-1259.358) (-1258.432) (-1258.202) [-1256.873] -- 0:00:00 994500 -- (-1258.153) (-1261.245) (-1259.598) [-1258.520] * [-1256.082] (-1261.746) (-1256.496) (-1261.966) -- 0:00:00 995000 -- [-1260.674] (-1261.216) (-1256.187) (-1258.769) * (-1256.940) [-1260.493] (-1256.595) (-1260.960) -- 0:00:00 Average standard deviation of split frequencies: 0.005269 995500 -- (-1257.447) [-1257.458] (-1258.970) (-1258.599) * (-1259.053) (-1257.782) [-1256.163] (-1265.239) -- 0:00:00 996000 -- (-1259.410) [-1258.872] (-1258.001) (-1259.437) * (-1260.473) (-1256.847) (-1257.040) [-1256.820] -- 0:00:00 996500 -- (-1256.814) (-1257.403) [-1258.351] (-1258.251) * (-1257.996) [-1256.359] (-1258.785) (-1257.478) -- 0:00:00 997000 -- (-1257.806) [-1257.131] (-1259.241) (-1258.450) * (-1256.513) [-1255.879] (-1259.159) (-1258.088) -- 0:00:00 997500 -- (-1260.408) (-1257.230) (-1259.864) [-1259.597] * (-1257.893) (-1255.975) (-1258.101) [-1257.057] -- 0:00:00 998000 -- (-1258.782) [-1257.080] (-1259.935) (-1258.201) * (-1258.598) [-1258.568] (-1257.061) (-1257.734) -- 0:00:00 998500 -- (-1258.296) (-1260.163) (-1258.606) [-1257.449] * (-1259.099) [-1257.179] (-1256.894) (-1257.740) -- 0:00:00 999000 -- (-1259.212) [-1257.763] (-1257.655) (-1259.748) * (-1260.018) [-1258.698] (-1260.482) (-1257.152) -- 0:00:00 999500 -- (-1258.240) (-1257.555) [-1259.245] (-1263.180) * (-1260.057) (-1258.248) [-1259.269] (-1257.153) -- 0:00:00 1000000 -- [-1257.554] (-1257.531) (-1257.352) (-1257.986) * (-1259.268) (-1259.128) [-1260.060] (-1256.751) -- 0:00:00 Average standard deviation of split frequencies: 0.005308 Analysis completed in 1 mins 3 seconds Analysis used 62.08 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1255.78 Likelihood of best state for "cold" chain of run 2 was -1255.78 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 74.8 % ( 72 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.9 % ( 27 %) Dirichlet(Pi{all}) 27.9 % ( 31 %) Slider(Pi{all}) 78.6 % ( 46 %) Multiplier(Alpha{1,2}) 77.6 % ( 56 %) Multiplier(Alpha{3}) 18.9 % ( 19 %) Slider(Pinvar{all}) 98.7 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.0 % ( 66 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 21 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.2 % ( 24 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.4 % ( 75 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 26.4 % ( 25 %) Dirichlet(Pi{all}) 28.1 % ( 27 %) Slider(Pi{all}) 79.1 % ( 55 %) Multiplier(Alpha{1,2}) 77.5 % ( 50 %) Multiplier(Alpha{3}) 18.6 % ( 28 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 75 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 26 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.1 % ( 24 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166678 0.82 0.67 3 | 166645 166316 0.84 4 | 166417 166864 167080 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166786 0.82 0.67 3 | 165933 166983 0.84 4 | 166965 166815 166518 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1257.40 | 2 1 1 | | 2 | | 1 | | 2 22 11 2 2 1 | |2 1 11 1 11 | | 12 2 1 1 1 1 22 1 21 1 1 | | 1 2 2 1 1 2 2 22 2 1 211 2*| | 221 1 1 *111 2 2 11 2 2 21 2* * *2 | |1* * 1 1 2 12 211 1 * | | 2 2 1 2 2 1 1 1 2 | | 2 2 21 2 2 2 | | 2 2 2 2 1 | | 2 | | 1 2 | | 1 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1259.25 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1257.49 -1261.37 2 -1257.53 -1261.02 -------------------------------------- TOTAL -1257.51 -1261.21 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.900643 0.092477 0.364200 1.515012 0.864920 1488.72 1494.86 1.000 r(A<->C){all} 0.159936 0.020284 0.000005 0.438621 0.120621 216.56 240.37 1.000 r(A<->G){all} 0.161085 0.018992 0.000014 0.449127 0.123617 200.18 202.11 1.000 r(A<->T){all} 0.174391 0.021459 0.000021 0.464138 0.136073 132.05 194.33 1.000 r(C<->G){all} 0.169169 0.021031 0.000026 0.466477 0.127136 206.81 272.42 1.013 r(C<->T){all} 0.171707 0.019187 0.000022 0.446871 0.138987 172.63 211.20 1.000 r(G<->T){all} 0.163713 0.018688 0.000118 0.435713 0.127275 168.40 284.62 1.003 pi(A){all} 0.166456 0.000151 0.142257 0.189022 0.165970 1388.49 1420.91 1.000 pi(C){all} 0.286262 0.000221 0.254973 0.313787 0.285727 1235.71 1283.16 1.000 pi(G){all} 0.328079 0.000241 0.296183 0.358233 0.328115 1155.72 1261.40 1.000 pi(T){all} 0.219203 0.000189 0.193255 0.245969 0.218903 1294.42 1314.50 1.000 alpha{1,2} 0.432838 0.234402 0.000223 1.392350 0.265475 1059.22 1170.10 1.000 alpha{3} 0.459893 0.246594 0.000259 1.469272 0.302824 1076.35 1212.07 1.000 pinvar{all} 0.998425 0.000003 0.995150 0.999999 0.998974 1326.28 1347.80 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ..*..* 8 -- .**... 9 -- ..*.*. 10 -- ..**** 11 -- ...**. 12 -- .*.*.. 13 -- .*..*. 14 -- .**.** 15 -- .*.*** 16 -- .****. 17 -- ...*.* 18 -- ....** 19 -- .*...* 20 -- ..**.. 21 -- .***.* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 456 0.151899 0.009422 0.145237 0.158561 2 8 447 0.148901 0.000471 0.148568 0.149234 2 9 445 0.148235 0.003298 0.145903 0.150566 2 10 442 0.147235 0.002827 0.145237 0.149234 2 11 440 0.146569 0.002827 0.144570 0.148568 2 12 438 0.145903 0.008480 0.139907 0.151899 2 13 428 0.142572 0.006595 0.137908 0.147235 2 14 427 0.142239 0.010835 0.134577 0.149900 2 15 425 0.141572 0.008009 0.135909 0.147235 2 16 423 0.140906 0.002355 0.139241 0.142572 2 17 421 0.140240 0.003298 0.137908 0.142572 2 18 418 0.139241 0.000942 0.138574 0.139907 2 19 414 0.137908 0.005653 0.133911 0.141905 2 20 409 0.136243 0.008009 0.130580 0.141905 2 21 396 0.131912 0.006595 0.127249 0.136576 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.099748 0.010081 0.000038 0.303328 0.070257 1.000 2 length{all}[2] 0.101904 0.010543 0.000015 0.310810 0.070160 1.000 2 length{all}[3] 0.101736 0.010603 0.000014 0.305658 0.068238 1.000 2 length{all}[4] 0.099796 0.010097 0.000035 0.303212 0.069684 1.000 2 length{all}[5] 0.101145 0.009816 0.000014 0.308722 0.070453 1.000 2 length{all}[6] 0.100719 0.009985 0.000028 0.305439 0.068945 1.000 2 length{all}[7] 0.106673 0.010693 0.000058 0.316150 0.073982 1.001 2 length{all}[8] 0.101690 0.011483 0.000606 0.301918 0.069854 1.000 2 length{all}[9] 0.101421 0.010167 0.000322 0.311988 0.072117 0.998 2 length{all}[10] 0.094300 0.008868 0.000038 0.278039 0.064682 0.999 2 length{all}[11] 0.097552 0.011389 0.000238 0.352179 0.056291 0.998 2 length{all}[12] 0.098340 0.008615 0.000047 0.288093 0.069472 0.998 2 length{all}[13] 0.095797 0.010127 0.000182 0.289323 0.063499 0.999 2 length{all}[14] 0.089236 0.008484 0.000109 0.280006 0.059971 0.998 2 length{all}[15] 0.093903 0.007103 0.000231 0.252861 0.070852 1.003 2 length{all}[16] 0.106274 0.011658 0.000241 0.292549 0.078357 0.999 2 length{all}[17] 0.097648 0.008326 0.001153 0.269277 0.073408 0.998 2 length{all}[18] 0.107076 0.011551 0.000518 0.323253 0.073298 1.002 2 length{all}[19] 0.097383 0.010472 0.000391 0.293778 0.060769 0.998 2 length{all}[20] 0.085961 0.007919 0.000297 0.248086 0.058971 0.998 2 length{all}[21] 0.098912 0.009618 0.000277 0.301078 0.069398 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.005308 Maximum standard deviation of split frequencies = 0.010835 Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999 Maximum PSRF for parameter values = 1.003 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |---------------------------------------------------------------------- C3 (3) + |----------------------------------------------------------------------- C4 (4) | |------------------------------------------------------------------------ C5 (5) | \---------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 927 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 57 patterns at 309 / 309 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 57 patterns at 309 / 309 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 55632 bytes for conP 5016 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.018928 0.078635 0.072087 0.101623 0.023949 0.034576 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1317.641387 Iterating by ming2 Initial: fx= 1317.641387 x= 0.01893 0.07864 0.07209 0.10162 0.02395 0.03458 0.30000 1.30000 1 h-m-p 0.0000 0.0001 741.9247 ++ 1283.416554 m 0.0001 13 | 1/8 2 h-m-p 0.0007 0.0101 59.9836 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 678.7230 ++ 1275.820723 m 0.0000 44 | 2/8 4 h-m-p 0.0002 0.0143 48.7315 ----------.. | 2/8 5 h-m-p 0.0000 0.0000 606.5566 ++ 1262.948332 m 0.0000 74 | 3/8 6 h-m-p 0.0005 0.0167 39.4847 -----------.. | 3/8 7 h-m-p 0.0000 0.0001 525.1139 ++ 1228.572530 m 0.0001 105 | 4/8 8 h-m-p 0.0019 0.0381 28.3148 ------------.. | 4/8 9 h-m-p 0.0000 0.0000 431.2348 ++ 1224.532045 m 0.0000 137 | 5/8 10 h-m-p 0.0004 0.0714 18.7327 ----------.. | 5/8 11 h-m-p 0.0000 0.0001 304.6498 ++ 1217.411645 m 0.0001 167 | 6/8 12 h-m-p 0.3456 8.0000 0.0000 +++ 1217.411645 m 8.0000 179 | 6/8 13 h-m-p 0.0160 8.0000 0.0050 +++++ 1217.411644 m 8.0000 195 | 6/8 14 h-m-p 0.0176 8.0000 2.2861 +++++ 1217.411584 m 8.0000 211 | 6/8 15 h-m-p 1.6000 8.0000 5.6132 ++ 1217.411543 m 8.0000 222 | 6/8 16 h-m-p 1.6000 8.0000 15.3568 ++ 1217.411519 m 8.0000 233 | 6/8 17 h-m-p 1.6000 8.0000 17.0217 ++ 1217.411512 m 8.0000 244 | 6/8 18 h-m-p 1.6000 8.0000 8.4822 ----------Y 1217.411512 0 0.0000 265 | 6/8 19 h-m-p 1.1957 8.0000 0.0000 -C 1217.411512 0 0.0747 277 Out.. lnL = -1217.411512 278 lfun, 278 eigenQcodon, 1668 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.017874 0.091110 0.019132 0.021501 0.044961 0.027780 321.922864 0.735664 0.461875 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 0.075439 np = 9 lnL0 = -1284.530705 Iterating by ming2 Initial: fx= 1284.530705 x= 0.01787 0.09111 0.01913 0.02150 0.04496 0.02778 321.92286 0.73566 0.46188 1 h-m-p 0.0000 0.0001 731.6701 ++ 1252.576035 m 0.0001 14 | 1/9 2 h-m-p 0.0001 0.0003 101.1677 ++ 1249.885095 m 0.0003 26 | 2/9 3 h-m-p 0.0000 0.0000 1837.4741 ++ 1248.432774 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0001 1834.8302 ++ 1243.427049 m 0.0001 50 | 4/9 5 h-m-p 0.0000 0.0000 1464.4839 ++ 1237.334501 m 0.0000 62 | 5/9 6 h-m-p 0.0005 0.0026 76.0873 ++ 1217.411671 m 0.0026 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0006 ++ 1217.411671 m 8.0000 86 | 6/9 8 h-m-p 0.0125 1.1779 0.3572 ++++ 1217.411641 m 1.1779 103 | 7/9 9 h-m-p 1.6000 8.0000 0.0000 Y 1217.411641 0 1.6000 118 | 7/9 10 h-m-p 1.6000 8.0000 0.0000 Y 1217.411641 0 1.6000 132 | 7/9 11 h-m-p 0.0003 0.1458 3.4047 +++++ 1217.411641 m 0.1458 149 | 7/9 12 h-m-p 1.6000 8.0000 0.0000 C 1217.411641 0 2.3077 161 | 7/9 13 h-m-p 0.1992 0.9962 0.0000 ---------Y 1217.411641 0 0.0000 184 Out.. lnL = -1217.411641 185 lfun, 555 eigenQcodon, 2220 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.083642 0.013970 0.104213 0.078907 0.060053 0.024602 321.922864 1.461325 0.134910 0.268761 22.918973 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 0.018337 np = 11 lnL0 = -1277.898321 Iterating by ming2 Initial: fx= 1277.898321 x= 0.08364 0.01397 0.10421 0.07891 0.06005 0.02460 321.92286 1.46133 0.13491 0.26876 22.91897 1 h-m-p 0.0000 0.0001 251.3944 ++ 1269.227339 m 0.0001 16 | 1/11 2 h-m-p 0.0006 0.0069 46.6842 ++ 1253.674696 m 0.0069 30 | 2/11 3 h-m-p 0.0008 0.0041 81.6981 ++ 1228.731914 m 0.0041 44 | 3/11 4 h-m-p 0.0001 0.0005 301.7935 ++ 1225.954863 m 0.0005 58 | 4/11 5 h-m-p 0.0000 0.0000 35341.8691 ++ 1224.085658 m 0.0000 72 | 5/11 6 h-m-p 0.0000 0.0001 5841.9398 ++ 1221.962764 m 0.0001 86 | 6/11 7 h-m-p 0.0052 0.0258 19.9101 ++ 1217.411554 m 0.0258 100 | 7/11 8 h-m-p 1.6000 8.0000 0.0001 -------C 1217.411554 0 0.0000 121 Out.. lnL = -1217.411554 122 lfun, 488 eigenQcodon, 2196 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1217.409832 S = -1217.405293 -0.001734 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:01 did 20 / 57 patterns 0:01 did 30 / 57 patterns 0:01 did 40 / 57 patterns 0:02 did 50 / 57 patterns 0:02 did 57 / 57 patterns 0:02 Time used: 0:02 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.031104 0.031372 0.072793 0.062541 0.037061 0.015664 321.922864 1.062662 1.184447 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 0.086113 np = 9 lnL0 = -1292.805597 Iterating by ming2 Initial: fx= 1292.805597 x= 0.03110 0.03137 0.07279 0.06254 0.03706 0.01566 321.92286 1.06266 1.18445 1 h-m-p 0.0000 0.0001 721.5687 ++ 1265.282009 m 0.0001 14 | 1/9 2 h-m-p 0.0018 0.0571 19.3719 ------------.. | 1/9 3 h-m-p 0.0000 0.0001 668.5051 ++ 1242.018946 m 0.0001 48 | 2/9 4 h-m-p 0.0034 0.1677 9.1480 ------------.. | 2/9 5 h-m-p 0.0000 0.0000 606.3646 ++ 1241.691316 m 0.0000 82 | 3/9 6 h-m-p 0.0004 0.1936 6.5437 ----------.. | 3/9 7 h-m-p 0.0000 0.0000 523.3081 ++ 1236.491707 m 0.0000 114 | 4/9 8 h-m-p 0.0015 0.2424 5.1918 -----------.. | 4/9 9 h-m-p 0.0000 0.0001 426.8614 ++ 1220.681935 m 0.0001 147 | 5/9 10 h-m-p 0.0054 0.2839 4.7760 ------------.. | 5/9 11 h-m-p 0.0000 0.0000 306.9143 ++ 1217.411720 m 0.0000 181 | 6/9 12 h-m-p 0.4967 8.0000 0.0000 +++ 1217.411720 m 8.0000 194 | 6/9 13 h-m-p 0.3543 8.0000 0.0000 ----C 1217.411720 0 0.0003 213 Out.. lnL = -1217.411720 214 lfun, 2354 eigenQcodon, 12840 P(t) Time used: 0:05 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.065399 0.058333 0.021832 0.033378 0.108370 0.020916 321.922864 0.900000 0.501020 1.150614 21.598101 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 0.027701 np = 11 lnL0 = -1267.699295 Iterating by ming2 Initial: fx= 1267.699295 x= 0.06540 0.05833 0.02183 0.03338 0.10837 0.02092 321.92286 0.90000 0.50102 1.15061 21.59810 1 h-m-p 0.0000 0.0002 265.5845 +++ 1252.932730 m 0.0002 17 | 1/11 2 h-m-p 0.0008 0.0038 42.3541 ++ 1247.387739 m 0.0038 31 | 2/11 3 h-m-p 0.0001 0.0007 135.3867 ++ 1234.327424 m 0.0007 45 | 3/11 4 h-m-p 0.0001 0.0003 375.4262 ++ 1228.375337 m 0.0003 59 | 4/11 5 h-m-p 0.0000 0.0002 454.6785 ++ 1217.436816 m 0.0002 73 | 5/11 6 h-m-p 0.0000 0.0000 275.2612 ++ 1217.411658 m 0.0000 87 | 6/11 7 h-m-p 1.6000 8.0000 0.0004 ++ 1217.411658 m 8.0000 101 | 6/11 8 h-m-p 0.0150 2.2045 0.2356 ++++ 1217.411648 m 2.2045 122 | 6/11 9 h-m-p 0.2891 1.4456 0.8888 ------------Y 1217.411648 0 0.0000 153 | 6/11 10 h-m-p 0.0000 0.0002 0.0000 ++ 1217.411648 m 0.0002 172 | 6/11 11 h-m-p -0.0000 -0.0000 0.0078 h-m-p: -0.00000000e+00 -0.00000000e+00 7.76649131e-03 1217.411648 .. | 6/11 12 h-m-p 0.0160 8.0000 0.0023 +++++ 1217.411615 m 8.0000 210 QuantileBeta(0.15, 0.00495, 1.36312) = 1.997492e-162 2000 rounds | 6/11 13 h-m-p 0.6554 8.0000 0.0278 ++ 1217.411533 m 8.0000 229 QuantileBeta(0.15, 0.00499, 1.36312) = 1.166810e-160 2000 rounds | 6/11 14 h-m-p 1.6000 8.0000 0.0173 ++ 1217.411524 m 8.0000 248 | 6/11 15 h-m-p 0.9343 4.6716 0.1238 ++ 1217.411512 m 4.6716 267 | 7/11 16 h-m-p 1.2679 8.0000 0.0010 ++ 1217.411512 m 8.0000 286 | 7/11 17 h-m-p 0.0035 0.0173 0.5794 ----Y 1217.411512 0 0.0000 308 | 7/11 18 h-m-p 0.0160 8.0000 0.0022 +++++ 1217.411512 m 8.0000 329 | 7/11 19 h-m-p 0.0160 8.0000 2.0447 +++++ 1217.411508 m 8.0000 350 | 7/11 20 h-m-p 1.6000 8.0000 3.8247 ++ 1217.411506 m 8.0000 364 | 7/11 21 h-m-p 1.6000 8.0000 11.9311 ++ 1217.411504 m 8.0000 378 | 7/11 22 h-m-p 1.3590 6.7949 20.9615 -----------Y 1217.411504 0 0.0000 403 | 7/11 23 h-m-p 1.3338 8.0000 0.0000 C 1217.411504 0 0.3334 417 | 7/11 24 h-m-p 1.2894 8.0000 0.0000 Y 1217.411504 0 1.2894 435 Out.. lnL = -1217.411504 436 lfun, 5232 eigenQcodon, 28776 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1217.404466 S = -1217.404326 -0.000061 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:12 did 20 / 57 patterns 0:12 did 30 / 57 patterns 0:13 did 40 / 57 patterns 0:13 did 50 / 57 patterns 0:13 did 57 / 57 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=309 NC_011896_1_WP_010907613_1_235_MLBR_RS01155 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR NC_002677_1_NP_301289_1_161_ML0229 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR ************************************************** NC_011896_1_WP_010907613_1_235_MLBR_RS01155 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT NC_002677_1_NP_301289_1_161_ML0229 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT ************************************************** NC_011896_1_WP_010907613_1_235_MLBR_RS01155 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT NC_002677_1_NP_301289_1_161_ML0229 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT ************************************************** NC_011896_1_WP_010907613_1_235_MLBR_RS01155 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE NC_002677_1_NP_301289_1_161_ML0229 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE ************************************************** NC_011896_1_WP_010907613_1_235_MLBR_RS01155 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ NC_002677_1_NP_301289_1_161_ML0229 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ ************************************************** NC_011896_1_WP_010907613_1_235_MLBR_RS01155 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP NC_002677_1_NP_301289_1_161_ML0229 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP ************************************************** NC_011896_1_WP_010907613_1_235_MLBR_RS01155 YDVVEALAP NC_002677_1_NP_301289_1_161_ML0229 YDVVEALAP NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 YDVVEALAP NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 YDVVEALAP NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 YDVVEALAP NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 YDVVEALAP *********
>NC_011896_1_WP_010907613_1_235_MLBR_RS01155 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >NC_002677_1_NP_301289_1_161_ML0229 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA >NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC TACGATGTCGTCGAAGCGCTGGCGCCA
>NC_011896_1_WP_010907613_1_235_MLBR_RS01155 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >NC_002677_1_NP_301289_1_161_ML0229 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP >NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP YDVVEALAP
#NEXUS [ID: 0577367638] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907613_1_235_MLBR_RS01155 NC_002677_1_NP_301289_1_161_ML0229 NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 ; end; begin trees; translate 1 NC_011896_1_WP_010907613_1_235_MLBR_RS01155, 2 NC_002677_1_NP_301289_1_161_ML0229, 3 NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775, 4 NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680, 5 NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215, 6 NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07025708,2:0.07015986,3:0.06823817,4:0.06968362,5:0.07045267,6:0.06894491); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07025708,2:0.07015986,3:0.06823817,4:0.06968362,5:0.07045267,6:0.06894491); end;
Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1257.49 -1261.37 2 -1257.53 -1261.02 -------------------------------------- TOTAL -1257.51 -1261.21 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.900643 0.092477 0.364200 1.515012 0.864920 1488.72 1494.86 1.000 r(A<->C){all} 0.159936 0.020284 0.000005 0.438621 0.120621 216.56 240.37 1.000 r(A<->G){all} 0.161085 0.018992 0.000014 0.449127 0.123617 200.18 202.11 1.000 r(A<->T){all} 0.174391 0.021459 0.000021 0.464138 0.136073 132.05 194.33 1.000 r(C<->G){all} 0.169169 0.021031 0.000026 0.466477 0.127136 206.81 272.42 1.013 r(C<->T){all} 0.171707 0.019187 0.000022 0.446871 0.138987 172.63 211.20 1.000 r(G<->T){all} 0.163713 0.018688 0.000118 0.435713 0.127275 168.40 284.62 1.003 pi(A){all} 0.166456 0.000151 0.142257 0.189022 0.165970 1388.49 1420.91 1.000 pi(C){all} 0.286262 0.000221 0.254973 0.313787 0.285727 1235.71 1283.16 1.000 pi(G){all} 0.328079 0.000241 0.296183 0.358233 0.328115 1155.72 1261.40 1.000 pi(T){all} 0.219203 0.000189 0.193255 0.245969 0.218903 1294.42 1314.50 1.000 alpha{1,2} 0.432838 0.234402 0.000223 1.392350 0.265475 1059.22 1170.10 1.000 alpha{3} 0.459893 0.246594 0.000259 1.469272 0.302824 1076.35 1212.07 1.000 pinvar{all} 0.998425 0.000003 0.995150 0.999999 0.998974 1326.28 1347.80 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0229/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 309 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 4 4 4 4 4 4 TTC 4 4 4 4 4 4 | TCC 8 8 8 8 8 8 | TAC 4 4 4 4 4 4 | TGC 3 3 3 3 3 3 Leu TTA 3 3 3 3 3 3 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 11 11 11 11 11 11 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 4 4 4 4 4 4 | Arg CGT 1 1 1 1 1 1 CTC 7 7 7 7 7 7 | CCC 5 5 5 5 5 5 | CAC 4 4 4 4 4 4 | CGC 7 7 7 7 7 7 CTA 3 3 3 3 3 3 | CCA 4 4 4 4 4 4 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1 CTG 10 10 10 10 10 10 | CCG 4 4 4 4 4 4 | CAG 10 10 10 10 10 10 | CGG 8 8 8 8 8 8 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 5 5 5 5 5 | Thr ACT 4 4 4 4 4 4 | Asn AAT 3 3 3 3 3 3 | Ser AGT 2 2 2 2 2 2 ATC 8 8 8 8 8 8 | ACC 6 6 6 6 6 6 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2 ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0 Met ATG 6 6 6 6 6 6 | ACG 2 2 2 2 2 2 | AAG 3 3 3 3 3 3 | AGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 6 6 6 6 6 6 | Ala GCT 7 7 7 7 7 7 | Asp GAT 7 7 7 7 7 7 | Gly GGT 3 3 3 3 3 3 GTC 12 12 12 12 12 12 | GCC 14 14 14 14 14 14 | GAC 9 9 9 9 9 9 | GGC 12 12 12 12 12 12 GTA 5 5 5 5 5 5 | GCA 6 6 6 6 6 6 | Glu GAA 6 6 6 6 6 6 | GGA 4 4 4 4 4 4 GTG 13 13 13 13 13 13 | GCG 13 13 13 13 13 13 | GAG 10 10 10 10 10 10 | GGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907613_1_235_MLBR_RS01155 position 1: T:0.16828 C:0.24272 A:0.15534 G:0.43366 position 2: T:0.31392 C:0.27184 A:0.22006 G:0.19417 position 3: T:0.17476 C:0.34628 A:0.12298 G:0.35599 Average T:0.21899 C:0.28695 A:0.16613 G:0.32794 #2: NC_002677_1_NP_301289_1_161_ML0229 position 1: T:0.16828 C:0.24272 A:0.15534 G:0.43366 position 2: T:0.31392 C:0.27184 A:0.22006 G:0.19417 position 3: T:0.17476 C:0.34628 A:0.12298 G:0.35599 Average T:0.21899 C:0.28695 A:0.16613 G:0.32794 #3: NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775 position 1: T:0.16828 C:0.24272 A:0.15534 G:0.43366 position 2: T:0.31392 C:0.27184 A:0.22006 G:0.19417 position 3: T:0.17476 C:0.34628 A:0.12298 G:0.35599 Average T:0.21899 C:0.28695 A:0.16613 G:0.32794 #4: NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680 position 1: T:0.16828 C:0.24272 A:0.15534 G:0.43366 position 2: T:0.31392 C:0.27184 A:0.22006 G:0.19417 position 3: T:0.17476 C:0.34628 A:0.12298 G:0.35599 Average T:0.21899 C:0.28695 A:0.16613 G:0.32794 #5: NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215 position 1: T:0.16828 C:0.24272 A:0.15534 G:0.43366 position 2: T:0.31392 C:0.27184 A:0.22006 G:0.19417 position 3: T:0.17476 C:0.34628 A:0.12298 G:0.35599 Average T:0.21899 C:0.28695 A:0.16613 G:0.32794 #6: NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260 position 1: T:0.16828 C:0.24272 A:0.15534 G:0.43366 position 2: T:0.31392 C:0.27184 A:0.22006 G:0.19417 position 3: T:0.17476 C:0.34628 A:0.12298 G:0.35599 Average T:0.21899 C:0.28695 A:0.16613 G:0.32794 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 24 TTC 24 | TCC 48 | TAC 24 | TGC 18 Leu L TTA 18 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 66 | TCG 42 | TAG 0 | Trp W TGG 12 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 12 | His H CAT 24 | Arg R CGT 6 CTC 42 | CCC 30 | CAC 24 | CGC 42 CTA 18 | CCA 24 | Gln Q CAA 18 | CGA 6 CTG 60 | CCG 24 | CAG 60 | CGG 48 ------------------------------------------------------------------------------ Ile I ATT 30 | Thr T ACT 24 | Asn N AAT 18 | Ser S AGT 12 ATC 48 | ACC 36 | AAC 12 | AGC 12 ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0 Met M ATG 36 | ACG 12 | AAG 18 | AGG 24 ------------------------------------------------------------------------------ Val V GTT 36 | Ala A GCT 42 | Asp D GAT 42 | Gly G GGT 18 GTC 72 | GCC 84 | GAC 54 | GGC 72 GTA 30 | GCA 36 | Glu E GAA 36 | GGA 24 GTG 78 | GCG 78 | GAG 60 | GGG 42 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.16828 C:0.24272 A:0.15534 G:0.43366 position 2: T:0.31392 C:0.27184 A:0.22006 G:0.19417 position 3: T:0.17476 C:0.34628 A:0.12298 G:0.35599 Average T:0.21899 C:0.28695 A:0.16613 G:0.32794 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1217.411512 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 321.922864 21.598101 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907613_1_235_MLBR_RS01155: 0.000004, NC_002677_1_NP_301289_1_161_ML0229: 0.000004, NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775: 0.000004, NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680: 0.000004, NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215: 0.000004, NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 321.92286 omega (dN/dS) = 21.59810 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 636.5 290.5 21.5981 0.0000 0.0000 0.0 0.0 7..2 0.000 636.5 290.5 21.5981 0.0000 0.0000 0.0 0.0 7..3 0.000 636.5 290.5 21.5981 0.0000 0.0000 0.0 0.0 7..4 0.000 636.5 290.5 21.5981 0.0000 0.0000 0.0 0.0 7..5 0.000 636.5 290.5 21.5981 0.0000 0.0000 0.0 0.0 7..6 0.000 636.5 290.5 21.5981 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1217.411641 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 321.922864 0.000010 0.999974 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907613_1_235_MLBR_RS01155: 0.000004, NC_002677_1_NP_301289_1_161_ML0229: 0.000004, NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775: 0.000004, NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680: 0.000004, NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215: 0.000004, NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 321.92286 MLEs of dN/dS (w) for site classes (K=2) p: 0.00001 0.99999 w: 0.99997 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 636.5 290.5 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 636.5 290.5 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 636.5 290.5 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 636.5 290.5 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 636.5 290.5 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 636.5 290.5 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1217.411554 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 321.922864 0.698259 0.159113 0.000001 22.908601 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907613_1_235_MLBR_RS01155: 0.000004, NC_002677_1_NP_301289_1_161_ML0229: 0.000004, NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775: 0.000004, NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680: 0.000004, NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215: 0.000004, NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 321.92286 MLEs of dN/dS (w) for site classes (K=3) p: 0.69826 0.15911 0.14263 w: 0.00000 1.00000 22.90860 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 636.5 290.5 3.4265 0.0000 0.0000 0.0 0.0 7..2 0.000 636.5 290.5 3.4265 0.0000 0.0000 0.0 0.0 7..3 0.000 636.5 290.5 3.4265 0.0000 0.0000 0.0 0.0 7..4 0.000 636.5 290.5 3.4265 0.0000 0.0000 0.0 0.0 7..5 0.000 636.5 290.5 3.4265 0.0000 0.0000 0.0 0.0 7..6 0.000 636.5 290.5 3.4265 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907613_1_235_MLBR_RS01155) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907613_1_235_MLBR_RS01155) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:02 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1217.411720 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 321.922864 1.062658 1.184419 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907613_1_235_MLBR_RS01155: 0.000004, NC_002677_1_NP_301289_1_161_ML0229: 0.000004, NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775: 0.000004, NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680: 0.000004, NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215: 0.000004, NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 321.92286 Parameters in M7 (beta): p = 1.06266 q = 1.18442 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.05078 0.14406 0.23515 0.32598 0.41748 0.51039 0.60556 0.70421 0.80853 0.92455 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 636.5 290.5 0.4727 0.0000 0.0000 0.0 0.0 7..2 0.000 636.5 290.5 0.4727 0.0000 0.0000 0.0 0.0 7..3 0.000 636.5 290.5 0.4727 0.0000 0.0000 0.0 0.0 7..4 0.000 636.5 290.5 0.4727 0.0000 0.0000 0.0 0.0 7..5 0.000 636.5 290.5 0.4727 0.0000 0.0000 0.0 0.0 7..6 0.000 636.5 290.5 0.4727 0.0000 0.0000 0.0 0.0 Time used: 0:05 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1217.411504 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 321.884770 0.000010 12.838752 1.349467 163.492512 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907613_1_235_MLBR_RS01155: 0.000004, NC_002677_1_NP_301289_1_161_ML0229: 0.000004, NZ_LVXE01000009_1_WP_010907613_1_2870_A3216_RS04775: 0.000004, NZ_LYPH01000016_1_WP_010907613_1_569_A8144_RS02680: 0.000004, NZ_CP029543_1_WP_010907613_1_235_DIJ64_RS01215: 0.000004, NZ_AP014567_1_WP_010907613_1_244_JK2ML_RS01260: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 321.88477 Parameters in M8 (beta&w>1): p0 = 0.00001 p = 12.83875 q = 1.34947 (p1 = 0.99999) w = 163.49251 MLEs of dN/dS (w) for site classes (K=11) p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999 w: 0.75572 0.82925 0.86697 0.89348 0.91441 0.93205 0.94762 0.96190 0.97560 0.98993 163.49251 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 636.5 290.5 163.4909 0.0000 0.0000 0.0 0.0 7..2 0.000 636.5 290.5 163.4909 0.0000 0.0000 0.0 0.0 7..3 0.000 636.5 290.5 163.4909 0.0000 0.0000 0.0 0.0 7..4 0.000 636.5 290.5 163.4909 0.0000 0.0000 0.0 0.0 7..5 0.000 636.5 290.5 163.4909 0.0000 0.0000 0.0 0.0 7..6 0.000 636.5 290.5 163.4909 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907613_1_235_MLBR_RS01155) Pr(w>1) post mean +- SE for w 1 M 1.000** 163.491 2 V 1.000** 163.491 3 Q 1.000** 163.491 4 F 1.000** 163.491 5 D 1.000** 163.491 6 G 1.000** 163.491 7 L 1.000** 163.491 8 R 1.000** 163.491 9 S 1.000** 163.491 10 A 1.000** 163.491 11 R 1.000** 163.491 12 L 1.000** 163.491 13 N 1.000** 163.491 14 I 1.000** 163.491 15 A 1.000** 163.491 16 I 1.000** 163.491 17 L 1.000** 163.491 18 S 1.000** 163.491 19 T 1.000** 163.491 20 G 1.000** 163.491 21 R 1.000** 163.491 22 V 1.000** 163.491 23 G 1.000** 163.491 24 V 1.000** 163.491 25 A 1.000** 163.491 26 L 1.000** 163.491 27 E 1.000** 163.491 28 R 1.000** 163.491 29 A 1.000** 163.491 30 D 1.000** 163.491 31 Q 1.000** 163.491 32 V 1.000** 163.491 33 V 1.000** 163.491 34 V 1.000** 163.491 35 A 1.000** 163.491 36 C 1.000** 163.491 37 S 1.000** 163.491 38 A 1.000** 163.491 39 V 1.000** 163.491 40 S 1.000** 163.491 41 H 1.000** 163.491 42 A 1.000** 163.491 43 S 1.000** 163.491 44 R 1.000** 163.491 45 Q 1.000** 163.491 46 W 1.000** 163.491 47 V 1.000** 163.491 48 Q 1.000** 163.491 49 F 1.000** 163.491 50 R 1.000** 163.491 51 L 1.000** 163.491 52 P 1.000** 163.491 53 E 1.000** 163.491 54 T 1.000** 163.491 55 S 1.000** 163.491 56 V 1.000** 163.491 57 A 1.000** 163.491 58 S 1.000** 163.491 59 P 1.000** 163.491 60 P 1.000** 163.491 61 E 1.000** 163.491 62 V 1.000** 163.491 63 A 1.000** 163.491 64 S 1.000** 163.491 65 S 1.000** 163.491 66 A 1.000** 163.491 67 E 1.000** 163.491 68 L 1.000** 163.491 69 L 1.000** 163.491 70 L 1.000** 163.491 71 L 1.000** 163.491 72 A 1.000** 163.491 73 V 1.000** 163.491 74 P 1.000** 163.491 75 D 1.000** 163.491 76 C 1.000** 163.491 77 E 1.000** 163.491 78 F 1.000** 163.491 79 A 1.000** 163.491 80 G 1.000** 163.491 81 L 1.000** 163.491 82 M 1.000** 163.491 83 S 1.000** 163.491 84 G 1.000** 163.491 85 V 1.000** 163.491 86 A 1.000** 163.491 87 V 1.000** 163.491 88 T 1.000** 163.491 89 S 1.000** 163.491 90 V 1.000** 163.491 91 P 1.000** 163.491 92 R 1.000** 163.491 93 P 1.000** 163.491 94 G 1.000** 163.491 95 T 1.000** 163.491 96 I 1.000** 163.491 97 V 1.000** 163.491 98 A 1.000** 163.491 99 H 1.000** 163.491 100 T 1.000** 163.491 101 S 1.000** 163.491 102 W 1.000** 163.491 103 A 1.000** 163.491 104 N 1.000** 163.491 105 G 1.000** 163.491 106 V 1.000** 163.491 107 G 1.000** 163.491 108 I 1.000** 163.491 109 L 1.000** 163.491 110 A 1.000** 163.491 111 Q 1.000** 163.491 112 L 1.000** 163.491 113 G 1.000** 163.491 114 K 1.000** 163.491 115 D 1.000** 163.491 116 G 1.000** 163.491 117 C 1.000** 163.491 118 I 1.000** 163.491 119 P 1.000** 163.491 120 L 1.000** 163.491 121 A 1.000** 163.491 122 I 1.000** 163.491 123 H 1.000** 163.491 124 P 1.000** 163.491 125 A 1.000** 163.491 126 M 1.000** 163.491 127 M 1.000** 163.491 128 F 1.000** 163.491 129 S 1.000** 163.491 130 G 1.000** 163.491 131 S 1.000** 163.491 132 D 1.000** 163.491 133 E 1.000** 163.491 134 D 1.000** 163.491 135 L 1.000** 163.491 136 S 1.000** 163.491 137 Q 1.000** 163.491 138 C 1.000** 163.491 139 Q 1.000** 163.491 140 L 1.000** 163.491 141 R 1.000** 163.491 142 D 1.000** 163.491 143 T 1.000** 163.491 144 Y 1.000** 163.491 145 F 1.000** 163.491 146 G 1.000** 163.491 147 I 1.000** 163.491 148 T 1.000** 163.491 149 K 1.000** 163.491 150 T 1.000** 163.491 151 D 1.000** 163.491 152 D 1.000** 163.491 153 V 1.000** 163.491 154 G 1.000** 163.491 155 Y 1.000** 163.491 156 A 1.000** 163.491 157 I 1.000** 163.491 158 A 1.000** 163.491 159 Q 1.000** 163.491 160 S 1.000** 163.491 161 L 1.000** 163.491 162 V 1.000** 163.491 163 L 1.000** 163.491 164 E 1.000** 163.491 165 M 1.000** 163.491 166 G 1.000** 163.491 167 G 1.000** 163.491 168 E 1.000** 163.491 169 P 1.000** 163.491 170 F 1.000** 163.491 171 C 1.000** 163.491 172 V 1.000** 163.491 173 V 1.000** 163.491 174 E 1.000** 163.491 175 Y 1.000** 163.491 176 A 1.000** 163.491 177 R 1.000** 163.491 178 I 1.000** 163.491 179 L 1.000** 163.491 180 Y 1.000** 163.491 181 H 1.000** 163.491 182 S 1.000** 163.491 183 V 1.000** 163.491 184 S 1.000** 163.491 185 P 1.000** 163.491 186 H 1.000** 163.491 187 V 1.000** 163.491 188 G 1.000** 163.491 189 N 1.000** 163.491 190 H 1.000** 163.491 191 I 1.000** 163.491 192 V 1.000** 163.491 193 T 1.000** 163.491 194 V 1.000** 163.491 195 L 1.000** 163.491 196 A 1.000** 163.491 197 D 1.000** 163.491 198 A 1.000** 163.491 199 L 1.000** 163.491 200 E 1.000** 163.491 201 V 1.000** 163.491 202 R 1.000** 163.491 203 R 1.000** 163.491 204 S 1.000** 163.491 205 A 1.000** 163.491 206 L 1.000** 163.491 207 R 1.000** 163.491 208 G 1.000** 163.491 209 S 1.000** 163.491 210 E 1.000** 163.491 211 L 1.000** 163.491 212 L 1.000** 163.491 213 G 1.000** 163.491 214 L 1.000** 163.491 215 G 1.000** 163.491 216 V 1.000** 163.491 217 P 1.000** 163.491 218 P 1.000** 163.491 219 A 1.000** 163.491 220 C 1.000** 163.491 221 R 1.000** 163.491 222 G 1.000** 163.491 223 E 1.000** 163.491 224 V 1.000** 163.491 225 V 1.000** 163.491 226 D 1.000** 163.491 227 D 1.000** 163.491 228 Q 1.000** 163.491 229 L 1.000** 163.491 230 D 1.000** 163.491 231 V 1.000** 163.491 232 I 1.000** 163.491 233 V 1.000** 163.491 234 E 1.000** 163.491 235 R 1.000** 163.491 236 I 1.000** 163.491 237 V 1.000** 163.491 238 G 1.000** 163.491 239 S 1.000** 163.491 240 L 1.000** 163.491 241 A 1.000** 163.491 242 R 1.000** 163.491 243 A 1.000** 163.491 244 A 1.000** 163.491 245 C 1.000** 163.491 246 E 1.000** 163.491 247 N 1.000** 163.491 248 T 1.000** 163.491 249 L 1.000** 163.491 250 Q 1.000** 163.491 251 R 1.000** 163.491 252 G 1.000** 163.491 253 Q 1.000** 163.491 254 A 1.000** 163.491 255 G 1.000** 163.491 256 L 1.000** 163.491 257 T 1.000** 163.491 258 K 1.000** 163.491 259 L 1.000** 163.491 260 V 1.000** 163.491 261 A 1.000** 163.491 262 R 1.000** 163.491 263 G 1.000** 163.491 264 D 1.000** 163.491 265 L 1.000** 163.491 266 D 1.000** 163.491 267 A 1.000** 163.491 268 L 1.000** 163.491 269 A 1.000** 163.491 270 G 1.000** 163.491 271 H 1.000** 163.491 272 L 1.000** 163.491 273 V 1.000** 163.491 274 A 1.000** 163.491 275 L 1.000** 163.491 276 M 1.000** 163.491 277 R 1.000** 163.491 278 I 1.000** 163.491 279 G 1.000** 163.491 280 P 1.000** 163.491 281 E 1.000** 163.491 282 L 1.000** 163.491 283 A 1.000** 163.491 284 Q 1.000** 163.491 285 A 1.000** 163.491 286 Y 1.000** 163.491 287 R 1.000** 163.491 288 V 1.000** 163.491 289 N 1.000** 163.491 290 A 1.000** 163.491 291 L 1.000** 163.491 292 R 1.000** 163.491 293 K 1.000** 163.491 294 T 1.000** 163.491 295 Q 1.000** 163.491 296 R 1.000** 163.491 297 A 1.000** 163.491 298 H 1.000** 163.491 299 A 1.000** 163.491 300 P 1.000** 163.491 301 Y 1.000** 163.491 302 D 1.000** 163.491 303 V 1.000** 163.491 304 V 1.000** 163.491 305 E 1.000** 163.491 306 A 1.000** 163.491 307 L 1.000** 163.491 308 A 1.000** 163.491 309 P 1.000** 163.491 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907613_1_235_MLBR_RS01155) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Time used: 0:13
Model 1: NearlyNeutral -1217.411641 Model 2: PositiveSelection -1217.411554 Model 0: one-ratio -1217.411512 Model 7: beta -1217.41172 Model 8: beta&w>1 -1217.411504 Model 0 vs 1 2.5800000003073364E-4 Model 2 vs 1 1.739999997880659E-4 Model 8 vs 7 4.320000002735469E-4