--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 16:21:06 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0229/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1257.49         -1261.37
2      -1257.53         -1261.02
--------------------------------------
TOTAL    -1257.51         -1261.21
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.900643    0.092477    0.364200    1.515012    0.864920   1488.72   1494.86    1.000
r(A<->C){all}   0.159936    0.020284    0.000005    0.438621    0.120621    216.56    240.37    1.000
r(A<->G){all}   0.161085    0.018992    0.000014    0.449127    0.123617    200.18    202.11    1.000
r(A<->T){all}   0.174391    0.021459    0.000021    0.464138    0.136073    132.05    194.33    1.000
r(C<->G){all}   0.169169    0.021031    0.000026    0.466477    0.127136    206.81    272.42    1.013
r(C<->T){all}   0.171707    0.019187    0.000022    0.446871    0.138987    172.63    211.20    1.000
r(G<->T){all}   0.163713    0.018688    0.000118    0.435713    0.127275    168.40    284.62    1.003
pi(A){all}      0.166456    0.000151    0.142257    0.189022    0.165970   1388.49   1420.91    1.000
pi(C){all}      0.286262    0.000221    0.254973    0.313787    0.285727   1235.71   1283.16    1.000
pi(G){all}      0.328079    0.000241    0.296183    0.358233    0.328115   1155.72   1261.40    1.000
pi(T){all}      0.219203    0.000189    0.193255    0.245969    0.218903   1294.42   1314.50    1.000
alpha{1,2}      0.432838    0.234402    0.000223    1.392350    0.265475   1059.22   1170.10    1.000
alpha{3}        0.459893    0.246594    0.000259    1.469272    0.302824   1076.35   1212.07    1.000
pinvar{all}     0.998425    0.000003    0.995150    0.999999    0.998974   1326.28   1347.80    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1217.411641
Model 2: PositiveSelection	-1217.411554
Model 0: one-ratio	-1217.411512
Model 7: beta	-1217.41172
Model 8: beta&w>1	-1217.411504


Model 0 vs 1	2.5800000003073364E-4

Model 2 vs 1	1.739999997880659E-4

Model 8 vs 7	4.320000002735469E-4
>C1
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C2
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C3
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C4
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C5
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C6
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=309 

C1              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C2              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C3              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C4              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C5              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C6              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
                **************************************************

C1              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C2              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C3              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C4              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C5              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C6              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
                **************************************************

C1              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C2              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C3              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C4              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C5              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C6              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
                **************************************************

C1              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C2              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C3              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C4              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C5              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C6              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
                **************************************************

C1              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C2              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C3              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C4              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C5              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C6              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
                **************************************************

C1              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C2              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C3              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C4              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C5              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C6              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
                **************************************************

C1              YDVVEALAP
C2              YDVVEALAP
C3              YDVVEALAP
C4              YDVVEALAP
C5              YDVVEALAP
C6              YDVVEALAP
                *********




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  309 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  309 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9270]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [9270]--->[9270]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.509 Mb, Max= 30.872 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C2              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C3              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C4              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C5              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
C6              MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
                **************************************************

C1              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C2              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C3              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C4              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C5              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
C6              LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
                **************************************************

C1              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C2              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C3              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C4              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C5              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
C6              SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
                **************************************************

C1              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C2              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C3              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C4              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C5              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
C6              DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
                **************************************************

C1              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C2              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C3              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C4              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C5              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
C6              VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
                **************************************************

C1              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C2              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C3              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C4              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C5              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
C6              RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
                **************************************************

C1              YDVVEALAP
C2              YDVVEALAP
C3              YDVVEALAP
C4              YDVVEALAP
C5              YDVVEALAP
C6              YDVVEALAP
                *********




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
C2              ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
C3              ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
C4              ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
C5              ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
C6              ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
                **************************************************

C1              CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
C2              CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
C3              CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
C4              CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
C5              CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
C6              CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
                **************************************************

C1              TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
C2              TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
C3              TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
C4              TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
C5              TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
C6              TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
                **************************************************

C1              TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
C2              TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
C3              TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
C4              TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
C5              TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
C6              TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
                **************************************************

C1              GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
C2              GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
C3              GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
C4              GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
C5              GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
C6              GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
                **************************************************

C1              GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
C2              GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
C3              GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
C4              GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
C5              GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
C6              GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
                **************************************************

C1              TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
C2              TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
C3              TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
C4              TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
C5              TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
C6              TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
                **************************************************

C1              TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
C2              TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
C3              TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
C4              TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
C5              TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
C6              TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
                **************************************************

C1              ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
C2              ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
C3              ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
C4              ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
C5              ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
C6              ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
                **************************************************

C1              GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
C2              GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
C3              GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
C4              GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
C5              GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
C6              GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
                **************************************************

C1              AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
C2              AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
C3              AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
C4              AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
C5              AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
C6              AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
                **************************************************

C1              CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
C2              CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
C3              CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
C4              CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
C5              CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
C6              CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
                **************************************************

C1              GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
C2              GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
C3              GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
C4              GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
C5              GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
C6              GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
                **************************************************

C1              TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
C2              TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
C3              TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
C4              TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
C5              TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
C6              TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
                **************************************************

C1              AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
C2              AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
C3              AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
C4              AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
C5              AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
C6              AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
                **************************************************

C1              CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
C2              CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
C3              CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
C4              CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
C5              CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
C6              CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
                **************************************************

C1              GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
C2              GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
C3              GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
C4              GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
C5              GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
C6              GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
                **************************************************

C1              AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
C2              AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
C3              AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
C4              AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
C5              AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
C6              AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
                **************************************************

C1              TACGATGTCGTCGAAGCGCTGGCGCCA
C2              TACGATGTCGTCGAAGCGCTGGCGCCA
C3              TACGATGTCGTCGAAGCGCTGGCGCCA
C4              TACGATGTCGTCGAAGCGCTGGCGCCA
C5              TACGATGTCGTCGAAGCGCTGGCGCCA
C6              TACGATGTCGTCGAAGCGCTGGCGCCA
                ***************************



>C1
ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
TACGATGTCGTCGAAGCGCTGGCGCCA
>C2
ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
TACGATGTCGTCGAAGCGCTGGCGCCA
>C3
ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
TACGATGTCGTCGAAGCGCTGGCGCCA
>C4
ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
TACGATGTCGTCGAAGCGCTGGCGCCA
>C5
ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
TACGATGTCGTCGAAGCGCTGGCGCCA
>C6
ATGGTGCAGTTCGATGGTTTGCGCTCGGCCAGGCTCAATATTGCGATCCT
CTCCACCGGCCGGGTAGGTGTCGCATTGGAGCGCGCCGACCAAGTCGTGG
TGGCATGCAGCGCAGTCTCCCATGCATCGCGGCAGTGGGTGCAGTTTAGG
TTGCCCGAAACCTCGGTGGCCTCGCCACCGGAGGTAGCCTCCAGTGCTGA
GCTGCTGCTGTTGGCGGTTCCCGACTGTGAATTCGCCGGACTGATGTCCG
GCGTGGCTGTGACTTCGGTGCCGCGACCCGGGACGATCGTGGCCCACACT
TCGTGGGCCAACGGGGTCGGCATCCTCGCACAGCTGGGCAAGGATGGCTG
TATTCCTCTGGCAATTCACCCGGCGATGATGTTCTCCGGCTCCGACGAGG
ACCTCAGTCAATGTCAATTGAGGGATACCTACTTCGGGATCACCAAGACT
GACGATGTCGGGTATGCGATCGCGCAGTCATTGGTTTTGGAGATGGGCGG
AGAGCCGTTTTGTGTGGTAGAGTACGCCCGCATCCTCTACCATTCCGTTT
CGCCCCATGTGGGCAATCACATCGTGACGGTGTTAGCTGACGCGCTTGAG
GTACGGCGGTCCGCGTTGCGCGGCAGCGAACTACTCGGACTAGGGGTACC
TCCAGCTTGCAGGGGCGAGGTCGTCGATGACCAGCTCGACGTTATTGTCG
AACGCATCGTTGGGTCATTGGCCCGGGCTGCGTGCGAGAACACCCTGCAG
CGCGGCCAGGCCGGGCTTACCAAACTGGTCGCCCGCGGTGATTTGGACGC
GTTAGCGGGACACTTAGTCGCGCTGATGCGGATTGGCCCAGAATTGGCCC
AGGCTTATCGGGTTAATGCCCTACGGAAGACTCAGCGTGCCCATGCTCCC
TACGATGTCGTCGAAGCGCTGGCGCCA
>C1
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C2
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C3
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C4
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C5
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP
>C6
MVQFDGLRSARLNIAILSTGRVGVALERADQVVVACSAVSHASRQWVQFR
LPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHT
SWANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFGITKT
DDVGYAIAQSLVLEMGGEPFCVVEYARILYHSVSPHVGNHIVTVLADALE
VRRSALRGSELLGLGVPPACRGEVVDDQLDVIVERIVGSLARAACENTLQ
RGQAGLTKLVARGDLDALAGHLVALMRIGPELAQAYRVNALRKTQRAHAP
YDVVEALAP


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 927 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579796388
      Setting output file names to "/data/4res/ML0229/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1362352105
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0577367638
      Seed = 2097125644
      Swapseed = 1579796388
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2074.670436 -- -24.965149
         Chain 2 -- -2074.670436 -- -24.965149
         Chain 3 -- -2074.670436 -- -24.965149
         Chain 4 -- -2074.670316 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2074.670316 -- -24.965149
         Chain 2 -- -2074.670436 -- -24.965149
         Chain 3 -- -2074.670436 -- -24.965149
         Chain 4 -- -2074.670316 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2074.670] (-2074.670) (-2074.670) (-2074.670) * [-2074.670] (-2074.670) (-2074.670) (-2074.670) 
        500 -- (-1278.002) (-1279.360) [-1267.784] (-1285.264) * (-1280.331) (-1273.812) (-1270.948) [-1266.173] -- 0:00:00
       1000 -- (-1274.656) [-1270.359] (-1269.134) (-1282.504) * (-1274.848) [-1269.575] (-1274.594) (-1270.796) -- 0:00:00
       1500 -- (-1278.167) (-1268.656) [-1263.934] (-1281.154) * [-1261.557] (-1265.645) (-1265.095) (-1269.434) -- 0:00:00
       2000 -- (-1267.422) (-1273.834) [-1265.880] (-1272.937) * (-1269.877) [-1271.294] (-1265.010) (-1265.774) -- 0:00:00
       2500 -- (-1270.032) (-1263.937) [-1264.727] (-1266.508) * (-1266.372) (-1263.784) [-1265.958] (-1260.556) -- 0:00:00
       3000 -- (-1268.397) [-1269.605] (-1270.028) (-1266.317) * [-1262.968] (-1272.120) (-1272.057) (-1272.164) -- 0:00:00
       3500 -- (-1268.486) (-1266.401) [-1265.188] (-1273.131) * (-1268.894) (-1267.714) (-1266.909) [-1268.284] -- 0:00:00
       4000 -- (-1266.621) (-1269.461) (-1267.083) [-1266.348] * (-1267.894) [-1265.831] (-1263.831) (-1269.829) -- 0:00:00
       4500 -- (-1266.115) (-1268.743) [-1263.913] (-1263.380) * (-1268.493) (-1271.690) (-1260.739) [-1267.705] -- 0:00:00
       5000 -- (-1272.282) (-1269.044) [-1265.837] (-1268.406) * (-1259.479) (-1268.102) (-1261.761) [-1266.237] -- 0:00:00

      Average standard deviation of split frequencies: 0.107513

       5500 -- [-1268.778] (-1267.222) (-1264.604) (-1265.964) * (-1263.586) (-1275.408) [-1265.581] (-1274.673) -- 0:00:00
       6000 -- (-1262.622) (-1268.931) (-1265.393) [-1264.252] * (-1269.833) (-1270.341) [-1267.708] (-1264.909) -- 0:00:00
       6500 -- (-1268.243) [-1277.216] (-1265.530) (-1265.037) * (-1273.439) (-1263.494) (-1274.307) [-1264.200] -- 0:00:00
       7000 -- [-1261.733] (-1263.962) (-1278.679) (-1262.449) * (-1263.691) [-1272.486] (-1278.898) (-1268.303) -- 0:00:00
       7500 -- (-1265.234) [-1268.796] (-1264.377) (-1265.144) * [-1271.009] (-1268.624) (-1266.106) (-1267.340) -- 0:00:00
       8000 -- [-1267.597] (-1268.142) (-1271.423) (-1268.288) * (-1273.826) (-1267.473) (-1280.957) [-1264.602] -- 0:00:00
       8500 -- [-1260.365] (-1280.143) (-1269.368) (-1272.161) * [-1265.529] (-1265.535) (-1271.016) (-1270.330) -- 0:00:00
       9000 -- (-1271.025) [-1266.837] (-1265.644) (-1267.561) * (-1265.603) (-1269.684) [-1261.891] (-1264.062) -- 0:00:00
       9500 -- [-1266.358] (-1266.245) (-1264.287) (-1267.451) * (-1265.282) (-1271.998) [-1263.991] (-1271.821) -- 0:00:00
      10000 -- (-1265.055) (-1267.598) (-1268.554) [-1270.886] * (-1279.242) (-1270.754) (-1279.475) [-1260.119] -- 0:01:39

      Average standard deviation of split frequencies: 0.064082

      10500 -- (-1267.541) (-1270.163) [-1268.167] (-1272.081) * (-1270.242) [-1263.577] (-1275.257) (-1270.959) -- 0:01:34
      11000 -- (-1264.784) [-1265.780] (-1264.752) (-1277.984) * (-1272.039) [-1267.198] (-1268.131) (-1269.829) -- 0:01:29
      11500 -- (-1266.469) [-1264.174] (-1267.487) (-1266.051) * (-1272.369) (-1272.153) [-1263.793] (-1270.540) -- 0:01:25
      12000 -- [-1272.976] (-1267.035) (-1267.368) (-1267.212) * (-1265.934) (-1267.819) (-1275.475) [-1271.697] -- 0:01:22
      12500 -- (-1266.513) (-1272.515) [-1266.881] (-1264.925) * (-1262.463) [-1262.290] (-1262.634) (-1265.518) -- 0:01:19
      13000 -- (-1263.917) (-1263.142) (-1264.842) [-1260.869] * [-1267.617] (-1271.069) (-1273.465) (-1272.059) -- 0:01:15
      13500 -- (-1267.244) (-1268.785) (-1265.201) [-1263.208] * (-1268.405) [-1263.295] (-1263.668) (-1278.873) -- 0:01:13
      14000 -- (-1268.221) [-1269.469] (-1265.273) (-1270.269) * [-1259.807] (-1274.667) (-1266.015) (-1281.304) -- 0:01:10
      14500 -- (-1270.340) (-1266.209) [-1264.320] (-1271.993) * (-1266.439) (-1269.250) [-1262.856] (-1256.115) -- 0:01:07
      15000 -- (-1271.343) [-1266.065] (-1267.513) (-1261.912) * (-1269.109) [-1262.907] (-1264.903) (-1257.183) -- 0:01:05

      Average standard deviation of split frequencies: 0.065473

      15500 -- (-1269.587) [-1265.319] (-1267.229) (-1272.756) * (-1268.825) (-1266.262) [-1263.197] (-1256.939) -- 0:01:03
      16000 -- (-1267.790) [-1267.476] (-1267.129) (-1263.087) * (-1265.186) (-1264.270) (-1275.223) [-1259.115] -- 0:01:01
      16500 -- (-1266.087) [-1267.567] (-1273.878) (-1268.112) * (-1266.660) (-1272.355) [-1269.426] (-1257.160) -- 0:00:59
      17000 -- (-1271.257) [-1263.880] (-1268.822) (-1262.545) * (-1268.205) [-1268.070] (-1263.193) (-1258.613) -- 0:00:57
      17500 -- [-1261.442] (-1257.684) (-1265.441) (-1267.876) * (-1271.249) (-1264.991) (-1263.756) [-1256.770] -- 0:00:56
      18000 -- (-1271.965) (-1257.768) [-1264.765] (-1272.479) * (-1269.456) [-1263.174] (-1264.415) (-1257.510) -- 0:00:54
      18500 -- (-1268.468) (-1260.360) (-1268.515) [-1267.585] * (-1269.351) (-1274.994) (-1270.264) [-1260.362] -- 0:00:53
      19000 -- (-1269.842) [-1259.771] (-1263.082) (-1268.492) * (-1267.528) (-1268.313) [-1266.435] (-1260.048) -- 0:00:51
      19500 -- (-1273.271) (-1256.869) (-1267.534) [-1265.444] * (-1264.488) [-1268.808] (-1271.584) (-1257.813) -- 0:00:50
      20000 -- (-1263.059) [-1257.120] (-1268.411) (-1267.443) * [-1262.199] (-1265.864) (-1265.194) (-1260.731) -- 0:00:49

      Average standard deviation of split frequencies: 0.048471

      20500 -- (-1272.016) [-1256.376] (-1266.445) (-1269.739) * (-1278.309) [-1266.962] (-1269.139) (-1258.126) -- 0:00:47
      21000 -- [-1273.852] (-1256.385) (-1271.164) (-1267.990) * (-1265.069) (-1276.392) [-1265.348] (-1261.008) -- 0:00:46
      21500 -- (-1267.075) [-1257.808] (-1266.393) (-1264.580) * (-1260.907) (-1268.921) [-1264.008] (-1258.578) -- 0:00:45
      22000 -- (-1279.051) (-1256.594) [-1264.364] (-1277.468) * (-1259.164) [-1264.910] (-1262.321) (-1258.663) -- 0:00:44
      22500 -- (-1264.113) (-1258.307) (-1268.595) [-1266.016] * (-1256.606) (-1267.678) [-1264.345] (-1259.788) -- 0:00:43
      23000 -- [-1265.663] (-1256.278) (-1268.674) (-1267.936) * (-1260.090) (-1269.226) [-1262.596] (-1260.542) -- 0:00:42
      23500 -- (-1272.339) [-1256.278] (-1266.650) (-1269.297) * (-1260.655) (-1270.127) [-1263.790] (-1258.531) -- 0:00:41
      24000 -- (-1266.808) (-1256.546) [-1265.817] (-1278.717) * (-1260.121) [-1266.274] (-1264.573) (-1258.478) -- 0:00:40
      24500 -- (-1267.416) [-1256.524] (-1267.802) (-1269.753) * (-1259.349) [-1273.638] (-1266.022) (-1258.051) -- 0:00:39
      25000 -- (-1266.537) [-1256.621] (-1279.027) (-1270.325) * (-1259.584) (-1262.982) (-1268.216) [-1257.242] -- 0:01:18

      Average standard deviation of split frequencies: 0.040579

      25500 -- (-1271.862) (-1258.223) (-1267.293) [-1267.787] * [-1259.655] (-1273.433) (-1274.540) (-1256.848) -- 0:01:16
      26000 -- (-1268.343) (-1257.404) (-1269.758) [-1265.190] * (-1261.679) (-1270.332) [-1266.214] (-1256.743) -- 0:01:14
      26500 -- (-1281.135) [-1257.857] (-1270.403) (-1273.648) * (-1263.521) [-1263.297] (-1274.031) (-1257.064) -- 0:01:13
      27000 -- (-1273.716) (-1256.442) [-1265.249] (-1262.993) * (-1263.183) (-1270.818) [-1264.314] (-1265.431) -- 0:01:12
      27500 -- (-1265.929) (-1257.263) (-1267.925) [-1269.018] * (-1262.177) (-1271.955) [-1266.980] (-1257.247) -- 0:01:10
      28000 -- (-1267.531) (-1257.585) [-1262.300] (-1271.747) * [-1261.270] (-1266.947) (-1264.000) (-1259.405) -- 0:01:09
      28500 -- (-1266.359) [-1258.956] (-1269.986) (-1269.784) * (-1259.571) [-1261.223] (-1267.812) (-1257.375) -- 0:01:08
      29000 -- (-1266.223) (-1257.465) (-1265.416) [-1267.460] * (-1261.700) (-1259.913) (-1271.699) [-1258.867] -- 0:01:06
      29500 -- (-1268.510) (-1259.810) (-1265.206) [-1272.543] * (-1267.472) [-1257.388] (-1262.498) (-1259.610) -- 0:01:05
      30000 -- (-1270.308) [-1257.867] (-1264.096) (-1270.353) * (-1261.620) [-1259.256] (-1268.597) (-1258.171) -- 0:01:04

      Average standard deviation of split frequencies: 0.047653

      30500 -- (-1266.993) (-1260.145) (-1264.864) [-1263.557] * (-1257.749) (-1256.747) [-1262.482] (-1257.890) -- 0:01:03
      31000 -- [-1263.466] (-1258.250) (-1265.077) (-1267.836) * (-1260.342) [-1256.101] (-1268.843) (-1256.186) -- 0:01:02
      31500 -- (-1265.653) [-1258.226] (-1270.827) (-1266.057) * (-1259.356) (-1256.770) (-1268.197) [-1256.160] -- 0:01:01
      32000 -- (-1269.647) (-1257.935) [-1264.512] (-1266.885) * [-1257.869] (-1257.993) (-1265.359) (-1256.747) -- 0:01:00
      32500 -- (-1269.374) [-1257.363] (-1267.961) (-1267.577) * (-1259.439) (-1256.700) [-1267.764] (-1258.956) -- 0:00:59
      33000 -- (-1263.851) (-1258.776) (-1271.642) [-1267.743] * (-1256.552) [-1257.621] (-1259.974) (-1258.210) -- 0:00:58
      33500 -- (-1268.506) (-1257.497) (-1264.414) [-1264.608] * (-1258.147) [-1256.711] (-1257.553) (-1258.014) -- 0:00:57
      34000 -- (-1278.530) (-1257.965) (-1266.266) [-1271.520] * (-1261.734) (-1258.270) [-1257.426] (-1256.592) -- 0:00:56
      34500 -- [-1269.219] (-1256.864) (-1268.695) (-1259.098) * (-1258.830) (-1258.915) (-1259.262) [-1257.075] -- 0:00:55
      35000 -- [-1267.028] (-1256.952) (-1262.269) (-1257.777) * (-1257.472) (-1257.388) (-1265.848) [-1257.724] -- 0:00:55

      Average standard deviation of split frequencies: 0.041903

      35500 -- (-1268.858) [-1258.234] (-1267.206) (-1257.803) * (-1258.096) (-1261.946) [-1266.371] (-1260.040) -- 0:00:54
      36000 -- (-1266.646) (-1258.968) [-1262.948] (-1258.122) * [-1258.296] (-1257.437) (-1261.154) (-1257.541) -- 0:00:53
      36500 -- (-1276.140) (-1259.029) (-1266.086) [-1258.671] * [-1259.876] (-1260.300) (-1261.895) (-1257.538) -- 0:00:52
      37000 -- (-1258.689) (-1259.042) (-1265.299) [-1257.842] * (-1257.376) (-1257.386) [-1258.355] (-1259.933) -- 0:00:52
      37500 -- (-1261.860) (-1260.554) (-1269.453) [-1257.691] * (-1258.595) (-1260.328) [-1257.365] (-1261.805) -- 0:00:51
      38000 -- (-1258.575) [-1261.053] (-1260.482) (-1258.165) * (-1258.531) [-1257.781] (-1256.796) (-1259.070) -- 0:00:50
      38500 -- (-1259.520) (-1264.478) [-1264.829] (-1260.545) * (-1260.619) (-1257.127) (-1256.410) [-1256.742] -- 0:00:49
      39000 -- (-1262.090) (-1257.792) [-1264.508] (-1259.902) * (-1262.040) [-1258.530] (-1258.243) (-1259.775) -- 0:00:49
      39500 -- [-1258.746] (-1256.428) (-1270.439) (-1259.550) * (-1260.875) (-1258.455) (-1258.876) [-1256.752] -- 0:00:48
      40000 -- (-1258.133) [-1257.628] (-1275.984) (-1258.745) * (-1256.789) [-1263.299] (-1257.722) (-1256.641) -- 0:00:48

      Average standard deviation of split frequencies: 0.039657

      40500 -- (-1256.417) (-1262.008) [-1269.935] (-1256.902) * (-1256.444) (-1257.299) (-1259.450) [-1256.932] -- 0:01:11
      41000 -- [-1257.372] (-1259.408) (-1266.363) (-1256.896) * [-1259.190] (-1257.023) (-1259.341) (-1260.723) -- 0:01:10
      41500 -- [-1256.396] (-1256.839) (-1272.917) (-1259.324) * (-1258.178) (-1259.016) (-1259.066) [-1257.673] -- 0:01:09
      42000 -- (-1256.434) (-1256.082) [-1269.034] (-1257.356) * [-1257.361] (-1257.939) (-1257.011) (-1256.812) -- 0:01:08
      42500 -- [-1257.867] (-1259.363) (-1270.489) (-1257.473) * (-1257.709) (-1262.975) (-1259.114) [-1256.021] -- 0:01:07
      43000 -- (-1259.259) (-1257.451) [-1270.705] (-1257.195) * (-1258.320) (-1261.994) [-1256.814] (-1259.148) -- 0:01:06
      43500 -- (-1257.538) (-1259.501) (-1268.005) [-1257.318] * (-1256.164) (-1261.086) [-1257.513] (-1257.442) -- 0:01:05
      44000 -- [-1258.973] (-1264.917) (-1267.906) (-1257.681) * (-1258.382) (-1260.378) (-1258.497) [-1256.199] -- 0:01:05
      44500 -- (-1257.829) [-1258.523] (-1270.836) (-1259.763) * (-1258.805) (-1257.900) (-1261.161) [-1257.559] -- 0:01:04
      45000 -- (-1257.802) [-1256.945] (-1267.172) (-1257.608) * [-1259.502] (-1259.797) (-1259.681) (-1256.670) -- 0:01:03

      Average standard deviation of split frequencies: 0.028881

      45500 -- (-1258.378) [-1256.706] (-1265.208) (-1257.756) * (-1261.999) (-1256.349) (-1258.455) [-1258.999] -- 0:01:02
      46000 -- (-1257.217) (-1260.236) [-1272.664] (-1256.084) * (-1257.108) [-1256.793] (-1258.568) (-1257.175) -- 0:01:02
      46500 -- (-1257.515) [-1262.171] (-1267.401) (-1258.407) * (-1258.552) (-1256.758) [-1256.617] (-1258.000) -- 0:01:01
      47000 -- (-1257.587) (-1258.137) (-1265.746) [-1258.958] * (-1262.902) (-1257.539) [-1257.204] (-1258.341) -- 0:01:00
      47500 -- (-1256.149) (-1258.566) (-1267.080) [-1257.300] * (-1262.566) [-1257.048] (-1256.784) (-1256.250) -- 0:01:00
      48000 -- (-1256.757) [-1257.545] (-1266.801) (-1256.183) * [-1261.063] (-1257.732) (-1258.040) (-1256.319) -- 0:00:59
      48500 -- [-1256.303] (-1257.786) (-1264.844) (-1256.340) * (-1261.587) (-1258.722) (-1259.111) [-1258.844] -- 0:00:58
      49000 -- (-1256.381) (-1257.185) [-1264.422] (-1256.235) * [-1257.133] (-1258.946) (-1261.682) (-1257.272) -- 0:00:58
      49500 -- (-1258.521) (-1260.765) (-1270.276) [-1259.854] * (-1256.886) (-1258.344) (-1263.773) [-1260.265] -- 0:00:57
      50000 -- [-1258.407] (-1263.182) (-1265.056) (-1260.142) * [-1259.223] (-1257.455) (-1258.255) (-1258.898) -- 0:00:57

      Average standard deviation of split frequencies: 0.029684

      50500 -- [-1258.417] (-1260.550) (-1269.609) (-1260.202) * (-1257.489) [-1258.878] (-1256.874) (-1262.812) -- 0:00:56
      51000 -- (-1258.828) (-1259.159) [-1265.858] (-1258.574) * (-1256.822) (-1258.788) (-1258.603) [-1258.324] -- 0:00:55
      51500 -- (-1259.565) (-1257.955) (-1266.614) [-1257.427] * (-1257.056) [-1256.735] (-1257.271) (-1258.101) -- 0:00:55
      52000 -- (-1259.282) (-1257.907) [-1261.699] (-1257.862) * [-1256.933] (-1256.714) (-1256.389) (-1258.050) -- 0:00:54
      52500 -- (-1258.720) [-1257.159] (-1267.232) (-1256.819) * (-1256.658) (-1256.516) (-1258.213) [-1257.760] -- 0:00:54
      53000 -- (-1257.908) [-1258.583] (-1271.151) (-1257.112) * (-1258.746) [-1256.854] (-1265.586) (-1259.838) -- 0:00:53
      53500 -- (-1262.016) [-1257.755] (-1277.102) (-1257.286) * (-1255.876) [-1257.255] (-1258.102) (-1258.065) -- 0:00:53
      54000 -- (-1260.052) [-1257.222] (-1271.343) (-1257.327) * (-1258.026) [-1257.059] (-1257.802) (-1265.156) -- 0:00:52
      54500 -- (-1257.880) [-1257.503] (-1268.540) (-1257.671) * (-1258.160) (-1256.825) [-1257.580] (-1260.408) -- 0:00:52
      55000 -- (-1257.894) [-1257.551] (-1266.199) (-1256.781) * (-1258.070) (-1257.143) [-1256.935] (-1258.294) -- 0:00:51

      Average standard deviation of split frequencies: 0.025721

      55500 -- (-1256.452) (-1257.778) (-1268.218) [-1258.742] * (-1259.269) (-1256.203) (-1256.721) [-1259.618] -- 0:00:51
      56000 -- (-1257.425) (-1258.367) (-1268.763) [-1258.743] * [-1266.463] (-1256.777) (-1256.562) (-1259.129) -- 0:00:50
      56500 -- (-1257.014) (-1257.001) (-1263.762) [-1259.144] * [-1257.937] (-1260.896) (-1257.177) (-1261.637) -- 0:01:06
      57000 -- (-1258.850) (-1256.495) (-1275.076) [-1259.964] * (-1257.564) [-1262.068] (-1257.460) (-1261.282) -- 0:01:06
      57500 -- (-1258.049) [-1259.197] (-1269.439) (-1257.836) * (-1257.675) [-1257.932] (-1260.080) (-1261.591) -- 0:01:05
      58000 -- (-1258.915) (-1261.516) (-1294.758) [-1257.203] * (-1257.897) (-1258.249) (-1257.130) [-1263.672] -- 0:01:04
      58500 -- [-1256.553] (-1262.766) (-1260.839) (-1256.879) * (-1257.104) (-1258.398) (-1258.853) [-1259.266] -- 0:01:04
      59000 -- [-1256.083] (-1258.027) (-1261.011) (-1259.713) * (-1256.521) (-1257.140) [-1260.612] (-1257.372) -- 0:01:03
      59500 -- (-1258.530) (-1257.718) (-1256.656) [-1257.412] * (-1257.715) (-1256.799) (-1263.969) [-1259.579] -- 0:01:03
      60000 -- [-1256.314] (-1256.505) (-1258.192) (-1258.639) * (-1257.715) (-1256.773) [-1258.892] (-1259.694) -- 0:01:02

      Average standard deviation of split frequencies: 0.024129

      60500 -- [-1259.578] (-1257.614) (-1258.174) (-1257.754) * [-1256.845] (-1258.194) (-1257.702) (-1258.448) -- 0:01:02
      61000 -- (-1256.541) (-1256.421) [-1257.794] (-1259.428) * (-1257.707) (-1263.091) (-1258.434) [-1258.118] -- 0:01:01
      61500 -- [-1257.441] (-1257.890) (-1256.705) (-1258.264) * (-1257.563) (-1257.651) [-1259.509] (-1257.465) -- 0:01:01
      62000 -- (-1264.446) (-1256.148) (-1259.135) [-1259.685] * [-1261.699] (-1257.686) (-1259.355) (-1257.408) -- 0:01:00
      62500 -- (-1264.492) [-1258.098] (-1259.141) (-1259.219) * (-1259.476) [-1260.594] (-1260.218) (-1256.927) -- 0:01:00
      63000 -- (-1264.207) [-1256.628] (-1258.362) (-1258.709) * (-1259.266) (-1257.075) [-1256.657] (-1258.544) -- 0:00:59
      63500 -- (-1258.502) (-1265.774) [-1259.089] (-1261.340) * [-1258.337] (-1257.196) (-1256.815) (-1258.388) -- 0:00:58
      64000 -- (-1259.735) [-1260.532] (-1257.658) (-1261.607) * [-1256.282] (-1257.907) (-1256.584) (-1256.255) -- 0:00:58
      64500 -- (-1257.478) (-1257.920) [-1256.273] (-1261.285) * (-1256.429) [-1257.480] (-1256.626) (-1257.390) -- 0:00:58
      65000 -- (-1259.279) [-1256.659] (-1256.820) (-1263.811) * (-1257.594) (-1256.997) [-1257.075] (-1256.532) -- 0:00:57

      Average standard deviation of split frequencies: 0.023468

      65500 -- [-1257.880] (-1260.993) (-1259.631) (-1258.622) * (-1258.074) (-1257.101) [-1256.625] (-1257.069) -- 0:00:57
      66000 -- [-1259.124] (-1256.555) (-1259.494) (-1257.111) * (-1259.144) (-1260.443) [-1257.256] (-1262.231) -- 0:00:56
      66500 -- (-1257.833) (-1258.415) (-1257.968) [-1259.294] * (-1259.621) (-1256.995) [-1259.074] (-1260.333) -- 0:00:56
      67000 -- (-1257.180) (-1260.011) [-1256.601] (-1260.121) * (-1260.127) (-1256.548) (-1259.933) [-1258.381] -- 0:00:55
      67500 -- (-1257.762) (-1259.928) (-1256.349) [-1259.085] * (-1258.150) [-1257.163] (-1258.459) (-1260.901) -- 0:00:55
      68000 -- (-1256.656) (-1257.728) (-1258.032) [-1259.350] * (-1258.326) [-1257.937] (-1256.927) (-1261.249) -- 0:00:54
      68500 -- [-1257.510] (-1256.477) (-1258.044) (-1257.291) * (-1258.495) (-1257.018) (-1256.874) [-1258.022] -- 0:00:54
      69000 -- (-1257.896) (-1256.094) (-1256.146) [-1257.020] * (-1260.301) (-1258.348) [-1259.349] (-1257.885) -- 0:00:53
      69500 -- (-1260.255) (-1258.434) [-1256.353] (-1259.112) * [-1258.627] (-1259.923) (-1260.958) (-1258.263) -- 0:00:53
      70000 -- [-1257.391] (-1257.490) (-1257.666) (-1258.836) * [-1257.118] (-1259.469) (-1261.492) (-1258.400) -- 0:00:53

      Average standard deviation of split frequencies: 0.021347

      70500 -- (-1256.666) (-1256.909) (-1259.548) [-1258.399] * (-1256.715) (-1261.411) (-1262.217) [-1258.956] -- 0:00:52
      71000 -- (-1256.394) (-1258.402) [-1257.951] (-1259.279) * (-1256.417) [-1258.550] (-1257.850) (-1261.397) -- 0:00:52
      71500 -- (-1259.119) [-1259.571] (-1258.052) (-1257.480) * (-1256.027) (-1260.065) [-1258.979] (-1260.810) -- 0:00:51
      72000 -- (-1257.250) (-1257.228) (-1258.347) [-1257.651] * (-1256.650) [-1258.968] (-1260.424) (-1260.810) -- 0:00:51
      72500 -- (-1256.107) (-1258.367) (-1258.471) [-1257.409] * (-1257.970) [-1258.028] (-1260.306) (-1257.386) -- 0:00:51
      73000 -- [-1256.423] (-1259.691) (-1257.194) (-1258.367) * (-1258.280) (-1256.945) (-1259.210) [-1257.770] -- 0:00:50
      73500 -- [-1256.606] (-1260.939) (-1256.551) (-1257.124) * (-1256.091) (-1257.913) [-1257.625] (-1256.532) -- 0:01:03
      74000 -- [-1261.572] (-1259.476) (-1256.542) (-1256.521) * (-1258.109) (-1259.689) (-1257.566) [-1256.945] -- 0:01:02
      74500 -- (-1262.016) (-1259.091) (-1256.967) [-1256.530] * (-1257.166) (-1258.285) (-1258.810) [-1258.249] -- 0:01:02
      75000 -- (-1256.534) (-1260.729) (-1256.973) [-1257.122] * [-1256.931] (-1260.907) (-1259.011) (-1261.874) -- 0:01:01

      Average standard deviation of split frequencies: 0.019849

      75500 -- (-1257.181) (-1257.771) [-1257.687] (-1256.821) * (-1257.030) [-1258.437] (-1256.663) (-1262.245) -- 0:01:01
      76000 -- (-1258.490) [-1257.657] (-1256.761) (-1256.821) * [-1257.382] (-1257.333) (-1257.624) (-1263.374) -- 0:01:00
      76500 -- [-1258.529] (-1257.753) (-1258.562) (-1258.522) * [-1261.384] (-1261.805) (-1257.011) (-1256.916) -- 0:01:00
      77000 -- (-1264.195) (-1258.909) [-1257.860] (-1258.422) * [-1259.471] (-1260.386) (-1257.723) (-1256.599) -- 0:00:59
      77500 -- (-1263.035) [-1256.758] (-1264.996) (-1257.861) * [-1257.243] (-1259.810) (-1260.336) (-1256.250) -- 0:00:59
      78000 -- (-1258.141) (-1257.898) (-1259.897) [-1259.809] * [-1257.245] (-1256.547) (-1258.483) (-1258.807) -- 0:00:59
      78500 -- (-1258.403) (-1257.893) (-1259.765) [-1258.204] * (-1257.244) [-1258.305] (-1257.197) (-1258.985) -- 0:00:58
      79000 -- [-1260.608] (-1256.754) (-1259.182) (-1258.022) * (-1257.357) (-1259.094) [-1258.800] (-1258.224) -- 0:00:58
      79500 -- (-1260.006) (-1257.580) (-1260.501) [-1257.259] * (-1258.038) (-1261.470) [-1258.685] (-1257.346) -- 0:00:57
      80000 -- (-1259.164) [-1258.768] (-1257.387) (-1259.817) * (-1261.833) (-1257.287) (-1260.594) [-1256.113] -- 0:00:57

      Average standard deviation of split frequencies: 0.020161

      80500 -- (-1265.320) (-1261.167) (-1258.573) [-1263.353] * (-1258.691) (-1257.273) [-1260.541] (-1256.245) -- 0:00:57
      81000 -- (-1261.296) (-1258.045) (-1261.931) [-1260.749] * (-1260.421) (-1257.372) (-1256.650) [-1256.326] -- 0:00:56
      81500 -- (-1263.371) [-1257.605] (-1260.206) (-1257.925) * (-1261.308) (-1258.079) (-1258.509) [-1257.540] -- 0:00:56
      82000 -- [-1264.193] (-1257.296) (-1258.294) (-1257.352) * (-1258.280) [-1258.248] (-1262.323) (-1256.906) -- 0:00:55
      82500 -- (-1257.994) (-1259.596) (-1257.031) [-1258.300] * (-1255.952) [-1259.569] (-1261.049) (-1262.606) -- 0:00:55
      83000 -- (-1258.762) (-1258.060) (-1259.417) [-1259.009] * (-1256.698) (-1261.221) (-1260.890) [-1259.214] -- 0:00:55
      83500 -- [-1257.972] (-1258.815) (-1257.294) (-1258.501) * (-1256.339) (-1258.829) (-1258.992) [-1259.625] -- 0:00:54
      84000 -- (-1258.581) (-1256.220) [-1256.392] (-1258.057) * [-1256.590] (-1258.421) (-1261.387) (-1258.272) -- 0:00:54
      84500 -- (-1259.752) (-1257.914) (-1258.513) [-1257.000] * (-1257.450) [-1257.557] (-1256.577) (-1257.482) -- 0:00:54
      85000 -- [-1262.231] (-1256.890) (-1263.591) (-1257.462) * (-1256.694) (-1257.070) [-1257.680] (-1258.949) -- 0:00:53

      Average standard deviation of split frequencies: 0.019316

      85500 -- (-1262.237) (-1257.707) [-1259.382] (-1260.193) * (-1256.228) [-1259.336] (-1257.281) (-1261.458) -- 0:00:53
      86000 -- [-1258.874] (-1257.605) (-1258.060) (-1256.469) * (-1258.033) [-1259.124] (-1257.107) (-1259.303) -- 0:00:53
      86500 -- (-1259.502) [-1258.222] (-1257.115) (-1256.066) * (-1258.563) (-1259.619) [-1256.370] (-1258.392) -- 0:00:52
      87000 -- [-1259.285] (-1257.081) (-1257.325) (-1256.024) * (-1257.563) [-1257.733] (-1256.374) (-1259.922) -- 0:00:52
      87500 -- [-1257.854] (-1257.952) (-1259.922) (-1256.024) * (-1257.701) (-1257.552) (-1256.268) [-1258.208] -- 0:00:52
      88000 -- (-1258.687) [-1258.371] (-1261.096) (-1259.908) * (-1257.554) (-1258.165) [-1256.631] (-1261.981) -- 0:00:51
      88500 -- (-1259.841) (-1262.998) (-1260.011) [-1257.243] * (-1260.191) (-1259.928) (-1256.326) [-1258.059] -- 0:00:51
      89000 -- (-1257.514) [-1261.196] (-1262.815) (-1257.386) * (-1257.301) [-1259.939] (-1256.964) (-1260.197) -- 0:00:51
      89500 -- (-1259.701) (-1257.956) (-1258.235) [-1256.802] * [-1257.378] (-1257.924) (-1256.935) (-1260.282) -- 0:00:50
      90000 -- (-1257.429) (-1262.070) [-1257.449] (-1257.708) * [-1258.322] (-1258.363) (-1256.692) (-1269.036) -- 0:01:00

      Average standard deviation of split frequencies: 0.018321

      90500 -- (-1259.957) [-1260.609] (-1257.657) (-1263.461) * (-1257.220) [-1257.450] (-1256.573) (-1259.828) -- 0:01:00
      91000 -- (-1256.764) [-1260.852] (-1257.337) (-1261.855) * [-1258.762] (-1260.552) (-1258.911) (-1260.294) -- 0:00:59
      91500 -- [-1257.439] (-1260.365) (-1260.156) (-1260.057) * (-1261.128) [-1258.392] (-1258.498) (-1265.854) -- 0:00:59
      92000 -- (-1257.080) (-1256.788) [-1256.524] (-1257.923) * [-1260.978] (-1259.579) (-1260.322) (-1267.124) -- 0:00:59
      92500 -- (-1261.650) (-1257.147) [-1260.612] (-1257.676) * (-1259.586) [-1259.167] (-1261.122) (-1261.413) -- 0:00:58
      93000 -- (-1260.501) (-1257.255) (-1260.019) [-1257.639] * (-1258.350) [-1259.863] (-1257.010) (-1257.589) -- 0:00:58
      93500 -- (-1263.279) (-1263.478) (-1259.097) [-1256.363] * (-1257.295) (-1261.024) [-1256.909] (-1256.058) -- 0:00:58
      94000 -- (-1268.065) (-1259.802) (-1260.756) [-1256.092] * (-1258.552) (-1265.378) [-1256.906] (-1257.874) -- 0:00:57
      94500 -- [-1258.536] (-1257.759) (-1259.119) (-1257.092) * (-1259.149) [-1258.294] (-1257.108) (-1256.978) -- 0:00:57
      95000 -- (-1257.675) (-1260.872) (-1257.006) [-1256.570] * [-1257.765] (-1258.286) (-1256.813) (-1256.929) -- 0:00:57

      Average standard deviation of split frequencies: 0.015959

      95500 -- [-1258.085] (-1257.471) (-1257.533) (-1256.656) * (-1257.166) (-1257.718) [-1259.728] (-1256.969) -- 0:00:56
      96000 -- (-1259.796) (-1257.355) [-1257.811] (-1256.895) * (-1257.355) [-1261.130] (-1259.499) (-1259.912) -- 0:00:56
      96500 -- (-1258.836) (-1263.849) (-1259.843) [-1258.092] * [-1258.755] (-1257.345) (-1259.498) (-1262.358) -- 0:00:56
      97000 -- (-1260.437) (-1258.220) (-1258.909) [-1257.918] * (-1260.982) (-1256.927) [-1255.920] (-1257.825) -- 0:00:55
      97500 -- (-1258.592) (-1258.461) [-1258.764] (-1258.325) * [-1258.091] (-1258.114) (-1255.930) (-1257.153) -- 0:00:55
      98000 -- [-1256.802] (-1256.906) (-1257.969) (-1257.918) * (-1257.760) [-1259.305] (-1258.433) (-1262.043) -- 0:00:55
      98500 -- [-1257.836] (-1256.949) (-1258.541) (-1263.410) * [-1262.185] (-1256.999) (-1256.168) (-1261.911) -- 0:00:54
      99000 -- [-1256.567] (-1257.408) (-1258.642) (-1260.174) * (-1259.258) (-1256.741) (-1256.258) [-1259.631] -- 0:00:54
      99500 -- (-1256.991) (-1258.645) [-1257.624] (-1257.715) * (-1259.686) (-1258.492) [-1256.919] (-1259.068) -- 0:00:54
      100000 -- (-1256.639) (-1256.464) (-1258.924) [-1257.027] * (-1258.694) (-1265.422) (-1256.479) [-1259.140] -- 0:00:54

      Average standard deviation of split frequencies: 0.017393

      100500 -- (-1256.532) (-1256.530) [-1259.027] (-1258.977) * (-1257.808) (-1261.136) [-1256.642] (-1256.983) -- 0:00:53
      101000 -- (-1258.499) [-1257.839] (-1259.565) (-1259.990) * [-1258.622] (-1259.497) (-1257.288) (-1256.431) -- 0:00:53
      101500 -- [-1261.270] (-1256.536) (-1260.426) (-1258.286) * [-1257.448] (-1258.920) (-1257.393) (-1258.418) -- 0:00:53
      102000 -- (-1260.423) (-1256.220) (-1260.872) [-1256.960] * (-1257.433) [-1258.368] (-1259.449) (-1258.784) -- 0:00:52
      102500 -- (-1258.992) (-1257.492) (-1258.872) [-1257.004] * (-1259.646) (-1259.025) [-1256.562] (-1260.055) -- 0:00:52
      103000 -- (-1259.006) (-1257.498) (-1256.377) [-1260.655] * (-1256.957) (-1257.509) (-1258.022) [-1258.480] -- 0:00:52
      103500 -- (-1263.077) (-1256.804) (-1256.699) [-1259.443] * [-1256.775] (-1260.288) (-1259.891) (-1264.399) -- 0:00:51
      104000 -- (-1260.773) [-1258.657] (-1257.024) (-1260.880) * (-1256.844) [-1259.939] (-1262.166) (-1258.276) -- 0:00:51
      104500 -- (-1261.907) [-1260.637] (-1256.064) (-1260.638) * (-1259.481) (-1260.968) (-1260.630) [-1256.804] -- 0:00:51
      105000 -- [-1260.665] (-1259.566) (-1257.345) (-1256.941) * [-1259.286] (-1260.370) (-1262.298) (-1258.720) -- 0:00:51

      Average standard deviation of split frequencies: 0.019406

      105500 -- (-1260.501) (-1258.626) [-1258.480] (-1256.987) * (-1257.523) (-1262.656) [-1261.513] (-1259.323) -- 0:00:50
      106000 -- [-1257.004] (-1257.912) (-1256.259) (-1256.933) * [-1256.508] (-1257.944) (-1260.558) (-1257.753) -- 0:00:59
      106500 -- [-1261.581] (-1258.919) (-1258.868) (-1256.352) * (-1257.201) [-1256.982] (-1258.302) (-1258.640) -- 0:00:58
      107000 -- (-1261.505) (-1259.512) [-1257.848] (-1258.995) * (-1256.735) (-1256.825) [-1262.205] (-1256.969) -- 0:00:58
      107500 -- (-1261.033) [-1262.115] (-1258.039) (-1260.013) * (-1256.488) (-1257.002) [-1258.192] (-1257.234) -- 0:00:58
      108000 -- (-1262.331) [-1260.408] (-1258.163) (-1257.754) * (-1256.682) [-1258.514] (-1257.160) (-1257.799) -- 0:00:57
      108500 -- (-1262.668) (-1258.558) (-1258.159) [-1259.367] * (-1258.078) (-1260.048) (-1257.390) [-1257.658] -- 0:00:57
      109000 -- (-1257.443) [-1257.888] (-1257.906) (-1262.099) * [-1257.149] (-1259.537) (-1257.605) (-1257.963) -- 0:00:57
      109500 -- [-1257.708] (-1260.888) (-1256.849) (-1266.422) * (-1256.650) (-1259.994) (-1257.944) [-1258.114] -- 0:00:56
      110000 -- (-1257.990) (-1258.386) [-1257.535] (-1260.679) * [-1256.086] (-1259.980) (-1258.539) (-1256.960) -- 0:00:56

      Average standard deviation of split frequencies: 0.017232

      110500 -- (-1258.727) (-1257.775) [-1257.117] (-1260.560) * (-1257.868) (-1259.210) [-1257.912] (-1260.381) -- 0:00:56
      111000 -- (-1261.931) (-1259.335) (-1258.792) [-1257.251] * [-1258.980] (-1259.370) (-1258.901) (-1256.919) -- 0:00:56
      111500 -- (-1260.018) (-1259.803) (-1257.574) [-1260.690] * (-1256.402) (-1257.528) (-1258.690) [-1261.674] -- 0:00:55
      112000 -- (-1262.273) [-1259.456] (-1259.368) (-1260.807) * (-1258.547) (-1256.506) (-1256.646) [-1261.264] -- 0:00:55
      112500 -- (-1260.376) (-1257.496) [-1259.355] (-1258.626) * (-1258.590) (-1257.236) [-1261.303] (-1266.589) -- 0:00:55
      113000 -- (-1258.280) (-1261.208) [-1259.626] (-1260.283) * (-1259.224) (-1256.988) (-1259.864) [-1256.812] -- 0:00:54
      113500 -- [-1256.864] (-1261.328) (-1258.185) (-1258.322) * (-1260.136) (-1257.002) (-1261.633) [-1256.793] -- 0:00:54
      114000 -- (-1258.229) (-1259.344) [-1259.002] (-1257.648) * [-1258.687] (-1256.473) (-1261.020) (-1256.772) -- 0:00:54
      114500 -- (-1257.757) (-1258.439) [-1259.594] (-1260.072) * (-1259.070) (-1256.364) [-1260.931] (-1257.668) -- 0:00:54
      115000 -- (-1257.362) (-1256.982) (-1256.014) [-1258.144] * [-1260.105] (-1259.355) (-1258.549) (-1257.188) -- 0:00:53

      Average standard deviation of split frequencies: 0.018771

      115500 -- (-1259.978) [-1257.516] (-1258.151) (-1259.880) * (-1265.869) [-1261.925] (-1256.799) (-1258.523) -- 0:00:53
      116000 -- [-1257.756] (-1258.459) (-1258.069) (-1257.328) * (-1263.916) [-1256.585] (-1262.906) (-1256.831) -- 0:00:53
      116500 -- (-1256.295) (-1259.284) (-1257.469) [-1258.215] * (-1260.273) [-1257.757] (-1260.938) (-1259.289) -- 0:00:53
      117000 -- (-1256.411) (-1258.628) [-1261.999] (-1257.239) * (-1260.388) [-1258.166] (-1260.378) (-1258.906) -- 0:00:52
      117500 -- (-1256.377) (-1256.942) (-1260.952) [-1257.865] * (-1260.062) [-1258.052] (-1260.561) (-1259.942) -- 0:00:52
      118000 -- [-1257.954] (-1257.621) (-1260.949) (-1257.404) * (-1260.757) [-1260.314] (-1258.660) (-1259.725) -- 0:00:52
      118500 -- (-1259.218) (-1257.302) (-1262.179) [-1260.178] * (-1260.167) (-1257.614) [-1257.110] (-1261.426) -- 0:00:52
      119000 -- (-1258.137) [-1260.280] (-1257.904) (-1259.804) * [-1258.372] (-1258.939) (-1257.292) (-1257.837) -- 0:00:51
      119500 -- (-1256.889) (-1258.396) [-1259.998] (-1258.621) * (-1258.942) (-1259.762) [-1257.831] (-1256.862) -- 0:00:51
      120000 -- [-1257.529] (-1258.142) (-1257.892) (-1267.433) * (-1260.099) (-1260.802) (-1260.140) [-1258.174] -- 0:00:51

      Average standard deviation of split frequencies: 0.019924

      120500 -- [-1257.320] (-1257.996) (-1259.081) (-1260.277) * (-1257.652) (-1261.044) [-1259.074] (-1259.931) -- 0:00:51
      121000 -- [-1257.127] (-1258.387) (-1258.515) (-1257.745) * (-1259.361) (-1259.502) (-1259.672) [-1257.440] -- 0:00:50
      121500 -- (-1257.305) (-1258.455) [-1257.389] (-1262.302) * (-1256.700) [-1257.163] (-1259.386) (-1260.826) -- 0:00:57
      122000 -- [-1257.366] (-1257.340) (-1257.370) (-1258.029) * (-1258.254) (-1257.062) (-1259.374) [-1257.782] -- 0:00:57
      122500 -- (-1258.603) (-1256.798) (-1257.213) [-1258.042] * (-1258.610) (-1258.786) [-1256.773] (-1260.547) -- 0:00:57
      123000 -- [-1259.518] (-1261.258) (-1257.156) (-1257.682) * (-1259.429) [-1257.782] (-1259.807) (-1256.842) -- 0:00:57
      123500 -- (-1259.573) (-1259.040) [-1256.227] (-1257.780) * [-1257.062] (-1258.260) (-1258.461) (-1259.749) -- 0:00:56
      124000 -- (-1257.217) [-1257.390] (-1261.843) (-1257.399) * [-1256.948] (-1262.691) (-1257.281) (-1259.122) -- 0:00:56
      124500 -- [-1257.212] (-1259.982) (-1265.524) (-1258.398) * (-1257.262) (-1259.801) (-1260.350) [-1260.020] -- 0:00:56
      125000 -- (-1256.589) (-1257.791) (-1260.176) [-1260.919] * (-1259.506) [-1257.719] (-1263.581) (-1258.867) -- 0:00:56

      Average standard deviation of split frequencies: 0.021598

      125500 -- (-1257.068) (-1258.455) (-1258.422) [-1258.502] * (-1257.498) (-1258.816) [-1258.866] (-1258.020) -- 0:00:55
      126000 -- [-1256.851] (-1259.485) (-1257.810) (-1260.956) * (-1257.933) (-1258.661) [-1256.682] (-1258.022) -- 0:00:55
      126500 -- (-1260.648) (-1261.705) [-1256.990] (-1259.119) * (-1256.296) (-1263.874) (-1256.605) [-1262.865] -- 0:00:55
      127000 -- (-1259.850) (-1260.024) (-1256.944) [-1257.376] * [-1255.996] (-1257.597) (-1258.875) (-1259.118) -- 0:00:54
      127500 -- (-1256.842) (-1261.374) (-1256.631) [-1258.125] * [-1257.455] (-1259.003) (-1262.029) (-1259.105) -- 0:00:54
      128000 -- (-1257.298) (-1257.567) [-1258.318] (-1256.496) * (-1259.393) [-1260.642] (-1265.750) (-1257.135) -- 0:00:54
      128500 -- [-1257.893] (-1258.036) (-1257.349) (-1257.499) * (-1259.683) [-1257.909] (-1258.833) (-1257.358) -- 0:00:54
      129000 -- (-1257.816) (-1259.485) [-1256.578] (-1257.730) * (-1258.638) (-1257.083) (-1258.962) [-1257.473] -- 0:00:54
      129500 -- (-1260.377) (-1258.967) [-1258.235] (-1256.452) * (-1261.743) (-1257.386) [-1261.221] (-1257.852) -- 0:00:53
      130000 -- [-1256.760] (-1257.411) (-1259.726) (-1256.987) * (-1257.778) [-1256.643] (-1258.861) (-1257.178) -- 0:00:53

      Average standard deviation of split frequencies: 0.024713

      130500 -- [-1256.457] (-1257.222) (-1258.486) (-1258.513) * (-1257.415) (-1256.762) [-1258.913] (-1257.335) -- 0:00:53
      131000 -- (-1258.879) (-1263.066) (-1263.870) [-1260.117] * (-1256.853) (-1259.428) [-1256.776] (-1258.802) -- 0:00:53
      131500 -- (-1260.460) (-1264.348) (-1262.725) [-1259.248] * (-1256.143) (-1260.271) [-1257.332] (-1261.040) -- 0:00:52
      132000 -- (-1258.159) (-1260.843) [-1261.549] (-1257.161) * (-1257.425) (-1261.518) [-1261.383] (-1258.088) -- 0:00:52
      132500 -- [-1257.199] (-1260.484) (-1259.629) (-1256.231) * [-1256.256] (-1260.653) (-1256.900) (-1258.517) -- 0:00:52
      133000 -- (-1257.819) [-1260.007] (-1256.340) (-1259.059) * (-1256.634) (-1260.569) [-1257.164] (-1263.146) -- 0:00:52
      133500 -- (-1258.476) [-1257.481] (-1256.254) (-1257.926) * (-1256.754) (-1259.326) [-1257.793] (-1257.489) -- 0:00:51
      134000 -- (-1260.286) (-1261.134) (-1256.850) [-1257.771] * (-1257.264) (-1258.575) [-1257.650] (-1257.877) -- 0:00:51
      134500 -- [-1257.777] (-1258.097) (-1256.993) (-1260.272) * (-1259.023) (-1263.381) [-1256.694] (-1259.209) -- 0:00:51
      135000 -- (-1257.780) (-1260.844) [-1256.966] (-1257.156) * (-1256.433) (-1266.413) [-1257.290] (-1259.304) -- 0:00:51

      Average standard deviation of split frequencies: 0.025997

      135500 -- (-1258.176) (-1256.827) [-1259.391] (-1261.151) * (-1257.306) (-1260.635) [-1257.845] (-1258.396) -- 0:00:51
      136000 -- (-1258.376) (-1257.532) [-1259.871] (-1260.297) * (-1256.966) (-1259.315) [-1259.299] (-1259.557) -- 0:00:50
      136500 -- (-1257.039) (-1267.631) (-1260.721) [-1258.557] * (-1256.642) (-1259.647) [-1259.100] (-1259.806) -- 0:00:50
      137000 -- (-1257.039) [-1257.945] (-1262.128) (-1257.990) * (-1257.836) (-1258.771) [-1260.735] (-1258.614) -- 0:00:56
      137500 -- (-1257.626) [-1256.689] (-1262.783) (-1259.157) * (-1257.183) (-1259.756) (-1256.038) [-1259.135] -- 0:00:56
      138000 -- (-1258.694) [-1258.877] (-1258.048) (-1263.758) * (-1259.801) (-1258.499) (-1257.702) [-1260.343] -- 0:00:56
      138500 -- (-1258.689) [-1257.354] (-1256.650) (-1258.278) * (-1265.155) (-1256.550) (-1259.836) [-1259.019] -- 0:00:55
      139000 -- (-1258.336) (-1258.103) [-1256.605] (-1263.995) * (-1264.039) (-1260.934) (-1257.247) [-1259.323] -- 0:00:55
      139500 -- (-1258.397) (-1258.131) [-1257.798] (-1260.552) * (-1261.185) [-1258.610] (-1259.163) (-1257.177) -- 0:00:55
      140000 -- (-1260.373) (-1259.094) (-1258.312) [-1259.595] * (-1261.538) [-1256.989] (-1260.133) (-1257.919) -- 0:00:55

      Average standard deviation of split frequencies: 0.021950

      140500 -- (-1259.721) (-1257.447) (-1258.007) [-1257.089] * (-1257.806) (-1256.875) [-1259.592] (-1261.176) -- 0:00:55
      141000 -- (-1259.646) (-1257.412) (-1257.121) [-1257.111] * (-1257.920) (-1256.875) (-1259.621) [-1257.746] -- 0:00:54
      141500 -- (-1267.673) [-1260.248] (-1257.453) (-1257.574) * (-1256.620) (-1257.736) (-1257.873) [-1257.297] -- 0:00:54
      142000 -- (-1264.014) [-1257.693] (-1256.854) (-1258.401) * [-1256.535] (-1256.878) (-1258.663) (-1257.829) -- 0:00:54
      142500 -- (-1259.740) (-1258.880) (-1257.256) [-1256.870] * [-1256.592] (-1260.167) (-1258.650) (-1257.890) -- 0:00:54
      143000 -- (-1259.283) (-1257.922) (-1258.026) [-1256.623] * (-1256.817) (-1264.945) (-1258.926) [-1259.157] -- 0:00:53
      143500 -- (-1257.683) (-1258.901) (-1257.956) [-1257.109] * (-1257.008) [-1261.913] (-1257.627) (-1258.314) -- 0:00:53
      144000 -- [-1259.359] (-1258.263) (-1260.937) (-1255.929) * [-1257.315] (-1258.255) (-1260.533) (-1256.879) -- 0:00:53
      144500 -- (-1259.779) (-1258.107) [-1258.720] (-1257.571) * (-1257.512) [-1256.673] (-1259.609) (-1261.992) -- 0:00:53
      145000 -- (-1262.502) [-1258.185] (-1261.592) (-1256.064) * (-1263.248) [-1257.313] (-1262.653) (-1260.461) -- 0:00:53

      Average standard deviation of split frequencies: 0.020449

      145500 -- [-1260.036] (-1256.428) (-1260.936) (-1256.372) * [-1258.686] (-1257.196) (-1262.452) (-1267.270) -- 0:00:52
      146000 -- [-1258.501] (-1258.014) (-1257.637) (-1255.945) * (-1258.355) (-1257.611) [-1257.071] (-1261.879) -- 0:00:52
      146500 -- (-1259.683) (-1259.935) (-1256.597) [-1257.726] * [-1257.444] (-1258.216) (-1257.703) (-1266.884) -- 0:00:52
      147000 -- (-1259.751) [-1259.333] (-1256.840) (-1265.358) * (-1259.166) [-1257.322] (-1261.712) (-1266.471) -- 0:00:52
      147500 -- (-1257.904) (-1256.926) [-1257.926] (-1262.029) * (-1260.043) [-1257.301] (-1258.153) (-1265.951) -- 0:00:52
      148000 -- [-1257.867] (-1256.252) (-1257.686) (-1259.748) * (-1259.310) (-1258.385) (-1257.755) [-1262.118] -- 0:00:51
      148500 -- [-1258.104] (-1256.809) (-1261.770) (-1257.041) * (-1257.160) (-1257.712) [-1258.626] (-1256.467) -- 0:00:51
      149000 -- (-1257.491) (-1256.401) (-1260.615) [-1257.138] * (-1259.150) [-1258.217] (-1258.264) (-1258.130) -- 0:00:51
      149500 -- [-1257.396] (-1258.265) (-1256.470) (-1259.068) * [-1258.371] (-1260.355) (-1256.286) (-1259.811) -- 0:00:51
      150000 -- [-1256.449] (-1259.683) (-1257.414) (-1257.137) * (-1257.737) [-1260.638] (-1259.257) (-1259.924) -- 0:00:51

      Average standard deviation of split frequencies: 0.020749

      150500 -- (-1258.320) (-1257.842) (-1262.804) [-1257.235] * (-1258.071) [-1258.675] (-1261.102) (-1258.623) -- 0:00:50
      151000 -- [-1258.018] (-1258.676) (-1261.743) (-1257.915) * (-1256.419) (-1258.187) (-1261.433) [-1259.641] -- 0:00:50
      151500 -- (-1256.956) [-1256.790] (-1261.317) (-1259.408) * (-1256.852) (-1259.764) (-1257.814) [-1258.938] -- 0:00:50
      152000 -- (-1256.858) (-1258.506) [-1257.629] (-1258.826) * (-1258.038) [-1256.515] (-1257.048) (-1260.511) -- 0:00:50
      152500 -- (-1260.420) [-1257.407] (-1257.932) (-1257.620) * (-1257.709) [-1255.939] (-1257.132) (-1258.818) -- 0:00:55
      153000 -- (-1260.497) (-1260.378) (-1257.849) [-1257.308] * (-1258.377) (-1257.703) [-1257.814] (-1259.192) -- 0:00:55
      153500 -- (-1260.467) [-1259.010] (-1257.227) (-1258.853) * (-1260.711) (-1260.564) (-1259.232) [-1258.132] -- 0:00:55
      154000 -- [-1258.524] (-1260.156) (-1256.987) (-1263.710) * (-1257.152) (-1261.572) (-1261.567) [-1260.414] -- 0:00:54
      154500 -- [-1259.240] (-1257.408) (-1260.025) (-1262.135) * (-1257.801) (-1259.267) (-1262.502) [-1260.559] -- 0:00:54
      155000 -- (-1260.710) (-1257.276) [-1257.928] (-1257.849) * (-1258.817) [-1257.115] (-1257.483) (-1261.119) -- 0:00:54

      Average standard deviation of split frequencies: 0.018608

      155500 -- (-1260.752) [-1262.355] (-1259.817) (-1257.902) * [-1256.034] (-1259.280) (-1259.786) (-1258.198) -- 0:00:54
      156000 -- [-1259.571] (-1259.192) (-1256.966) (-1260.057) * (-1258.262) (-1263.816) [-1258.156] (-1256.961) -- 0:00:54
      156500 -- (-1258.447) [-1259.884] (-1258.617) (-1259.178) * (-1260.216) (-1256.554) (-1257.663) [-1256.864] -- 0:00:53
      157000 -- [-1258.257] (-1259.371) (-1256.644) (-1257.774) * (-1260.481) [-1257.244] (-1257.295) (-1256.650) -- 0:00:53
      157500 -- (-1259.253) [-1257.316] (-1256.320) (-1258.743) * (-1261.164) [-1259.385] (-1261.395) (-1259.367) -- 0:00:53
      158000 -- (-1257.085) (-1258.067) (-1256.320) [-1258.704] * (-1259.026) [-1262.751] (-1258.585) (-1257.765) -- 0:00:53
      158500 -- (-1256.891) [-1257.774] (-1257.442) (-1263.230) * (-1258.546) [-1258.489] (-1261.130) (-1260.698) -- 0:00:53
      159000 -- (-1257.531) (-1258.975) [-1257.371] (-1262.231) * (-1261.742) [-1257.018] (-1260.564) (-1259.190) -- 0:00:52
      159500 -- [-1257.502] (-1259.891) (-1258.299) (-1258.398) * [-1258.622] (-1257.670) (-1259.885) (-1265.714) -- 0:00:52
      160000 -- (-1260.869) (-1257.663) (-1258.705) [-1257.783] * [-1257.041] (-1260.095) (-1259.903) (-1261.866) -- 0:00:52

      Average standard deviation of split frequencies: 0.016369

      160500 -- [-1258.274] (-1257.667) (-1261.517) (-1257.176) * (-1259.616) (-1259.611) (-1262.794) [-1261.953] -- 0:00:52
      161000 -- (-1258.898) [-1256.909] (-1261.958) (-1256.847) * [-1257.028] (-1256.659) (-1261.833) (-1257.703) -- 0:00:52
      161500 -- (-1257.634) (-1257.387) [-1265.461] (-1259.371) * (-1259.726) [-1256.527] (-1261.437) (-1259.957) -- 0:00:51
      162000 -- (-1256.381) [-1258.204] (-1263.918) (-1256.967) * [-1256.242] (-1257.311) (-1258.553) (-1258.943) -- 0:00:51
      162500 -- (-1256.643) [-1258.409] (-1263.981) (-1258.632) * (-1258.709) (-1256.506) [-1257.940] (-1258.668) -- 0:00:51
      163000 -- (-1256.642) (-1257.530) (-1257.252) [-1256.703] * [-1258.028] (-1257.792) (-1258.171) (-1258.524) -- 0:00:51
      163500 -- [-1257.725] (-1261.501) (-1258.753) (-1259.662) * (-1259.439) (-1258.729) (-1258.791) [-1256.860] -- 0:00:51
      164000 -- [-1258.658] (-1259.023) (-1257.321) (-1259.845) * (-1257.922) (-1256.478) (-1258.791) [-1262.542] -- 0:00:50
      164500 -- (-1263.822) (-1258.560) [-1256.836] (-1257.357) * (-1256.938) (-1256.448) (-1257.724) [-1256.908] -- 0:00:50
      165000 -- (-1258.200) (-1256.052) [-1256.955] (-1257.279) * [-1258.653] (-1257.964) (-1258.026) (-1257.465) -- 0:00:50

      Average standard deviation of split frequencies: 0.017039

      165500 -- (-1257.716) [-1256.164] (-1260.523) (-1261.383) * (-1256.866) (-1258.345) (-1256.745) [-1259.266] -- 0:00:50
      166000 -- [-1258.159] (-1256.632) (-1260.757) (-1261.235) * (-1256.218) [-1256.564] (-1258.593) (-1260.425) -- 0:00:50
      166500 -- (-1257.539) (-1256.791) [-1257.064] (-1258.394) * (-1256.490) (-1256.538) [-1257.520] (-1261.412) -- 0:00:50
      167000 -- (-1257.688) [-1257.092] (-1256.974) (-1258.215) * (-1256.711) (-1258.364) (-1258.935) [-1257.869] -- 0:00:49
      167500 -- [-1258.532] (-1257.628) (-1257.821) (-1261.835) * (-1258.450) (-1258.693) (-1260.733) [-1257.271] -- 0:00:49
      168000 -- [-1257.447] (-1262.370) (-1257.895) (-1260.640) * (-1259.536) [-1258.139] (-1261.243) (-1256.395) -- 0:00:49
      168500 -- (-1260.608) [-1256.347] (-1256.893) (-1259.602) * (-1259.097) [-1260.711] (-1258.351) (-1256.551) -- 0:00:49
      169000 -- (-1258.637) (-1256.676) (-1256.868) [-1258.313] * (-1259.366) [-1258.784] (-1262.978) (-1257.344) -- 0:00:54
      169500 -- (-1260.398) (-1257.095) [-1256.207] (-1259.336) * (-1260.811) (-1259.304) (-1256.879) [-1256.370] -- 0:00:53
      170000 -- (-1258.119) [-1256.560] (-1256.082) (-1257.959) * (-1262.690) (-1258.746) [-1258.081] (-1256.789) -- 0:00:53

      Average standard deviation of split frequencies: 0.016427

      170500 -- [-1258.434] (-1257.009) (-1256.475) (-1258.324) * (-1260.599) [-1259.442] (-1257.694) (-1258.563) -- 0:00:53
      171000 -- (-1261.292) [-1256.739] (-1258.911) (-1262.967) * (-1260.662) (-1261.694) [-1257.788] (-1262.325) -- 0:00:53
      171500 -- (-1258.267) [-1256.843] (-1256.359) (-1256.927) * (-1258.381) [-1260.101] (-1257.815) (-1259.058) -- 0:00:53
      172000 -- (-1256.548) (-1257.334) (-1260.404) [-1258.094] * (-1258.858) (-1257.932) [-1256.750] (-1259.779) -- 0:00:52
      172500 -- [-1256.854] (-1257.421) (-1256.188) (-1260.783) * (-1259.368) (-1261.694) (-1255.979) [-1256.942] -- 0:00:52
      173000 -- (-1259.945) (-1261.049) [-1257.362] (-1260.383) * (-1257.854) (-1260.322) [-1258.457] (-1257.684) -- 0:00:52
      173500 -- (-1258.213) (-1258.556) [-1256.108] (-1258.408) * (-1257.648) (-1258.270) [-1258.796] (-1258.941) -- 0:00:52
      174000 -- [-1257.354] (-1257.985) (-1256.480) (-1259.713) * (-1257.667) (-1259.903) (-1257.349) [-1256.559] -- 0:00:52
      174500 -- (-1261.125) (-1257.938) [-1257.922] (-1259.340) * (-1258.386) (-1256.520) (-1260.093) [-1257.311] -- 0:00:52
      175000 -- (-1257.913) (-1257.896) (-1257.409) [-1258.045] * (-1256.314) (-1258.014) (-1263.042) [-1258.317] -- 0:00:51

      Average standard deviation of split frequencies: 0.017198

      175500 -- (-1260.452) (-1259.302) [-1259.315] (-1257.131) * (-1257.022) (-1256.884) (-1258.713) [-1257.115] -- 0:00:51
      176000 -- (-1257.530) (-1258.950) (-1257.316) [-1257.316] * (-1256.793) (-1258.035) (-1258.475) [-1258.036] -- 0:00:51
      176500 -- (-1259.900) (-1259.041) [-1256.122] (-1257.357) * [-1256.399] (-1258.870) (-1257.969) (-1256.595) -- 0:00:51
      177000 -- (-1258.620) (-1256.539) [-1257.714] (-1258.103) * (-1259.632) (-1258.024) [-1258.311] (-1256.423) -- 0:00:51
      177500 -- [-1259.838] (-1256.759) (-1256.832) (-1257.129) * (-1258.334) [-1257.922] (-1258.417) (-1257.586) -- 0:00:50
      178000 -- (-1257.866) (-1258.355) [-1259.834] (-1259.129) * (-1258.733) [-1258.526] (-1257.664) (-1260.860) -- 0:00:50
      178500 -- (-1263.267) [-1256.651] (-1261.177) (-1257.354) * [-1259.452] (-1257.337) (-1260.058) (-1261.330) -- 0:00:50
      179000 -- (-1257.566) (-1257.898) [-1260.910] (-1257.595) * (-1263.344) (-1257.767) [-1257.487] (-1259.458) -- 0:00:50
      179500 -- [-1256.946] (-1256.933) (-1259.906) (-1258.314) * (-1261.625) (-1257.648) (-1257.039) [-1260.486] -- 0:00:50
      180000 -- (-1256.905) (-1256.495) [-1258.279] (-1256.427) * (-1256.102) (-1258.100) [-1256.914] (-1259.794) -- 0:00:50

      Average standard deviation of split frequencies: 0.018265

      180500 -- (-1257.617) (-1256.060) [-1258.253] (-1256.673) * (-1257.618) (-1256.943) [-1258.981] (-1259.961) -- 0:00:49
      181000 -- [-1257.492] (-1256.105) (-1257.190) (-1259.198) * (-1256.910) (-1256.795) [-1257.725] (-1256.752) -- 0:00:49
      181500 -- [-1257.853] (-1257.717) (-1256.407) (-1260.201) * (-1258.554) (-1257.172) [-1258.140] (-1259.949) -- 0:00:49
      182000 -- (-1257.336) (-1256.601) [-1256.407] (-1257.514) * (-1258.376) [-1256.250] (-1259.479) (-1260.096) -- 0:00:49
      182500 -- (-1259.471) (-1256.621) (-1259.283) [-1260.189] * (-1260.121) (-1256.266) (-1258.514) [-1259.320] -- 0:00:49
      183000 -- (-1257.191) [-1257.225] (-1257.914) (-1259.987) * [-1257.236] (-1256.963) (-1259.208) (-1258.581) -- 0:00:49
      183500 -- (-1257.124) (-1259.338) (-1259.856) [-1258.942] * (-1257.684) [-1259.877] (-1258.857) (-1258.023) -- 0:00:48
      184000 -- (-1260.182) (-1258.261) (-1259.030) [-1256.877] * [-1255.888] (-1261.519) (-1261.288) (-1260.502) -- 0:00:48
      184500 -- [-1258.525] (-1256.926) (-1259.105) (-1256.228) * [-1255.908] (-1260.008) (-1260.230) (-1259.271) -- 0:00:48
      185000 -- [-1257.207] (-1260.688) (-1257.131) (-1258.183) * (-1255.928) (-1260.332) [-1256.994] (-1257.067) -- 0:00:52

      Average standard deviation of split frequencies: 0.018628

      185500 -- (-1257.102) [-1259.165] (-1257.953) (-1258.282) * (-1256.807) (-1257.906) [-1257.246] (-1256.397) -- 0:00:52
      186000 -- [-1257.063] (-1259.010) (-1257.627) (-1258.228) * (-1256.086) (-1257.595) (-1257.604) [-1256.393] -- 0:00:52
      186500 -- (-1257.269) (-1257.522) (-1261.622) [-1256.413] * (-1256.666) [-1257.810] (-1258.024) (-1256.218) -- 0:00:52
      187000 -- (-1256.931) (-1259.020) (-1260.743) [-1258.259] * (-1256.415) (-1258.232) [-1257.342] (-1257.440) -- 0:00:52
      187500 -- [-1257.339] (-1258.382) (-1259.095) (-1257.943) * (-1256.414) [-1257.300] (-1257.012) (-1256.964) -- 0:00:52
      188000 -- [-1258.437] (-1259.204) (-1258.158) (-1256.044) * (-1257.959) (-1258.056) [-1259.088] (-1256.791) -- 0:00:51
      188500 -- (-1259.218) (-1257.038) (-1258.948) [-1256.654] * [-1258.715] (-1259.216) (-1256.606) (-1258.124) -- 0:00:51
      189000 -- (-1263.980) (-1257.801) [-1258.351] (-1257.649) * [-1258.484] (-1259.669) (-1256.706) (-1257.016) -- 0:00:51
      189500 -- [-1259.016] (-1256.143) (-1260.029) (-1258.065) * (-1258.015) (-1260.013) (-1260.827) [-1256.662] -- 0:00:51
      190000 -- (-1258.409) (-1257.467) [-1257.590] (-1260.396) * (-1257.056) [-1260.947] (-1258.535) (-1256.483) -- 0:00:51

      Average standard deviation of split frequencies: 0.018680

      190500 -- (-1258.948) (-1257.677) [-1258.211] (-1258.555) * (-1258.753) (-1258.594) (-1259.526) [-1258.747] -- 0:00:50
      191000 -- (-1260.323) (-1258.739) (-1260.247) [-1257.876] * [-1258.682] (-1257.500) (-1256.373) (-1257.571) -- 0:00:50
      191500 -- (-1260.026) (-1260.340) [-1258.702] (-1256.523) * (-1257.766) (-1257.839) [-1256.463] (-1257.031) -- 0:00:50
      192000 -- (-1257.651) [-1258.815] (-1263.236) (-1256.176) * (-1256.985) (-1257.851) (-1256.674) [-1257.288] -- 0:00:50
      192500 -- (-1258.868) (-1258.439) [-1258.750] (-1258.747) * [-1258.204] (-1257.789) (-1256.674) (-1258.120) -- 0:00:50
      193000 -- (-1260.428) (-1260.281) (-1258.545) [-1260.293] * [-1260.371] (-1257.054) (-1255.988) (-1259.764) -- 0:00:50
      193500 -- (-1257.815) [-1260.517] (-1258.245) (-1258.059) * (-1258.973) (-1260.117) [-1256.013] (-1257.328) -- 0:00:50
      194000 -- (-1257.508) (-1257.234) (-1259.040) [-1256.537] * (-1259.214) (-1262.912) (-1260.832) [-1256.926] -- 0:00:49
      194500 -- (-1257.604) (-1263.217) [-1261.637] (-1258.294) * (-1260.136) (-1262.776) (-1260.840) [-1256.220] -- 0:00:49
      195000 -- (-1257.020) (-1257.929) [-1263.319] (-1257.626) * (-1263.052) (-1257.748) [-1261.516] (-1259.100) -- 0:00:49

      Average standard deviation of split frequencies: 0.018840

      195500 -- (-1258.860) (-1256.401) [-1259.804] (-1257.545) * (-1257.979) (-1257.557) [-1258.631] (-1258.982) -- 0:00:49
      196000 -- (-1259.830) (-1258.077) [-1259.997] (-1258.647) * [-1258.094] (-1258.214) (-1260.061) (-1257.881) -- 0:00:49
      196500 -- (-1259.071) [-1258.783] (-1258.405) (-1258.497) * (-1257.053) (-1257.505) [-1259.372] (-1259.344) -- 0:00:49
      197000 -- [-1261.511] (-1258.253) (-1257.076) (-1256.813) * (-1259.692) (-1259.299) [-1257.768] (-1260.605) -- 0:00:48
      197500 -- (-1257.166) [-1260.693] (-1260.292) (-1260.501) * (-1258.160) [-1257.848] (-1258.885) (-1258.915) -- 0:00:48
      198000 -- [-1258.374] (-1258.129) (-1260.059) (-1257.216) * (-1256.054) (-1258.725) (-1257.550) [-1257.686] -- 0:00:48
      198500 -- (-1262.420) (-1257.138) [-1256.651] (-1258.441) * [-1259.128] (-1261.950) (-1257.623) (-1261.715) -- 0:00:48
      199000 -- (-1260.190) (-1257.402) [-1256.634] (-1262.114) * (-1259.126) (-1257.396) [-1257.392] (-1259.623) -- 0:00:48
      199500 -- [-1256.697] (-1256.653) (-1261.237) (-1265.401) * (-1257.876) (-1258.769) [-1257.583] (-1266.073) -- 0:00:48
      200000 -- (-1256.754) (-1259.457) [-1256.722] (-1256.240) * (-1258.090) (-1261.545) [-1258.800] (-1262.197) -- 0:00:51

      Average standard deviation of split frequencies: 0.018271

      200500 -- [-1256.700] (-1260.028) (-1257.391) (-1258.616) * (-1258.232) (-1259.980) [-1257.031] (-1256.968) -- 0:00:51
      201000 -- (-1262.167) (-1256.679) (-1257.782) [-1259.444] * (-1256.550) (-1259.351) [-1258.876] (-1257.652) -- 0:00:51
      201500 -- (-1259.840) (-1256.990) [-1257.326] (-1260.030) * (-1258.747) (-1259.410) [-1258.125] (-1260.867) -- 0:00:51
      202000 -- [-1258.114] (-1256.797) (-1257.550) (-1258.035) * (-1257.894) [-1257.438] (-1257.816) (-1257.550) -- 0:00:51
      202500 -- [-1258.740] (-1256.737) (-1258.130) (-1258.234) * [-1259.139] (-1257.028) (-1258.756) (-1257.657) -- 0:00:51
      203000 -- (-1256.995) (-1257.024) (-1258.632) [-1258.102] * [-1257.127] (-1259.481) (-1259.599) (-1258.777) -- 0:00:51
      203500 -- [-1256.707] (-1256.936) (-1257.474) (-1257.008) * (-1258.234) (-1256.449) (-1257.024) [-1258.361] -- 0:00:50
      204000 -- (-1256.714) [-1257.731] (-1257.306) (-1257.567) * (-1257.576) (-1263.539) (-1258.640) [-1257.269] -- 0:00:50
      204500 -- (-1261.780) (-1258.221) [-1256.739] (-1257.770) * (-1257.580) (-1257.852) [-1258.581] (-1259.695) -- 0:00:50
      205000 -- (-1260.551) [-1256.737] (-1258.601) (-1260.807) * (-1258.662) [-1256.756] (-1258.503) (-1257.737) -- 0:00:50

      Average standard deviation of split frequencies: 0.017417

      205500 -- (-1258.944) (-1256.929) (-1257.915) [-1259.910] * [-1260.801] (-1258.252) (-1257.054) (-1261.601) -- 0:00:50
      206000 -- (-1258.040) (-1258.620) (-1259.669) [-1261.652] * [-1256.404] (-1262.821) (-1257.113) (-1261.671) -- 0:00:50
      206500 -- [-1258.418] (-1256.680) (-1264.982) (-1258.879) * (-1256.668) (-1259.196) [-1259.238] (-1258.824) -- 0:00:49
      207000 -- (-1260.058) (-1261.662) [-1269.446] (-1256.416) * [-1256.623] (-1259.403) (-1257.848) (-1258.041) -- 0:00:49
      207500 -- (-1258.088) (-1261.444) (-1261.035) [-1260.526] * [-1260.501] (-1257.727) (-1258.094) (-1256.770) -- 0:00:49
      208000 -- (-1257.722) (-1261.327) [-1256.288] (-1260.784) * (-1257.793) (-1258.792) [-1260.308] (-1261.671) -- 0:00:49
      208500 -- (-1257.538) (-1258.325) [-1256.663] (-1260.497) * [-1259.132] (-1259.445) (-1257.768) (-1260.632) -- 0:00:49
      209000 -- (-1262.040) [-1258.120] (-1255.949) (-1258.609) * (-1260.729) (-1261.538) (-1259.902) [-1259.357] -- 0:00:49
      209500 -- (-1261.806) (-1257.033) (-1256.707) [-1259.115] * (-1263.367) (-1260.334) (-1258.694) [-1258.195] -- 0:00:49
      210000 -- (-1257.884) (-1257.672) (-1260.276) [-1257.798] * (-1264.271) (-1259.492) [-1259.853] (-1257.541) -- 0:00:48

      Average standard deviation of split frequencies: 0.015539

      210500 -- (-1257.853) [-1258.332] (-1260.870) (-1257.436) * (-1256.602) (-1258.395) [-1262.308] (-1259.799) -- 0:00:48
      211000 -- [-1256.504] (-1258.823) (-1262.312) (-1256.632) * (-1259.467) (-1259.060) (-1259.048) [-1259.655] -- 0:00:48
      211500 -- (-1257.253) (-1259.038) [-1259.574] (-1256.632) * (-1261.469) (-1258.944) [-1261.032] (-1257.003) -- 0:00:48
      212000 -- (-1256.865) [-1257.968] (-1256.192) (-1261.116) * (-1260.503) [-1262.160] (-1257.148) (-1256.802) -- 0:00:48
      212500 -- [-1257.967] (-1258.634) (-1256.132) (-1260.624) * [-1264.442] (-1259.948) (-1257.189) (-1257.587) -- 0:00:48
      213000 -- (-1257.839) [-1263.169] (-1257.262) (-1257.825) * (-1263.215) (-1259.849) [-1258.373] (-1259.088) -- 0:00:48
      213500 -- (-1259.386) (-1263.002) (-1256.968) [-1258.015] * (-1258.476) [-1260.967] (-1257.611) (-1259.251) -- 0:00:47
      214000 -- (-1258.178) (-1258.093) (-1258.912) [-1259.087] * (-1256.610) [-1256.160] (-1257.346) (-1261.145) -- 0:00:51
      214500 -- [-1260.223] (-1257.616) (-1258.311) (-1257.252) * (-1258.716) (-1258.017) [-1256.528] (-1262.209) -- 0:00:51
      215000 -- [-1260.141] (-1257.684) (-1259.990) (-1257.097) * (-1257.321) [-1258.271] (-1256.585) (-1259.122) -- 0:00:51

      Average standard deviation of split frequencies: 0.015883

      215500 -- (-1259.806) (-1259.584) (-1257.378) [-1258.105] * (-1256.390) (-1256.432) (-1256.913) [-1258.610] -- 0:00:50
      216000 -- (-1258.975) [-1256.560] (-1256.787) (-1259.743) * (-1257.020) [-1259.070] (-1257.394) (-1257.768) -- 0:00:50
      216500 -- [-1258.440] (-1256.302) (-1257.543) (-1260.081) * (-1259.185) [-1261.212] (-1256.192) (-1257.603) -- 0:00:50
      217000 -- (-1260.309) [-1257.861] (-1256.875) (-1259.560) * (-1260.170) (-1259.837) (-1256.795) [-1257.122] -- 0:00:50
      217500 -- [-1258.755] (-1257.554) (-1258.609) (-1260.284) * (-1261.266) (-1260.104) [-1255.935] (-1257.469) -- 0:00:50
      218000 -- (-1261.824) (-1257.695) [-1259.114] (-1259.436) * (-1259.421) [-1257.502] (-1256.338) (-1257.369) -- 0:00:50
      218500 -- (-1259.626) [-1257.820] (-1258.223) (-1259.356) * (-1258.597) (-1256.553) [-1256.646] (-1258.385) -- 0:00:50
      219000 -- [-1259.237] (-1256.468) (-1257.627) (-1257.494) * (-1256.617) [-1262.971] (-1256.769) (-1258.345) -- 0:00:49
      219500 -- (-1259.559) [-1258.594] (-1259.791) (-1257.013) * (-1258.680) (-1256.820) (-1257.304) [-1257.388] -- 0:00:49
      220000 -- (-1259.305) (-1260.063) [-1256.689] (-1259.230) * [-1256.544] (-1261.346) (-1258.128) (-1257.987) -- 0:00:49

      Average standard deviation of split frequencies: 0.015666

      220500 -- (-1261.734) (-1260.010) (-1256.455) [-1260.338] * [-1257.148] (-1258.765) (-1258.626) (-1256.002) -- 0:00:49
      221000 -- (-1259.546) [-1257.409] (-1257.118) (-1260.786) * (-1256.210) (-1257.862) [-1256.466] (-1257.376) -- 0:00:49
      221500 -- (-1259.398) [-1256.773] (-1257.843) (-1256.404) * (-1257.148) [-1259.705] (-1257.168) (-1257.388) -- 0:00:49
      222000 -- (-1258.064) (-1256.904) [-1256.304] (-1257.874) * (-1258.807) (-1257.853) [-1258.874] (-1259.022) -- 0:00:49
      222500 -- (-1257.753) (-1258.151) [-1256.446] (-1260.807) * (-1257.479) [-1258.406] (-1257.073) (-1256.985) -- 0:00:48
      223000 -- (-1260.933) (-1261.223) (-1257.552) [-1258.794] * (-1256.869) [-1257.201] (-1257.737) (-1258.531) -- 0:00:48
      223500 -- (-1261.532) (-1256.652) [-1259.686] (-1257.245) * (-1256.861) (-1257.270) (-1258.808) [-1258.767] -- 0:00:48
      224000 -- (-1261.126) (-1257.267) [-1258.917] (-1257.181) * [-1260.523] (-1260.719) (-1257.530) (-1259.548) -- 0:00:48
      224500 -- (-1262.191) [-1256.730] (-1258.176) (-1257.724) * (-1260.574) (-1260.393) [-1257.440] (-1258.049) -- 0:00:48
      225000 -- (-1258.355) [-1257.741] (-1256.641) (-1259.627) * (-1257.936) (-1258.746) [-1257.354] (-1256.075) -- 0:00:48

      Average standard deviation of split frequencies: 0.015412

      225500 -- [-1258.302] (-1260.485) (-1257.418) (-1262.996) * (-1257.802) (-1258.617) (-1256.842) [-1257.400] -- 0:00:48
      226000 -- (-1259.452) (-1261.018) [-1257.675] (-1260.374) * (-1257.883) [-1257.466] (-1257.486) (-1259.414) -- 0:00:47
      226500 -- (-1258.457) (-1259.854) [-1256.609] (-1260.541) * [-1257.323] (-1256.608) (-1259.671) (-1257.805) -- 0:00:47
      227000 -- (-1257.480) [-1258.730] (-1256.325) (-1257.155) * (-1258.616) (-1256.870) (-1257.072) [-1257.403] -- 0:00:47
      227500 -- (-1257.017) (-1258.307) [-1257.823] (-1257.394) * (-1261.238) (-1259.266) (-1258.633) [-1261.303] -- 0:00:50
      228000 -- (-1258.431) (-1256.939) (-1256.242) [-1257.573] * [-1260.717] (-1259.266) (-1257.891) (-1261.304) -- 0:00:50
      228500 -- (-1257.334) [-1258.438] (-1258.558) (-1257.357) * (-1258.859) (-1257.181) (-1257.764) [-1256.826] -- 0:00:50
      229000 -- (-1260.726) [-1258.788] (-1258.678) (-1258.755) * (-1259.967) [-1257.584] (-1257.576) (-1258.234) -- 0:00:50
      229500 -- [-1263.473] (-1258.992) (-1257.113) (-1258.258) * (-1259.737) [-1257.650] (-1261.615) (-1258.549) -- 0:00:50
      230000 -- (-1258.845) [-1256.459] (-1257.340) (-1259.430) * [-1258.946] (-1257.650) (-1256.918) (-1259.319) -- 0:00:50

      Average standard deviation of split frequencies: 0.015668

      230500 -- (-1261.431) (-1257.284) (-1260.547) [-1259.658] * (-1257.675) (-1257.057) [-1257.534] (-1263.101) -- 0:00:50
      231000 -- [-1258.782] (-1257.016) (-1256.944) (-1259.183) * (-1259.957) [-1260.574] (-1257.933) (-1259.696) -- 0:00:49
      231500 -- (-1258.943) (-1257.391) [-1256.944] (-1259.195) * (-1259.794) (-1256.951) [-1259.320] (-1257.298) -- 0:00:49
      232000 -- (-1258.439) (-1257.097) (-1258.931) [-1256.710] * [-1259.093] (-1256.852) (-1259.377) (-1257.943) -- 0:00:49
      232500 -- (-1258.108) [-1259.316] (-1258.144) (-1256.711) * (-1256.999) (-1256.853) (-1257.738) [-1260.313] -- 0:00:49
      233000 -- (-1257.230) (-1258.868) [-1256.797] (-1256.711) * (-1256.321) [-1258.325] (-1257.342) (-1259.160) -- 0:00:49
      233500 -- (-1261.171) [-1259.922] (-1257.126) (-1256.711) * [-1257.598] (-1258.037) (-1260.521) (-1257.450) -- 0:00:49
      234000 -- (-1259.393) [-1258.845] (-1256.273) (-1257.875) * (-1257.352) (-1256.811) (-1261.931) [-1256.695] -- 0:00:49
      234500 -- (-1258.989) [-1258.045] (-1256.268) (-1258.587) * (-1267.504) (-1257.126) (-1260.122) [-1260.020] -- 0:00:48
      235000 -- (-1260.095) (-1257.364) (-1256.082) [-1257.733] * (-1262.000) [-1257.778] (-1261.754) (-1258.752) -- 0:00:48

      Average standard deviation of split frequencies: 0.014981

      235500 -- (-1261.509) [-1257.325] (-1256.050) (-1258.496) * [-1257.192] (-1255.935) (-1259.039) (-1256.752) -- 0:00:48
      236000 -- [-1258.453] (-1257.795) (-1257.331) (-1257.888) * (-1264.941) (-1257.862) (-1257.710) [-1257.685] -- 0:00:48
      236500 -- [-1257.320] (-1257.249) (-1257.081) (-1259.442) * [-1257.174] (-1257.067) (-1259.798) (-1257.166) -- 0:00:48
      237000 -- (-1257.180) (-1257.854) (-1258.023) [-1259.434] * (-1258.215) (-1256.786) [-1258.257] (-1257.567) -- 0:00:48
      237500 -- (-1257.258) (-1257.154) (-1257.100) [-1256.805] * [-1257.759] (-1255.827) (-1257.020) (-1257.408) -- 0:00:48
      238000 -- (-1258.200) (-1258.433) [-1258.773] (-1257.658) * (-1259.512) (-1259.896) (-1258.080) [-1257.152] -- 0:00:48
      238500 -- (-1259.265) (-1256.758) (-1257.868) [-1257.707] * (-1257.972) [-1261.099] (-1260.147) (-1258.893) -- 0:00:47
      239000 -- (-1257.148) (-1259.005) (-1257.790) [-1257.683] * (-1260.753) (-1256.657) (-1257.934) [-1258.443] -- 0:00:47
      239500 -- (-1257.761) (-1260.821) [-1258.902] (-1258.185) * (-1262.216) (-1256.310) (-1258.023) [-1261.322] -- 0:00:47
      240000 -- (-1258.196) (-1257.239) [-1259.183] (-1258.974) * [-1263.229] (-1258.831) (-1260.316) (-1261.526) -- 0:00:47

      Average standard deviation of split frequencies: 0.014582

      240500 -- (-1258.522) [-1258.067] (-1258.019) (-1262.529) * (-1260.780) (-1256.801) [-1258.543] (-1259.114) -- 0:00:47
      241000 -- (-1258.073) [-1259.140] (-1258.354) (-1263.982) * (-1260.410) (-1259.548) [-1256.267] (-1256.909) -- 0:00:47
      241500 -- (-1257.208) (-1257.515) [-1259.706] (-1264.547) * [-1259.887] (-1257.869) (-1256.609) (-1266.342) -- 0:00:47
      242000 -- (-1258.652) [-1260.803] (-1260.010) (-1262.454) * [-1258.131] (-1259.064) (-1256.171) (-1256.637) -- 0:00:46
      242500 -- (-1257.296) [-1260.887] (-1263.133) (-1260.236) * (-1257.447) (-1258.358) (-1256.327) [-1258.735] -- 0:00:46
      243000 -- (-1259.070) [-1259.796] (-1260.836) (-1259.256) * (-1257.492) (-1257.125) (-1256.323) [-1256.830] -- 0:00:49
      243500 -- [-1257.795] (-1259.458) (-1257.754) (-1258.741) * (-1258.140) (-1260.202) (-1257.997) [-1257.271] -- 0:00:49
      244000 -- (-1261.462) (-1257.991) [-1259.591] (-1258.158) * (-1258.857) (-1256.564) (-1259.383) [-1256.312] -- 0:00:49
      244500 -- (-1257.792) (-1259.536) (-1258.758) [-1259.703] * [-1262.695] (-1257.235) (-1262.175) (-1256.433) -- 0:00:49
      245000 -- (-1259.682) (-1261.558) (-1257.769) [-1257.122] * (-1257.812) (-1258.472) [-1259.814] (-1256.557) -- 0:00:49

      Average standard deviation of split frequencies: 0.013414

      245500 -- (-1259.353) (-1261.387) (-1258.011) [-1259.642] * (-1259.952) (-1258.144) (-1257.865) [-1257.299] -- 0:00:49
      246000 -- (-1261.549) (-1262.176) [-1257.045] (-1258.048) * (-1260.838) (-1262.307) [-1257.903] (-1257.043) -- 0:00:49
      246500 -- (-1257.584) [-1258.618] (-1259.679) (-1258.601) * (-1259.486) (-1258.838) [-1259.796] (-1258.707) -- 0:00:48
      247000 -- (-1256.927) [-1260.968] (-1257.371) (-1258.135) * [-1256.767] (-1257.068) (-1259.355) (-1259.190) -- 0:00:48
      247500 -- (-1257.331) [-1258.842] (-1257.861) (-1260.578) * (-1257.248) (-1256.810) [-1260.034] (-1259.719) -- 0:00:48
      248000 -- (-1260.226) (-1257.693) [-1257.626] (-1259.380) * (-1257.474) (-1258.017) [-1257.680] (-1259.528) -- 0:00:48
      248500 -- (-1259.192) [-1257.254] (-1258.232) (-1258.632) * [-1257.774] (-1257.122) (-1258.377) (-1260.297) -- 0:00:48
      249000 -- (-1257.453) (-1260.319) (-1259.608) [-1259.605] * [-1256.653] (-1258.194) (-1260.104) (-1257.001) -- 0:00:48
      249500 -- (-1261.740) (-1262.519) [-1256.793] (-1258.777) * (-1257.965) (-1257.644) [-1256.546] (-1259.065) -- 0:00:48
      250000 -- (-1262.237) (-1259.805) (-1264.841) [-1257.467] * (-1258.867) (-1257.088) [-1257.605] (-1259.569) -- 0:00:48

      Average standard deviation of split frequencies: 0.014522

      250500 -- (-1257.692) [-1258.981] (-1261.051) (-1257.763) * (-1258.222) (-1257.631) (-1256.694) [-1257.928] -- 0:00:47
      251000 -- [-1258.337] (-1259.641) (-1261.658) (-1257.774) * [-1258.476] (-1256.468) (-1255.930) (-1258.583) -- 0:00:47
      251500 -- (-1257.126) (-1258.976) (-1267.915) [-1257.487] * (-1257.616) [-1257.219] (-1257.347) (-1257.908) -- 0:00:47
      252000 -- (-1258.497) (-1259.959) (-1264.451) [-1257.655] * [-1256.900] (-1260.357) (-1257.642) (-1257.705) -- 0:00:47
      252500 -- (-1256.349) [-1258.391] (-1262.073) (-1257.282) * (-1256.837) (-1261.415) [-1257.546] (-1258.520) -- 0:00:47
      253000 -- (-1260.841) (-1256.406) [-1256.405] (-1260.494) * [-1258.427] (-1256.976) (-1256.386) (-1257.829) -- 0:00:47
      253500 -- (-1259.832) (-1261.012) [-1260.363] (-1258.723) * (-1257.445) (-1257.250) [-1258.448] (-1258.262) -- 0:00:47
      254000 -- [-1257.607] (-1258.722) (-1263.235) (-1259.613) * (-1258.748) (-1258.002) [-1257.962] (-1259.705) -- 0:00:46
      254500 -- (-1257.050) (-1256.570) (-1259.661) [-1257.175] * (-1257.399) (-1256.980) [-1260.226] (-1256.483) -- 0:00:46
      255000 -- (-1257.223) (-1259.291) [-1260.682] (-1258.087) * (-1257.365) [-1256.975] (-1260.049) (-1258.122) -- 0:00:46

      Average standard deviation of split frequencies: 0.015345

      255500 -- (-1256.796) (-1256.490) (-1257.103) [-1261.331] * (-1258.629) (-1263.753) (-1259.663) [-1257.045] -- 0:00:46
      256000 -- [-1256.908] (-1257.891) (-1258.188) (-1258.921) * (-1257.053) (-1258.526) [-1256.290] (-1257.305) -- 0:00:46
      256500 -- (-1256.510) (-1265.083) (-1257.198) [-1258.411] * (-1259.082) (-1257.716) [-1256.685] (-1257.383) -- 0:00:46
      257000 -- (-1256.985) [-1258.428] (-1262.499) (-1257.432) * (-1259.199) [-1258.226] (-1261.245) (-1259.830) -- 0:00:46
      257500 -- (-1256.532) (-1259.127) (-1265.239) [-1259.030] * [-1257.196] (-1257.375) (-1257.773) (-1263.781) -- 0:00:46
      258000 -- (-1259.356) (-1263.195) (-1260.534) [-1256.643] * (-1257.036) [-1256.833] (-1257.775) (-1259.952) -- 0:00:46
      258500 -- (-1261.305) (-1259.782) [-1260.987] (-1257.078) * (-1263.559) (-1258.269) (-1260.379) [-1256.180] -- 0:00:45
      259000 -- [-1261.741] (-1259.076) (-1258.393) (-1259.972) * (-1258.883) (-1261.565) (-1257.408) [-1258.418] -- 0:00:48
      259500 -- (-1259.131) (-1256.361) [-1260.200] (-1261.170) * (-1260.657) (-1261.993) (-1259.716) [-1266.008] -- 0:00:48
      260000 -- (-1258.888) (-1258.509) [-1259.237] (-1258.376) * (-1256.288) [-1259.421] (-1258.993) (-1263.972) -- 0:00:48

      Average standard deviation of split frequencies: 0.014870

      260500 -- (-1259.099) (-1256.473) (-1257.587) [-1256.712] * [-1256.652] (-1258.004) (-1258.446) (-1261.537) -- 0:00:48
      261000 -- (-1258.162) (-1260.360) [-1256.079] (-1257.614) * (-1257.144) (-1256.659) [-1258.228] (-1265.905) -- 0:00:48
      261500 -- (-1258.058) (-1259.187) (-1256.844) [-1258.034] * [-1257.533] (-1257.036) (-1258.280) (-1263.982) -- 0:00:48
      262000 -- (-1258.009) (-1257.162) (-1256.204) [-1257.181] * (-1256.279) (-1257.412) [-1257.453] (-1258.167) -- 0:00:47
      262500 -- (-1257.020) [-1257.194] (-1259.059) (-1258.510) * (-1256.776) [-1256.464] (-1257.629) (-1260.621) -- 0:00:47
      263000 -- (-1256.906) [-1257.906] (-1259.916) (-1259.091) * (-1257.435) (-1257.532) (-1260.820) [-1260.407] -- 0:00:47
      263500 -- (-1257.427) (-1258.310) [-1256.994] (-1259.508) * (-1260.239) (-1259.747) (-1261.847) [-1261.087] -- 0:00:47
      264000 -- (-1256.887) (-1257.555) [-1258.540] (-1258.343) * (-1259.962) (-1259.215) [-1258.725] (-1257.972) -- 0:00:47
      264500 -- (-1258.427) [-1259.647] (-1261.688) (-1258.343) * [-1257.680] (-1260.094) (-1257.666) (-1259.018) -- 0:00:47
      265000 -- [-1258.564] (-1260.520) (-1261.195) (-1258.615) * [-1259.936] (-1262.104) (-1257.678) (-1258.741) -- 0:00:47

      Average standard deviation of split frequencies: 0.014374

      265500 -- (-1259.005) (-1256.801) [-1259.228] (-1256.268) * (-1257.978) [-1258.710] (-1259.421) (-1260.322) -- 0:00:47
      266000 -- (-1259.494) (-1256.959) (-1259.297) [-1262.731] * (-1259.314) (-1259.199) (-1259.099) [-1259.214] -- 0:00:46
      266500 -- (-1259.020) (-1256.669) (-1258.504) [-1257.158] * (-1258.266) (-1258.406) [-1259.703] (-1256.288) -- 0:00:46
      267000 -- (-1259.925) (-1257.830) (-1257.619) [-1262.509] * (-1259.310) (-1259.479) (-1258.601) [-1256.450] -- 0:00:46
      267500 -- (-1258.387) [-1256.180] (-1257.845) (-1258.629) * (-1258.822) (-1256.675) (-1258.291) [-1256.614] -- 0:00:46
      268000 -- [-1257.000] (-1259.434) (-1256.769) (-1259.261) * (-1258.171) [-1259.558] (-1261.699) (-1257.079) -- 0:00:46
      268500 -- (-1259.258) (-1259.280) (-1256.768) [-1259.235] * [-1259.802] (-1258.296) (-1259.066) (-1259.118) -- 0:00:46
      269000 -- (-1257.804) [-1258.955] (-1256.318) (-1259.701) * (-1257.794) (-1257.032) (-1259.379) [-1257.361] -- 0:00:46
      269500 -- (-1261.135) (-1258.813) [-1259.528] (-1257.434) * (-1257.686) (-1257.720) (-1260.091) [-1259.057] -- 0:00:46
      270000 -- (-1257.215) [-1258.905] (-1256.884) (-1259.005) * [-1256.286] (-1257.517) (-1259.144) (-1257.615) -- 0:00:45

      Average standard deviation of split frequencies: 0.014804

      270500 -- [-1256.219] (-1259.997) (-1259.355) (-1260.294) * (-1259.106) (-1259.922) [-1261.656] (-1259.439) -- 0:00:45
      271000 -- (-1256.654) (-1259.948) [-1259.574] (-1257.600) * (-1258.380) (-1259.111) (-1258.992) [-1257.894] -- 0:00:45
      271500 -- (-1257.844) (-1260.222) [-1259.232] (-1256.592) * (-1257.750) [-1258.394] (-1260.369) (-1257.847) -- 0:00:45
      272000 -- (-1257.887) [-1259.881] (-1257.642) (-1257.335) * (-1257.424) (-1259.480) [-1257.638] (-1260.017) -- 0:00:45
      272500 -- (-1258.698) (-1257.005) [-1256.244] (-1259.811) * [-1259.809] (-1261.451) (-1257.974) (-1259.006) -- 0:00:45
      273000 -- [-1256.719] (-1257.451) (-1258.235) (-1259.722) * (-1256.904) (-1258.071) [-1258.158] (-1258.368) -- 0:00:45
      273500 -- [-1257.116] (-1258.711) (-1258.417) (-1258.310) * [-1256.924] (-1257.602) (-1258.200) (-1258.706) -- 0:00:45
      274000 -- [-1257.976] (-1257.851) (-1258.416) (-1259.617) * (-1258.911) (-1256.114) [-1256.410] (-1257.661) -- 0:00:45
      274500 -- [-1257.665] (-1264.680) (-1258.344) (-1261.475) * (-1259.110) [-1256.961] (-1258.533) (-1257.686) -- 0:00:44
      275000 -- (-1259.072) (-1259.550) [-1259.458] (-1258.154) * (-1263.147) (-1257.793) [-1262.931] (-1259.088) -- 0:00:47

      Average standard deviation of split frequencies: 0.014992

      275500 -- (-1258.644) (-1257.758) (-1259.021) [-1257.897] * (-1264.035) [-1256.785] (-1259.759) (-1256.814) -- 0:00:47
      276000 -- [-1257.834] (-1258.613) (-1257.527) (-1257.283) * (-1261.407) (-1257.360) [-1256.871] (-1257.098) -- 0:00:47
      276500 -- (-1256.913) (-1257.158) (-1257.978) [-1262.055] * (-1259.152) (-1258.159) (-1256.555) [-1257.492] -- 0:00:47
      277000 -- (-1258.621) (-1257.381) [-1259.184] (-1258.816) * (-1258.420) (-1256.925) [-1256.572] (-1261.719) -- 0:00:46
      277500 -- [-1257.756] (-1258.357) (-1258.718) (-1256.606) * (-1259.749) (-1259.102) [-1260.987] (-1263.308) -- 0:00:46
      278000 -- (-1263.289) (-1259.299) [-1258.280] (-1259.092) * (-1259.293) (-1260.523) [-1265.354] (-1259.397) -- 0:00:46
      278500 -- (-1260.448) (-1257.835) (-1258.685) [-1257.671] * (-1258.435) (-1260.173) [-1257.413] (-1257.080) -- 0:00:46
      279000 -- (-1262.292) [-1257.272] (-1258.995) (-1260.526) * (-1258.034) (-1258.167) [-1257.104] (-1256.946) -- 0:00:46
      279500 -- (-1259.596) (-1257.562) (-1259.639) [-1258.301] * (-1260.899) (-1258.167) [-1258.677] (-1258.084) -- 0:00:46
      280000 -- (-1259.071) [-1259.133] (-1259.926) (-1258.271) * (-1258.723) (-1258.400) (-1259.020) [-1258.203] -- 0:00:46

      Average standard deviation of split frequencies: 0.015293

      280500 -- (-1256.691) (-1258.131) [-1258.104] (-1261.554) * (-1259.723) [-1258.353] (-1256.104) (-1256.618) -- 0:00:46
      281000 -- [-1258.978] (-1257.093) (-1257.917) (-1261.537) * [-1258.228] (-1256.040) (-1260.015) (-1256.068) -- 0:00:46
      281500 -- (-1260.178) (-1256.998) [-1258.230] (-1257.221) * (-1258.399) (-1256.260) (-1260.540) [-1256.422] -- 0:00:45
      282000 -- (-1260.321) (-1257.159) [-1259.162] (-1257.226) * [-1258.851] (-1256.260) (-1257.960) (-1256.231) -- 0:00:45
      282500 -- (-1257.295) [-1257.553] (-1258.388) (-1257.760) * (-1260.056) (-1256.260) [-1258.405] (-1256.375) -- 0:00:45
      283000 -- [-1257.885] (-1257.371) (-1257.647) (-1257.777) * (-1261.769) [-1256.272] (-1260.233) (-1260.896) -- 0:00:45
      283500 -- (-1268.018) (-1257.842) [-1256.225] (-1258.880) * (-1260.270) (-1260.892) (-1260.858) [-1258.165] -- 0:00:45
      284000 -- (-1259.320) (-1258.472) (-1258.833) [-1258.112] * (-1259.261) [-1257.049] (-1257.995) (-1258.303) -- 0:00:45
      284500 -- (-1258.667) (-1258.704) (-1258.159) [-1257.867] * (-1258.834) (-1257.889) [-1257.709] (-1258.883) -- 0:00:45
      285000 -- (-1260.695) (-1258.470) [-1257.964] (-1257.895) * (-1258.250) (-1257.727) [-1256.706] (-1260.883) -- 0:00:45

      Average standard deviation of split frequencies: 0.015615

      285500 -- (-1259.043) [-1258.304] (-1258.527) (-1258.714) * (-1256.258) (-1258.667) (-1257.285) [-1258.519] -- 0:00:45
      286000 -- (-1260.959) (-1257.757) [-1258.708] (-1258.686) * [-1258.640] (-1261.521) (-1258.959) (-1260.248) -- 0:00:44
      286500 -- [-1256.452] (-1259.459) (-1257.163) (-1259.234) * (-1257.017) (-1258.526) [-1257.159] (-1258.413) -- 0:00:44
      287000 -- (-1258.070) [-1256.384] (-1258.789) (-1263.576) * (-1256.508) [-1258.191] (-1258.907) (-1258.450) -- 0:00:44
      287500 -- [-1260.012] (-1261.098) (-1261.094) (-1259.225) * [-1257.987] (-1260.889) (-1258.106) (-1257.874) -- 0:00:44
      288000 -- (-1260.833) (-1259.402) [-1261.982] (-1258.886) * (-1256.502) (-1257.347) [-1261.108] (-1259.375) -- 0:00:44
      288500 -- (-1256.441) [-1257.249] (-1258.615) (-1256.280) * (-1258.029) (-1256.743) (-1259.571) [-1258.775] -- 0:00:44
      289000 -- (-1258.692) (-1257.815) (-1263.216) [-1256.355] * (-1256.328) (-1257.119) [-1260.562] (-1256.466) -- 0:00:44
      289500 -- (-1256.492) (-1258.653) (-1260.550) [-1256.896] * (-1261.648) [-1257.693] (-1258.498) (-1258.850) -- 0:00:44
      290000 -- [-1257.366] (-1258.466) (-1258.958) (-1256.074) * (-1258.074) [-1258.784] (-1259.865) (-1260.038) -- 0:00:44

      Average standard deviation of split frequencies: 0.014767

      290500 -- (-1259.425) (-1257.277) (-1257.065) [-1256.808] * (-1258.990) (-1257.349) [-1259.466] (-1259.204) -- 0:00:43
      291000 -- (-1257.786) (-1258.477) (-1256.720) [-1256.324] * (-1258.308) (-1260.089) (-1259.392) [-1258.629] -- 0:00:46
      291500 -- (-1256.767) (-1258.854) [-1256.211] (-1257.659) * [-1258.288] (-1256.857) (-1259.074) (-1258.618) -- 0:00:46
      292000 -- [-1256.677] (-1260.877) (-1257.387) (-1263.296) * (-1259.731) (-1257.374) [-1259.311] (-1260.650) -- 0:00:46
      292500 -- (-1260.085) (-1257.490) (-1256.521) [-1258.485] * [-1258.588] (-1259.086) (-1257.672) (-1259.154) -- 0:00:45
      293000 -- [-1258.444] (-1256.286) (-1257.038) (-1257.896) * (-1258.600) (-1258.085) (-1259.644) [-1260.007] -- 0:00:45
      293500 -- [-1256.103] (-1256.606) (-1258.927) (-1261.544) * (-1263.142) (-1256.739) (-1258.203) [-1260.453] -- 0:00:45
      294000 -- [-1259.858] (-1256.964) (-1258.236) (-1256.850) * (-1258.982) [-1257.135] (-1259.160) (-1260.822) -- 0:00:45
      294500 -- (-1259.728) [-1257.258] (-1257.213) (-1257.965) * (-1256.500) [-1256.173] (-1257.647) (-1257.555) -- 0:00:45
      295000 -- (-1260.578) (-1259.940) (-1258.023) [-1258.290] * (-1256.505) [-1256.315] (-1258.026) (-1257.858) -- 0:00:45

      Average standard deviation of split frequencies: 0.014510

      295500 -- (-1260.276) (-1259.052) [-1256.310] (-1259.143) * (-1256.893) (-1261.727) [-1255.905] (-1260.111) -- 0:00:45
      296000 -- (-1257.326) [-1258.595] (-1258.892) (-1260.761) * (-1256.533) (-1262.195) (-1255.991) [-1259.560] -- 0:00:45
      296500 -- (-1259.316) (-1257.426) [-1257.398] (-1262.826) * (-1256.567) (-1259.869) (-1256.189) [-1257.060] -- 0:00:45
      297000 -- [-1257.122] (-1257.194) (-1256.829) (-1256.170) * [-1256.561] (-1261.441) (-1256.482) (-1257.373) -- 0:00:44
      297500 -- [-1258.495] (-1259.181) (-1257.090) (-1263.291) * (-1257.742) [-1258.969] (-1256.482) (-1256.679) -- 0:00:44
      298000 -- (-1258.091) (-1260.563) (-1257.908) [-1259.421] * [-1257.188] (-1260.866) (-1256.722) (-1258.323) -- 0:00:44
      298500 -- (-1257.535) (-1259.468) (-1258.757) [-1257.573] * (-1256.920) (-1258.111) (-1256.716) [-1257.129] -- 0:00:44
      299000 -- [-1256.572] (-1256.934) (-1258.550) (-1257.281) * [-1257.642] (-1258.173) (-1258.010) (-1258.787) -- 0:00:44
      299500 -- (-1257.516) [-1256.947] (-1258.383) (-1259.366) * (-1260.513) (-1258.142) (-1259.276) [-1258.256] -- 0:00:44
      300000 -- [-1262.139] (-1256.528) (-1258.497) (-1259.603) * (-1261.881) [-1259.169] (-1259.927) (-1260.262) -- 0:00:44

      Average standard deviation of split frequencies: 0.013240

      300500 -- (-1260.351) [-1257.100] (-1257.615) (-1257.743) * [-1256.566] (-1259.352) (-1257.598) (-1264.428) -- 0:00:44
      301000 -- (-1260.053) (-1257.459) [-1256.516] (-1261.149) * (-1259.181) (-1258.576) [-1257.824] (-1263.254) -- 0:00:44
      301500 -- (-1258.638) (-1257.410) [-1256.632] (-1256.976) * (-1260.127) (-1258.134) (-1262.866) [-1257.206] -- 0:00:44
      302000 -- (-1259.558) (-1259.935) (-1256.804) [-1258.189] * [-1256.696] (-1258.518) (-1259.259) (-1256.040) -- 0:00:43
      302500 -- (-1258.402) (-1258.471) (-1261.091) [-1259.516] * (-1257.116) (-1261.273) [-1257.481] (-1258.847) -- 0:00:43
      303000 -- (-1259.316) (-1258.939) [-1257.568] (-1260.413) * (-1258.181) (-1258.320) (-1256.582) [-1257.755] -- 0:00:43
      303500 -- (-1256.972) (-1260.145) (-1257.548) [-1259.486] * (-1257.343) (-1257.592) [-1256.740] (-1259.194) -- 0:00:43
      304000 -- (-1257.131) (-1260.494) [-1257.938] (-1258.729) * (-1257.786) [-1257.291] (-1256.755) (-1259.844) -- 0:00:43
      304500 -- (-1258.106) (-1261.212) (-1257.685) [-1257.767] * (-1257.445) (-1261.027) [-1257.360] (-1259.743) -- 0:00:43
      305000 -- (-1260.801) (-1261.070) [-1261.712] (-1257.933) * [-1256.637] (-1263.419) (-1257.892) (-1263.037) -- 0:00:43

      Average standard deviation of split frequencies: 0.012667

      305500 -- (-1257.912) (-1258.820) (-1262.444) [-1258.994] * [-1257.397] (-1258.777) (-1258.491) (-1271.418) -- 0:00:43
      306000 -- (-1256.807) (-1258.429) [-1258.276] (-1259.130) * [-1257.581] (-1258.667) (-1258.193) (-1263.034) -- 0:00:43
      306500 -- (-1256.394) [-1258.591] (-1258.457) (-1261.032) * (-1262.674) (-1259.106) [-1257.527] (-1256.687) -- 0:00:45
      307000 -- (-1258.160) (-1256.042) (-1257.785) [-1260.887] * (-1257.833) [-1256.742] (-1257.532) (-1259.661) -- 0:00:45
      307500 -- (-1257.995) (-1258.590) (-1257.949) [-1257.742] * [-1259.794] (-1256.804) (-1256.598) (-1258.686) -- 0:00:45
      308000 -- (-1256.987) [-1257.719] (-1259.896) (-1260.795) * (-1256.438) (-1259.405) (-1258.125) [-1258.213] -- 0:00:44
      308500 -- (-1257.383) (-1258.785) [-1258.551] (-1262.471) * (-1256.438) [-1256.443] (-1257.543) (-1257.537) -- 0:00:44
      309000 -- (-1256.714) (-1258.769) [-1258.112] (-1259.716) * (-1256.180) (-1258.539) [-1258.690] (-1257.526) -- 0:00:44
      309500 -- (-1257.345) (-1260.967) [-1257.233] (-1256.674) * [-1256.180] (-1257.501) (-1256.779) (-1261.714) -- 0:00:44
      310000 -- [-1256.596] (-1258.968) (-1257.769) (-1259.802) * (-1255.985) (-1259.718) [-1258.412] (-1259.758) -- 0:00:44

      Average standard deviation of split frequencies: 0.011886

      310500 -- (-1256.786) (-1258.993) [-1259.046] (-1256.461) * (-1256.846) (-1257.663) (-1257.142) [-1259.380] -- 0:00:44
      311000 -- (-1261.981) (-1259.042) (-1259.002) [-1257.232] * [-1256.339] (-1261.343) (-1256.422) (-1257.134) -- 0:00:44
      311500 -- (-1260.759) (-1258.492) (-1258.496) [-1256.830] * (-1256.046) (-1258.095) [-1257.326] (-1257.512) -- 0:00:44
      312000 -- (-1259.693) [-1257.658] (-1260.255) (-1257.248) * [-1256.852] (-1261.508) (-1257.110) (-1259.646) -- 0:00:44
      312500 -- (-1262.235) (-1256.985) (-1257.310) [-1258.915] * (-1259.410) [-1257.781] (-1257.936) (-1260.491) -- 0:00:44
      313000 -- (-1260.510) [-1258.046] (-1259.137) (-1258.296) * [-1256.752] (-1260.586) (-1256.849) (-1259.255) -- 0:00:43
      313500 -- (-1265.885) [-1258.472] (-1259.481) (-1261.914) * (-1258.622) [-1259.734] (-1256.589) (-1259.354) -- 0:00:43
      314000 -- [-1257.809] (-1259.579) (-1259.298) (-1260.010) * (-1258.854) [-1260.939] (-1256.594) (-1258.750) -- 0:00:43
      314500 -- (-1258.917) (-1259.409) [-1257.920] (-1260.329) * [-1259.708] (-1261.731) (-1257.143) (-1257.664) -- 0:00:43
      315000 -- (-1258.850) (-1258.508) [-1257.534] (-1258.949) * (-1261.072) (-1259.119) [-1256.658] (-1257.241) -- 0:00:43

      Average standard deviation of split frequencies: 0.012514

      315500 -- [-1258.804] (-1259.978) (-1256.990) (-1258.962) * (-1258.346) (-1259.874) [-1257.001] (-1257.234) -- 0:00:43
      316000 -- (-1267.040) (-1258.145) (-1256.987) [-1257.653] * (-1259.909) (-1262.919) (-1259.412) [-1256.680] -- 0:00:43
      316500 -- (-1259.975) (-1259.322) [-1256.753] (-1257.083) * [-1258.189] (-1257.743) (-1257.328) (-1258.559) -- 0:00:43
      317000 -- (-1258.877) (-1258.356) (-1256.959) [-1263.416] * (-1259.476) [-1258.727] (-1257.240) (-1257.539) -- 0:00:43
      317500 -- [-1258.741] (-1256.596) (-1259.098) (-1259.144) * [-1260.027] (-1256.786) (-1257.406) (-1257.537) -- 0:00:42
      318000 -- (-1264.122) [-1257.819] (-1258.768) (-1258.014) * (-1259.737) [-1256.529] (-1259.088) (-1258.467) -- 0:00:42
      318500 -- (-1258.755) (-1256.714) (-1257.880) [-1259.084] * (-1258.830) [-1257.072] (-1259.916) (-1260.036) -- 0:00:42
      319000 -- (-1258.072) (-1259.822) (-1258.905) [-1256.702] * (-1258.217) (-1256.243) [-1261.005] (-1258.119) -- 0:00:42
      319500 -- (-1259.723) (-1259.998) [-1259.408] (-1257.237) * (-1258.217) [-1258.147] (-1256.767) (-1257.032) -- 0:00:42
      320000 -- (-1257.532) [-1257.033] (-1259.616) (-1257.298) * [-1256.438] (-1258.507) (-1258.652) (-1258.830) -- 0:00:42

      Average standard deviation of split frequencies: 0.013231

      320500 -- (-1261.953) [-1258.658] (-1261.514) (-1259.529) * (-1256.446) (-1259.216) (-1259.846) [-1257.452] -- 0:00:42
      321000 -- (-1258.587) (-1256.872) [-1257.568] (-1256.204) * (-1256.402) [-1258.464] (-1257.608) (-1257.378) -- 0:00:42
      321500 -- (-1257.387) (-1259.568) [-1258.312] (-1256.750) * (-1260.731) [-1256.965] (-1258.739) (-1258.889) -- 0:00:42
      322000 -- (-1256.612) (-1259.468) [-1259.219] (-1260.072) * (-1258.528) (-1257.138) (-1257.294) [-1257.735] -- 0:00:42
      322500 -- (-1258.946) (-1257.059) [-1260.907] (-1259.147) * (-1258.623) [-1259.356] (-1257.353) (-1260.345) -- 0:00:44
      323000 -- [-1257.116] (-1256.960) (-1262.247) (-1258.660) * (-1258.313) (-1260.804) (-1260.085) [-1261.433] -- 0:00:44
      323500 -- (-1256.606) (-1257.645) [-1259.959] (-1257.324) * (-1259.024) [-1260.381] (-1257.661) (-1258.003) -- 0:00:43
      324000 -- (-1256.930) (-1261.150) (-1264.376) [-1258.270] * (-1259.385) (-1260.454) (-1257.837) [-1260.234] -- 0:00:43
      324500 -- [-1256.506] (-1259.014) (-1257.795) (-1257.451) * (-1259.249) [-1256.454] (-1257.536) (-1256.277) -- 0:00:43
      325000 -- (-1257.884) (-1261.728) [-1258.111] (-1264.260) * (-1256.937) (-1256.614) (-1257.081) [-1259.499] -- 0:00:43

      Average standard deviation of split frequencies: 0.012854

      325500 -- (-1257.384) (-1259.503) [-1259.142] (-1257.505) * (-1263.163) [-1256.873] (-1257.288) (-1257.517) -- 0:00:43
      326000 -- (-1258.025) (-1259.700) (-1258.792) [-1258.536] * (-1259.086) (-1257.936) [-1257.484] (-1257.238) -- 0:00:43
      326500 -- (-1259.322) (-1259.459) [-1256.723] (-1257.310) * (-1259.098) (-1256.381) [-1256.236] (-1258.045) -- 0:00:43
      327000 -- [-1260.195] (-1258.039) (-1256.805) (-1258.110) * [-1259.524] (-1260.335) (-1257.275) (-1258.326) -- 0:00:43
      327500 -- (-1260.377) (-1257.603) (-1256.742) [-1257.821] * (-1256.214) [-1257.830] (-1258.520) (-1259.088) -- 0:00:43
      328000 -- (-1259.577) [-1261.051] (-1259.574) (-1259.726) * (-1259.072) (-1257.412) [-1258.744] (-1260.898) -- 0:00:43
      328500 -- [-1256.883] (-1257.895) (-1261.637) (-1257.889) * (-1256.956) (-1258.758) [-1257.898] (-1260.327) -- 0:00:42
      329000 -- (-1261.043) (-1256.965) (-1258.765) [-1257.239] * (-1257.010) (-1256.973) (-1258.526) [-1257.351] -- 0:00:42
      329500 -- (-1261.740) (-1257.752) (-1257.380) [-1257.128] * (-1256.981) [-1257.670] (-1257.027) (-1259.340) -- 0:00:42
      330000 -- (-1257.759) (-1256.368) [-1257.859] (-1259.749) * (-1259.749) (-1258.964) (-1256.992) [-1257.097] -- 0:00:42

      Average standard deviation of split frequencies: 0.013543

      330500 -- (-1257.366) [-1256.666] (-1259.620) (-1260.528) * (-1258.339) (-1258.700) (-1256.925) [-1257.829] -- 0:00:42
      331000 -- (-1256.691) [-1257.562] (-1258.666) (-1261.055) * (-1258.452) (-1269.433) [-1256.605] (-1260.873) -- 0:00:42
      331500 -- [-1257.727] (-1260.547) (-1259.294) (-1259.775) * (-1257.753) (-1260.259) (-1257.001) [-1258.611] -- 0:00:42
      332000 -- (-1256.212) (-1264.492) (-1257.122) [-1257.184] * [-1259.759] (-1259.128) (-1256.186) (-1256.779) -- 0:00:42
      332500 -- [-1256.921] (-1258.904) (-1256.431) (-1257.214) * (-1257.118) (-1257.929) [-1256.448] (-1257.519) -- 0:00:42
      333000 -- (-1257.461) (-1258.233) [-1257.908] (-1260.303) * (-1257.336) (-1263.148) [-1258.342] (-1259.241) -- 0:00:42
      333500 -- (-1259.310) (-1257.416) [-1258.198] (-1259.880) * [-1256.944] (-1259.162) (-1256.804) (-1260.622) -- 0:00:41
      334000 -- (-1257.768) (-1260.277) [-1259.267] (-1260.805) * (-1257.239) (-1260.676) (-1259.894) [-1259.251] -- 0:00:41
      334500 -- (-1261.128) [-1261.334] (-1259.677) (-1256.950) * (-1259.925) [-1256.182] (-1257.075) (-1258.517) -- 0:00:41
      335000 -- [-1260.377] (-1258.529) (-1259.991) (-1257.464) * (-1256.964) (-1256.335) [-1256.646] (-1256.175) -- 0:00:41

      Average standard deviation of split frequencies: 0.013562

      335500 -- [-1257.968] (-1259.527) (-1257.252) (-1257.611) * (-1259.682) (-1257.711) (-1258.315) [-1257.983] -- 0:00:41
      336000 -- (-1257.109) [-1257.793] (-1259.300) (-1258.573) * [-1259.075] (-1257.674) (-1261.032) (-1257.488) -- 0:00:41
      336500 -- (-1256.915) (-1258.765) (-1258.981) [-1258.815] * (-1258.776) (-1259.884) [-1257.388] (-1260.308) -- 0:00:41
      337000 -- (-1259.438) [-1259.334] (-1258.212) (-1261.718) * (-1260.424) (-1260.007) [-1257.652] (-1260.593) -- 0:00:41
      337500 -- (-1258.937) (-1260.328) (-1258.382) [-1257.612] * (-1259.079) (-1257.423) (-1263.492) [-1260.034] -- 0:00:41
      338000 -- (-1260.203) (-1260.077) (-1257.364) [-1256.810] * (-1258.931) (-1257.822) [-1256.997] (-1263.539) -- 0:00:43
      338500 -- (-1259.410) [-1260.481] (-1257.151) (-1257.789) * (-1257.472) (-1261.943) [-1256.989] (-1262.112) -- 0:00:42
      339000 -- (-1257.966) [-1259.687] (-1258.276) (-1258.824) * (-1259.327) [-1259.014] (-1256.969) (-1261.271) -- 0:00:42
      339500 -- [-1257.646] (-1259.158) (-1257.953) (-1257.512) * (-1261.132) (-1256.962) [-1257.852] (-1259.469) -- 0:00:42
      340000 -- (-1260.640) (-1257.805) (-1257.554) [-1258.025] * (-1258.290) (-1256.259) (-1256.900) [-1259.703] -- 0:00:42

      Average standard deviation of split frequencies: 0.013838

      340500 -- (-1261.461) (-1259.135) (-1262.356) [-1256.992] * [-1256.635] (-1256.163) (-1257.029) (-1256.734) -- 0:00:42
      341000 -- (-1262.025) (-1258.778) [-1256.193] (-1262.699) * (-1260.070) (-1259.561) [-1258.090] (-1258.321) -- 0:00:42
      341500 -- (-1257.524) (-1260.004) [-1256.506] (-1262.902) * (-1257.933) (-1257.728) [-1258.654] (-1258.210) -- 0:00:42
      342000 -- (-1258.193) [-1261.453] (-1257.372) (-1258.382) * (-1259.805) (-1257.478) [-1259.005] (-1259.676) -- 0:00:42
      342500 -- (-1259.242) [-1257.924] (-1256.555) (-1257.716) * [-1258.083] (-1259.979) (-1258.812) (-1263.223) -- 0:00:42
      343000 -- (-1258.095) (-1262.963) (-1258.061) [-1259.026] * (-1259.877) (-1257.499) [-1259.214] (-1257.616) -- 0:00:42
      343500 -- (-1258.111) (-1258.911) [-1257.196] (-1257.494) * [-1258.312] (-1259.333) (-1256.673) (-1262.037) -- 0:00:42
      344000 -- (-1257.962) (-1260.157) (-1259.630) [-1256.902] * (-1259.545) [-1256.792] (-1257.093) (-1260.441) -- 0:00:41
      344500 -- (-1260.078) (-1260.616) [-1267.870] (-1258.186) * (-1258.133) (-1256.415) (-1258.456) [-1263.035] -- 0:00:41
      345000 -- [-1259.399] (-1258.844) (-1260.034) (-1258.202) * [-1258.898] (-1257.860) (-1257.587) (-1258.607) -- 0:00:41

      Average standard deviation of split frequencies: 0.014055

      345500 -- (-1259.417) (-1261.202) [-1258.818] (-1265.092) * [-1256.993] (-1258.436) (-1256.290) (-1257.372) -- 0:00:41
      346000 -- (-1259.148) [-1259.440] (-1259.722) (-1258.578) * [-1256.323] (-1259.205) (-1256.290) (-1257.323) -- 0:00:41
      346500 -- (-1257.859) (-1257.351) (-1262.324) [-1256.877] * [-1257.837] (-1257.786) (-1259.760) (-1259.088) -- 0:00:41
      347000 -- (-1257.906) [-1256.608] (-1257.677) (-1256.870) * (-1256.178) (-1257.740) (-1262.997) [-1258.879] -- 0:00:41
      347500 -- (-1257.716) (-1259.609) (-1257.510) [-1256.914] * (-1256.823) [-1257.496] (-1258.796) (-1256.866) -- 0:00:41
      348000 -- (-1256.424) [-1260.791] (-1256.816) (-1256.792) * (-1260.204) (-1258.284) [-1259.386] (-1256.712) -- 0:00:41
      348500 -- [-1257.231] (-1261.000) (-1258.102) (-1257.018) * [-1261.617] (-1257.896) (-1256.973) (-1258.887) -- 0:00:41
      349000 -- (-1258.866) (-1258.047) (-1257.569) [-1256.705] * (-1258.695) [-1258.237] (-1258.633) (-1258.351) -- 0:00:41
      349500 -- (-1256.454) (-1258.989) [-1257.738] (-1258.002) * (-1259.802) (-1263.092) [-1261.237] (-1259.151) -- 0:00:40
      350000 -- (-1257.612) (-1256.907) [-1257.953] (-1259.796) * (-1260.052) (-1256.298) (-1257.725) [-1259.930] -- 0:00:40

      Average standard deviation of split frequencies: 0.013070

      350500 -- [-1256.672] (-1256.947) (-1261.418) (-1257.259) * (-1257.334) (-1256.315) (-1256.709) [-1257.866] -- 0:00:40
      351000 -- (-1259.647) [-1256.676] (-1260.497) (-1257.961) * [-1260.181] (-1257.426) (-1261.260) (-1260.546) -- 0:00:40
      351500 -- (-1258.105) (-1257.726) (-1259.206) [-1259.289] * (-1261.739) (-1257.122) [-1257.238] (-1261.313) -- 0:00:40
      352000 -- [-1258.806] (-1256.923) (-1256.858) (-1256.243) * (-1260.442) [-1256.394] (-1257.020) (-1259.697) -- 0:00:40
      352500 -- [-1260.670] (-1257.657) (-1259.473) (-1256.901) * [-1260.172] (-1260.131) (-1256.355) (-1263.829) -- 0:00:40
      353000 -- (-1257.957) [-1259.020] (-1258.428) (-1256.196) * (-1261.952) [-1259.988] (-1258.079) (-1256.067) -- 0:00:40
      353500 -- [-1259.005] (-1258.726) (-1258.605) (-1260.448) * [-1258.344] (-1259.960) (-1258.195) (-1257.719) -- 0:00:42
      354000 -- (-1257.441) (-1258.118) (-1261.143) [-1257.951] * (-1261.428) (-1258.969) (-1260.003) [-1258.890] -- 0:00:41
      354500 -- (-1257.101) [-1258.049] (-1259.872) (-1260.203) * (-1257.861) (-1256.755) [-1258.686] (-1257.632) -- 0:00:41
      355000 -- [-1256.661] (-1257.826) (-1259.340) (-1258.512) * (-1257.615) [-1256.150] (-1259.765) (-1257.692) -- 0:00:41

      Average standard deviation of split frequencies: 0.013381

      355500 -- (-1257.265) [-1257.851] (-1258.423) (-1262.073) * (-1257.678) (-1256.602) [-1260.980] (-1257.702) -- 0:00:41
      356000 -- [-1256.149] (-1258.103) (-1259.054) (-1264.320) * [-1256.941] (-1256.466) (-1260.047) (-1256.986) -- 0:00:41
      356500 -- (-1259.964) [-1260.957] (-1258.187) (-1266.316) * (-1261.600) [-1256.619] (-1257.355) (-1256.818) -- 0:00:41
      357000 -- (-1261.706) (-1256.819) [-1258.198] (-1261.904) * [-1256.353] (-1258.665) (-1260.310) (-1256.320) -- 0:00:41
      357500 -- (-1262.008) (-1257.213) (-1257.054) [-1260.098] * (-1267.612) (-1259.727) (-1265.767) [-1256.103] -- 0:00:41
      358000 -- (-1259.776) (-1259.440) [-1256.546] (-1258.842) * (-1258.828) (-1257.188) [-1256.457] (-1256.400) -- 0:00:41
      358500 -- (-1259.541) [-1256.928] (-1257.588) (-1257.718) * [-1257.611] (-1257.533) (-1256.645) (-1257.536) -- 0:00:41
      359000 -- (-1261.143) (-1257.058) [-1257.799] (-1257.250) * (-1257.915) [-1257.881] (-1256.407) (-1257.946) -- 0:00:41
      359500 -- [-1256.849] (-1258.208) (-1258.106) (-1258.271) * (-1263.042) (-1257.538) (-1256.767) [-1257.540] -- 0:00:40
      360000 -- (-1259.088) [-1256.476] (-1259.268) (-1258.552) * (-1261.157) (-1257.417) (-1256.093) [-1256.616] -- 0:00:40

      Average standard deviation of split frequencies: 0.012520

      360500 -- [-1258.775] (-1257.102) (-1258.962) (-1264.159) * (-1258.713) [-1258.902] (-1257.651) (-1256.301) -- 0:00:40
      361000 -- (-1258.056) (-1260.437) (-1259.827) [-1260.737] * (-1259.676) [-1259.924] (-1260.338) (-1260.405) -- 0:00:40
      361500 -- [-1257.177] (-1260.308) (-1257.268) (-1259.919) * (-1259.673) (-1261.263) (-1265.697) [-1259.711] -- 0:00:40
      362000 -- (-1257.234) (-1258.580) (-1258.138) [-1257.214] * [-1258.111] (-1258.370) (-1260.460) (-1262.107) -- 0:00:40
      362500 -- (-1256.129) [-1258.665] (-1261.262) (-1259.664) * [-1257.318] (-1259.452) (-1256.563) (-1257.421) -- 0:00:40
      363000 -- (-1260.978) [-1256.890] (-1258.674) (-1262.635) * (-1258.234) (-1259.332) [-1260.117] (-1260.526) -- 0:00:40
      363500 -- [-1263.927] (-1257.326) (-1257.255) (-1257.948) * (-1258.686) [-1258.614] (-1260.638) (-1259.004) -- 0:00:40
      364000 -- (-1258.277) (-1256.467) [-1257.231] (-1256.757) * (-1260.218) [-1256.925] (-1259.484) (-1259.408) -- 0:00:40
      364500 -- (-1256.730) (-1256.330) [-1258.331] (-1258.147) * (-1259.367) (-1256.657) [-1256.959] (-1260.642) -- 0:00:40
      365000 -- [-1256.730] (-1256.331) (-1256.717) (-1257.045) * (-1257.503) [-1257.654] (-1258.127) (-1258.666) -- 0:00:40

      Average standard deviation of split frequencies: 0.012202

      365500 -- (-1256.730) [-1256.585] (-1265.012) (-1259.377) * (-1256.665) (-1257.409) [-1257.134] (-1259.097) -- 0:00:39
      366000 -- (-1257.789) [-1258.023] (-1258.482) (-1258.582) * (-1257.283) (-1257.552) [-1258.644] (-1256.913) -- 0:00:39
      366500 -- (-1257.828) (-1261.137) (-1258.675) [-1261.410] * (-1257.328) (-1256.698) [-1257.363] (-1258.996) -- 0:00:39
      367000 -- (-1261.217) (-1264.503) [-1258.845] (-1260.803) * (-1260.074) (-1258.202) (-1259.141) [-1257.832] -- 0:00:39
      367500 -- (-1258.467) (-1261.070) [-1257.631] (-1257.650) * (-1257.490) [-1258.963] (-1262.046) (-1261.777) -- 0:00:39
      368000 -- (-1257.943) (-1259.877) [-1256.966] (-1256.143) * [-1256.325] (-1258.892) (-1263.134) (-1260.925) -- 0:00:39
      368500 -- (-1259.264) (-1259.937) (-1256.969) [-1261.681] * (-1258.943) (-1261.309) [-1259.140] (-1257.781) -- 0:00:39
      369000 -- [-1260.402] (-1260.737) (-1259.563) (-1257.775) * (-1257.359) [-1256.432] (-1265.025) (-1258.833) -- 0:00:39
      369500 -- (-1262.591) [-1257.176] (-1261.769) (-1257.775) * (-1259.144) [-1257.183] (-1260.861) (-1258.350) -- 0:00:40
      370000 -- (-1261.115) (-1259.256) (-1258.236) [-1256.915] * [-1259.683] (-1259.616) (-1258.928) (-1256.414) -- 0:00:40

      Average standard deviation of split frequencies: 0.012115

      370500 -- (-1258.550) (-1259.263) [-1260.333] (-1257.480) * (-1258.441) (-1257.765) [-1260.062] (-1258.699) -- 0:00:40
      371000 -- [-1256.396] (-1257.377) (-1260.485) (-1257.070) * (-1257.368) (-1258.579) [-1256.802] (-1260.747) -- 0:00:40
      371500 -- (-1257.494) (-1260.368) (-1259.164) [-1257.484] * (-1257.535) (-1257.699) [-1258.227] (-1258.632) -- 0:00:40
      372000 -- [-1258.047] (-1258.620) (-1259.143) (-1258.495) * (-1258.858) [-1256.556] (-1256.639) (-1260.552) -- 0:00:40
      372500 -- (-1256.472) [-1257.173] (-1259.038) (-1257.967) * (-1258.510) [-1256.554] (-1257.624) (-1258.795) -- 0:00:40
      373000 -- (-1256.472) [-1256.511] (-1258.326) (-1257.984) * (-1263.513) (-1258.252) [-1256.551] (-1258.128) -- 0:00:40
      373500 -- (-1261.125) (-1260.447) (-1257.608) [-1258.332] * (-1261.594) [-1263.439] (-1257.508) (-1261.459) -- 0:00:40
      374000 -- (-1257.507) (-1256.648) [-1258.345] (-1256.595) * [-1258.767] (-1258.226) (-1257.463) (-1262.884) -- 0:00:40
      374500 -- (-1258.246) (-1260.871) [-1257.208] (-1257.272) * [-1257.371] (-1262.218) (-1259.205) (-1262.294) -- 0:00:40
      375000 -- (-1260.416) [-1260.069] (-1257.520) (-1258.446) * (-1258.047) (-1261.019) (-1259.114) [-1257.563] -- 0:00:40

      Average standard deviation of split frequencies: 0.011680

      375500 -- [-1262.106] (-1261.445) (-1257.741) (-1257.552) * [-1256.896] (-1262.358) (-1259.223) (-1260.089) -- 0:00:39
      376000 -- (-1257.456) (-1258.868) (-1258.323) [-1256.539] * (-1257.637) (-1264.330) [-1257.134] (-1259.533) -- 0:00:39
      376500 -- [-1258.280] (-1260.327) (-1258.209) (-1259.595) * (-1256.669) (-1257.752) [-1257.180] (-1258.307) -- 0:00:39
      377000 -- (-1257.504) (-1259.607) (-1257.523) [-1256.731] * (-1258.177) [-1258.518] (-1256.989) (-1256.872) -- 0:00:39
      377500 -- (-1257.822) [-1258.197] (-1260.950) (-1256.990) * [-1258.562] (-1258.061) (-1257.592) (-1256.959) -- 0:00:39
      378000 -- (-1258.196) (-1257.893) [-1257.714] (-1256.919) * (-1261.086) (-1260.779) [-1260.479] (-1262.450) -- 0:00:39
      378500 -- [-1259.166] (-1261.608) (-1260.918) (-1256.462) * (-1261.122) (-1257.179) [-1259.162] (-1258.730) -- 0:00:39
      379000 -- (-1259.766) (-1258.264) [-1258.573] (-1258.375) * (-1263.503) (-1261.542) [-1259.038] (-1261.420) -- 0:00:39
      379500 -- (-1256.668) (-1259.279) [-1257.666] (-1256.170) * [-1257.041] (-1260.024) (-1259.318) (-1259.440) -- 0:00:39
      380000 -- (-1261.271) (-1263.351) (-1258.532) [-1256.461] * [-1256.684] (-1260.457) (-1258.168) (-1259.474) -- 0:00:39

      Average standard deviation of split frequencies: 0.010939

      380500 -- [-1261.271] (-1257.386) (-1260.487) (-1259.338) * (-1257.164) [-1259.626] (-1256.187) (-1259.935) -- 0:00:39
      381000 -- (-1259.325) [-1258.708] (-1257.722) (-1258.919) * (-1256.928) [-1258.506] (-1259.607) (-1258.287) -- 0:00:38
      381500 -- (-1257.738) (-1260.868) [-1257.190] (-1258.048) * (-1261.260) [-1257.052] (-1261.220) (-1262.088) -- 0:00:38
      382000 -- (-1256.601) (-1261.212) (-1260.745) [-1256.747] * [-1256.769] (-1258.144) (-1258.623) (-1258.960) -- 0:00:38
      382500 -- (-1259.153) (-1258.199) [-1258.274] (-1260.015) * (-1260.233) (-1259.095) (-1257.346) [-1257.292] -- 0:00:38
      383000 -- (-1261.608) (-1256.097) [-1256.649] (-1256.485) * [-1260.113] (-1259.851) (-1260.799) (-1260.450) -- 0:00:38
      383500 -- [-1257.992] (-1256.460) (-1255.963) (-1257.979) * (-1258.677) (-1256.653) [-1260.135] (-1258.816) -- 0:00:38
      384000 -- (-1259.143) (-1259.953) (-1258.073) [-1259.883] * (-1257.537) (-1257.399) [-1257.314] (-1259.150) -- 0:00:38
      384500 -- (-1258.235) (-1256.169) (-1258.080) [-1257.761] * [-1256.538] (-1258.970) (-1257.166) (-1258.638) -- 0:00:38
      385000 -- [-1259.685] (-1257.174) (-1258.840) (-1259.788) * (-1259.374) (-1261.066) [-1259.101] (-1263.495) -- 0:00:38

      Average standard deviation of split frequencies: 0.010788

      385500 -- (-1258.083) (-1259.040) [-1259.082] (-1261.806) * [-1257.627] (-1259.237) (-1259.263) (-1259.948) -- 0:00:38
      386000 -- [-1258.654] (-1257.760) (-1258.425) (-1261.176) * [-1259.756] (-1258.470) (-1257.387) (-1258.515) -- 0:00:39
      386500 -- (-1258.257) (-1257.431) (-1257.209) [-1258.324] * (-1258.548) (-1257.496) (-1256.997) [-1256.321] -- 0:00:39
      387000 -- (-1257.100) (-1257.018) (-1257.180) [-1260.905] * [-1259.778] (-1257.235) (-1258.186) (-1256.178) -- 0:00:39
      387500 -- (-1259.022) (-1257.239) [-1256.964] (-1256.828) * (-1259.238) (-1257.750) (-1256.722) [-1256.178] -- 0:00:39
      388000 -- (-1261.188) (-1259.358) (-1257.827) [-1257.740] * [-1257.820] (-1257.147) (-1261.340) (-1259.297) -- 0:00:39
      388500 -- (-1260.856) [-1259.441] (-1257.677) (-1257.756) * (-1266.240) [-1257.141] (-1264.014) (-1257.429) -- 0:00:39
      389000 -- (-1258.793) (-1257.045) (-1258.015) [-1258.362] * (-1261.144) (-1260.394) (-1258.261) [-1257.044] -- 0:00:39
      389500 -- (-1258.289) (-1259.291) (-1259.169) [-1257.967] * (-1257.373) [-1256.303] (-1258.299) (-1258.078) -- 0:00:39
      390000 -- (-1261.645) (-1259.064) [-1256.613] (-1259.347) * (-1258.504) (-1259.194) (-1258.286) [-1260.377] -- 0:00:39

      Average standard deviation of split frequencies: 0.011262

      390500 -- (-1257.478) (-1258.102) (-1256.603) [-1256.772] * (-1257.825) [-1261.722] (-1265.107) (-1257.920) -- 0:00:39
      391000 -- (-1257.598) (-1257.892) [-1256.963] (-1257.655) * (-1257.429) [-1257.753] (-1257.002) (-1260.262) -- 0:00:38
      391500 -- (-1257.611) (-1256.925) [-1258.810] (-1258.056) * (-1257.136) (-1256.852) (-1258.192) [-1256.675] -- 0:00:38
      392000 -- (-1257.767) (-1260.383) (-1258.710) [-1257.973] * (-1257.151) [-1257.352] (-1258.890) (-1258.341) -- 0:00:38
      392500 -- [-1261.120] (-1259.180) (-1259.300) (-1259.130) * [-1258.398] (-1258.430) (-1258.673) (-1256.740) -- 0:00:38
      393000 -- [-1261.032] (-1258.796) (-1257.773) (-1258.327) * (-1257.681) [-1258.277] (-1259.709) (-1257.688) -- 0:00:38
      393500 -- (-1258.617) (-1258.855) (-1256.966) [-1258.607] * [-1256.865] (-1258.907) (-1261.752) (-1258.592) -- 0:00:38
      394000 -- (-1257.754) (-1259.195) [-1258.514] (-1257.440) * [-1257.217] (-1258.890) (-1258.914) (-1261.044) -- 0:00:38
      394500 -- [-1256.699] (-1257.263) (-1258.076) (-1259.184) * (-1259.812) (-1257.561) (-1260.540) [-1262.626] -- 0:00:38
      395000 -- (-1258.048) (-1259.095) [-1258.851] (-1257.796) * [-1259.916] (-1259.783) (-1260.529) (-1261.229) -- 0:00:38

      Average standard deviation of split frequencies: 0.011134

      395500 -- (-1258.707) (-1261.262) [-1257.395] (-1261.693) * (-1260.501) (-1260.478) [-1258.196] (-1260.861) -- 0:00:38
      396000 -- (-1257.770) (-1258.332) [-1257.265] (-1257.399) * [-1257.565] (-1259.881) (-1258.615) (-1259.258) -- 0:00:38
      396500 -- [-1257.800] (-1259.917) (-1259.068) (-1259.018) * (-1258.199) (-1257.524) (-1257.552) [-1258.923] -- 0:00:38
      397000 -- (-1259.356) (-1256.475) (-1257.478) [-1257.164] * (-1258.725) [-1258.286] (-1257.320) (-1259.599) -- 0:00:37
      397500 -- (-1258.555) (-1256.517) (-1256.996) [-1260.159] * (-1256.597) (-1262.517) (-1257.443) [-1256.616] -- 0:00:37
      398000 -- (-1261.455) [-1262.009] (-1262.832) (-1265.311) * (-1259.214) (-1257.978) [-1258.271] (-1258.049) -- 0:00:37
      398500 -- [-1257.504] (-1263.771) (-1259.314) (-1262.411) * (-1258.294) [-1258.562] (-1259.572) (-1257.333) -- 0:00:37
      399000 -- (-1258.583) (-1256.803) [-1257.795] (-1260.616) * (-1257.069) (-1259.665) (-1259.379) [-1258.233] -- 0:00:37
      399500 -- (-1259.657) (-1256.705) (-1261.120) [-1259.217] * (-1256.985) [-1260.538] (-1257.511) (-1258.591) -- 0:00:37
      400000 -- (-1262.423) [-1256.291] (-1261.965) (-1258.049) * (-1255.991) (-1259.197) (-1259.442) [-1259.352] -- 0:00:37

      Average standard deviation of split frequencies: 0.011251

      400500 -- (-1258.466) [-1259.138] (-1259.631) (-1258.103) * [-1256.356] (-1256.702) (-1258.623) (-1256.188) -- 0:00:37
      401000 -- (-1256.535) (-1261.007) (-1257.196) [-1260.197] * [-1258.397] (-1260.833) (-1258.147) (-1256.475) -- 0:00:37
      401500 -- (-1260.617) (-1263.125) [-1257.053] (-1258.395) * (-1257.508) (-1257.231) (-1257.833) [-1256.347] -- 0:00:37
      402000 -- (-1260.402) (-1262.520) (-1258.483) [-1259.184] * (-1257.378) (-1265.660) [-1261.299] (-1259.005) -- 0:00:38
      402500 -- [-1258.188] (-1260.448) (-1260.236) (-1259.350) * (-1261.512) [-1259.914] (-1256.992) (-1256.411) -- 0:00:38
      403000 -- (-1259.824) [-1258.261] (-1259.569) (-1256.804) * (-1258.103) (-1258.889) (-1260.851) [-1261.826] -- 0:00:38
      403500 -- (-1259.561) [-1256.949] (-1258.065) (-1258.875) * (-1256.455) [-1261.143] (-1256.336) (-1260.181) -- 0:00:38
      404000 -- (-1258.056) (-1258.588) [-1257.426] (-1258.684) * (-1256.906) (-1261.258) [-1256.680] (-1261.401) -- 0:00:38
      404500 -- (-1256.218) (-1259.126) (-1257.349) [-1257.476] * (-1259.260) (-1257.198) (-1257.083) [-1256.930] -- 0:00:38
      405000 -- [-1256.473] (-1259.626) (-1257.295) (-1260.473) * (-1258.957) (-1256.892) (-1255.943) [-1258.087] -- 0:00:38

      Average standard deviation of split frequencies: 0.012650

      405500 -- (-1256.677) (-1257.362) (-1257.906) [-1260.536] * [-1257.863] (-1257.305) (-1256.451) (-1257.774) -- 0:00:38
      406000 -- (-1259.290) (-1256.449) [-1258.212] (-1258.517) * [-1259.120] (-1257.134) (-1256.892) (-1257.399) -- 0:00:38
      406500 -- (-1258.207) [-1257.506] (-1257.153) (-1258.434) * (-1257.049) (-1259.795) [-1256.822] (-1257.540) -- 0:00:37
      407000 -- (-1260.130) (-1258.705) (-1258.474) [-1257.721] * (-1256.546) (-1257.435) (-1263.249) [-1258.455] -- 0:00:37
      407500 -- [-1257.718] (-1258.182) (-1256.834) (-1259.516) * (-1256.525) (-1256.923) (-1257.931) [-1257.543] -- 0:00:37
      408000 -- [-1257.175] (-1257.617) (-1257.919) (-1259.967) * (-1257.471) (-1257.603) (-1256.612) [-1259.162] -- 0:00:37
      408500 -- [-1257.123] (-1257.850) (-1261.760) (-1259.181) * (-1260.186) (-1257.576) (-1257.113) [-1257.864] -- 0:00:37
      409000 -- (-1257.567) [-1256.431] (-1257.794) (-1258.934) * (-1256.545) (-1256.571) [-1259.292] (-1260.786) -- 0:00:37
      409500 -- (-1260.901) (-1262.746) [-1261.792] (-1256.769) * (-1257.546) (-1256.398) (-1256.824) [-1259.497] -- 0:00:37
      410000 -- (-1260.700) (-1259.079) (-1264.539) [-1259.438] * (-1257.179) (-1256.642) (-1258.891) [-1256.296] -- 0:00:37

      Average standard deviation of split frequencies: 0.011074

      410500 -- (-1258.587) (-1259.373) (-1262.479) [-1264.080] * (-1258.789) [-1259.201] (-1259.965) (-1257.776) -- 0:00:37
      411000 -- [-1258.679] (-1262.917) (-1258.466) (-1258.887) * [-1261.744] (-1258.058) (-1259.169) (-1257.449) -- 0:00:37
      411500 -- [-1257.150] (-1259.021) (-1258.615) (-1261.137) * (-1259.023) [-1259.121] (-1259.826) (-1260.025) -- 0:00:37
      412000 -- (-1257.573) (-1258.402) (-1258.369) [-1257.891] * [-1257.001] (-1259.966) (-1260.081) (-1260.699) -- 0:00:37
      412500 -- [-1258.846] (-1257.412) (-1257.674) (-1256.931) * (-1257.710) (-1261.612) [-1257.797] (-1259.996) -- 0:00:37
      413000 -- (-1259.675) [-1258.060] (-1256.892) (-1256.557) * (-1259.967) [-1262.901] (-1261.541) (-1262.039) -- 0:00:36
      413500 -- (-1258.096) (-1257.523) (-1261.668) [-1256.553] * [-1258.990] (-1259.799) (-1256.953) (-1257.660) -- 0:00:36
      414000 -- [-1259.520] (-1259.018) (-1258.740) (-1257.839) * (-1258.488) [-1260.500] (-1257.903) (-1255.955) -- 0:00:36
      414500 -- [-1261.661] (-1260.980) (-1257.954) (-1257.439) * (-1258.396) [-1262.573] (-1258.297) (-1261.004) -- 0:00:36
      415000 -- (-1259.469) (-1256.789) [-1259.023] (-1259.889) * (-1258.121) (-1261.792) (-1259.122) [-1258.245] -- 0:00:36

      Average standard deviation of split frequencies: 0.011773

      415500 -- [-1259.570] (-1258.111) (-1256.908) (-1256.717) * (-1258.121) (-1257.676) (-1259.925) [-1259.554] -- 0:00:36
      416000 -- (-1260.816) (-1257.192) (-1257.197) [-1257.128] * (-1258.910) (-1257.970) [-1260.706] (-1262.720) -- 0:00:36
      416500 -- (-1257.985) (-1257.177) [-1262.228] (-1257.663) * (-1259.432) (-1258.141) (-1257.950) [-1263.051] -- 0:00:36
      417000 -- (-1256.764) [-1258.240] (-1260.489) (-1257.622) * (-1258.507) (-1259.462) (-1259.130) [-1260.564] -- 0:00:36
      417500 -- (-1259.120) (-1257.269) [-1257.869] (-1257.489) * (-1257.257) (-1258.208) [-1257.686] (-1259.107) -- 0:00:36
      418000 -- [-1258.019] (-1259.795) (-1257.938) (-1257.978) * (-1258.809) [-1257.604] (-1259.187) (-1257.620) -- 0:00:37
      418500 -- [-1258.329] (-1256.722) (-1258.783) (-1257.817) * (-1261.187) (-1257.861) (-1258.202) [-1256.248] -- 0:00:37
      419000 -- [-1256.429] (-1258.054) (-1256.886) (-1259.217) * (-1263.261) [-1258.648] (-1259.058) (-1257.846) -- 0:00:37
      419500 -- (-1260.546) [-1257.544] (-1259.598) (-1258.706) * (-1261.657) [-1256.869] (-1257.932) (-1257.360) -- 0:00:37
      420000 -- (-1257.554) [-1256.299] (-1261.141) (-1258.521) * (-1258.323) [-1258.114] (-1257.882) (-1257.005) -- 0:00:37

      Average standard deviation of split frequencies: 0.011626

      420500 -- (-1258.604) [-1256.269] (-1259.443) (-1257.600) * (-1256.340) (-1257.210) [-1256.672] (-1258.701) -- 0:00:37
      421000 -- [-1258.878] (-1257.767) (-1258.065) (-1257.944) * (-1257.987) (-1257.153) [-1256.654] (-1260.759) -- 0:00:37
      421500 -- (-1257.165) [-1256.865] (-1258.610) (-1257.251) * (-1259.389) [-1256.951] (-1260.324) (-1261.698) -- 0:00:37
      422000 -- [-1258.758] (-1257.716) (-1259.856) (-1258.702) * (-1259.057) (-1257.389) (-1258.562) [-1257.802] -- 0:00:36
      422500 -- [-1258.422] (-1256.999) (-1260.171) (-1259.805) * (-1258.336) (-1258.237) [-1256.718] (-1257.125) -- 0:00:36
      423000 -- (-1257.616) (-1258.112) [-1258.784] (-1259.377) * [-1257.153] (-1257.103) (-1257.332) (-1257.324) -- 0:00:36
      423500 -- (-1260.130) (-1259.682) [-1257.619] (-1256.933) * (-1256.856) [-1258.277] (-1257.423) (-1256.994) -- 0:00:36
      424000 -- (-1260.556) [-1257.831] (-1261.109) (-1256.605) * (-1258.682) (-1258.110) (-1258.735) [-1258.367] -- 0:00:36
      424500 -- (-1259.103) (-1259.788) [-1259.476] (-1256.828) * (-1258.127) [-1259.357] (-1259.234) (-1258.349) -- 0:00:36
      425000 -- [-1257.618] (-1261.696) (-1257.193) (-1256.543) * (-1258.897) (-1257.513) [-1260.977] (-1258.341) -- 0:00:36

      Average standard deviation of split frequencies: 0.010943

      425500 -- (-1258.826) (-1257.473) [-1257.792] (-1256.858) * (-1262.601) (-1256.924) (-1257.061) [-1256.569] -- 0:00:36
      426000 -- (-1257.298) (-1256.988) (-1256.654) [-1261.898] * [-1256.056] (-1256.470) (-1258.845) (-1257.755) -- 0:00:36
      426500 -- [-1261.291] (-1257.255) (-1260.310) (-1261.573) * (-1258.175) (-1256.919) [-1258.421] (-1257.763) -- 0:00:36
      427000 -- (-1259.918) (-1256.856) (-1257.821) [-1259.697] * [-1257.434] (-1262.256) (-1256.241) (-1261.170) -- 0:00:36
      427500 -- (-1257.448) (-1258.076) (-1256.792) [-1257.792] * (-1258.134) [-1260.874] (-1257.329) (-1260.452) -- 0:00:36
      428000 -- (-1257.929) (-1257.974) [-1257.157] (-1258.266) * (-1256.378) (-1256.918) (-1256.890) [-1256.899] -- 0:00:36
      428500 -- [-1257.981] (-1259.276) (-1258.463) (-1258.728) * (-1256.339) (-1258.424) (-1262.713) [-1258.058] -- 0:00:36
      429000 -- (-1256.166) (-1258.909) (-1258.532) [-1257.657] * (-1259.078) (-1258.425) (-1259.016) [-1256.996] -- 0:00:35
      429500 -- (-1260.482) (-1258.264) (-1258.714) [-1257.082] * [-1258.628] (-1258.915) (-1261.367) (-1259.812) -- 0:00:35
      430000 -- (-1256.891) (-1259.731) (-1258.312) [-1257.155] * (-1259.166) (-1261.591) (-1257.910) [-1261.290] -- 0:00:35

      Average standard deviation of split frequencies: 0.010399

      430500 -- (-1256.860) [-1261.110] (-1258.590) (-1260.010) * (-1258.629) [-1258.660] (-1263.881) (-1259.876) -- 0:00:35
      431000 -- (-1259.406) [-1257.573] (-1258.787) (-1258.488) * [-1257.194] (-1261.650) (-1259.740) (-1259.599) -- 0:00:35
      431500 -- (-1264.335) (-1257.674) (-1258.388) [-1256.875] * (-1259.418) [-1259.959] (-1259.121) (-1257.431) -- 0:00:35
      432000 -- (-1260.990) (-1258.820) (-1260.133) [-1257.757] * (-1256.422) [-1259.576] (-1258.801) (-1258.088) -- 0:00:35
      432500 -- (-1260.746) [-1258.315] (-1256.452) (-1258.628) * (-1256.271) [-1258.160] (-1256.359) (-1259.525) -- 0:00:35
      433000 -- (-1258.945) (-1258.480) (-1260.840) [-1256.965] * [-1260.374] (-1258.749) (-1258.409) (-1257.190) -- 0:00:35
      433500 -- (-1261.670) [-1257.293] (-1260.840) (-1260.060) * (-1257.243) [-1260.590] (-1258.708) (-1256.940) -- 0:00:35
      434000 -- (-1258.827) [-1260.678] (-1257.557) (-1257.976) * [-1257.539] (-1259.580) (-1257.434) (-1257.873) -- 0:00:36
      434500 -- (-1261.866) (-1257.708) [-1257.445] (-1258.607) * (-1257.057) (-1256.883) (-1259.527) [-1258.547] -- 0:00:36
      435000 -- [-1258.756] (-1258.377) (-1261.679) (-1262.085) * [-1257.057] (-1256.853) (-1256.952) (-1259.785) -- 0:00:36

      Average standard deviation of split frequencies: 0.011194

      435500 -- (-1259.992) (-1257.328) (-1262.162) [-1258.491] * (-1257.143) [-1256.435] (-1257.385) (-1258.703) -- 0:00:36
      436000 -- [-1258.336] (-1256.903) (-1260.118) (-1257.108) * (-1262.064) (-1256.340) [-1256.366] (-1257.887) -- 0:00:36
      436500 -- (-1257.370) (-1261.130) (-1258.088) [-1258.938] * (-1257.693) (-1257.395) [-1258.682] (-1260.624) -- 0:00:36
      437000 -- [-1256.470] (-1260.094) (-1258.461) (-1261.123) * (-1258.708) (-1256.354) [-1259.266] (-1258.969) -- 0:00:36
      437500 -- (-1257.937) (-1260.140) (-1255.905) [-1258.230] * (-1257.217) (-1260.191) [-1258.604] (-1258.417) -- 0:00:36
      438000 -- (-1256.469) [-1258.924] (-1256.419) (-1257.294) * (-1257.315) [-1257.832] (-1258.100) (-1262.367) -- 0:00:35
      438500 -- (-1255.936) (-1259.462) [-1257.228] (-1260.728) * (-1259.931) (-1256.582) [-1258.401] (-1260.895) -- 0:00:35
      439000 -- (-1257.820) (-1261.623) (-1259.203) [-1257.903] * (-1258.512) (-1261.239) [-1260.082] (-1263.871) -- 0:00:35
      439500 -- [-1257.550] (-1264.339) (-1259.537) (-1260.634) * (-1256.520) (-1257.485) (-1259.141) [-1258.695] -- 0:00:35
      440000 -- (-1260.541) (-1259.464) [-1260.367] (-1260.730) * (-1257.446) [-1256.779] (-1258.587) (-1260.529) -- 0:00:35

      Average standard deviation of split frequencies: 0.010949

      440500 -- (-1255.983) (-1259.277) (-1259.874) [-1259.748] * (-1256.597) (-1259.423) (-1258.875) [-1258.176] -- 0:00:35
      441000 -- (-1256.109) (-1256.740) (-1258.620) [-1260.872] * [-1257.082] (-1259.790) (-1258.753) (-1258.529) -- 0:00:35
      441500 -- [-1256.109] (-1258.557) (-1257.884) (-1256.384) * (-1256.234) [-1257.116] (-1256.589) (-1257.957) -- 0:00:35
      442000 -- (-1256.263) [-1260.259] (-1268.252) (-1256.187) * (-1258.030) (-1257.358) (-1256.718) [-1260.887] -- 0:00:35
      442500 -- [-1256.382] (-1256.806) (-1272.058) (-1256.849) * (-1257.136) (-1259.857) (-1256.437) [-1260.448] -- 0:00:35
      443000 -- (-1261.749) [-1257.454] (-1260.279) (-1259.244) * (-1256.130) [-1259.362] (-1258.327) (-1257.987) -- 0:00:35
      443500 -- (-1257.306) [-1256.558] (-1261.357) (-1260.908) * (-1260.080) [-1256.555] (-1261.396) (-1257.432) -- 0:00:35
      444000 -- (-1258.931) [-1256.791] (-1256.820) (-1262.973) * (-1256.679) (-1257.208) (-1257.645) [-1258.413] -- 0:00:35
      444500 -- [-1257.662] (-1256.652) (-1258.234) (-1258.398) * [-1260.475] (-1257.813) (-1257.951) (-1260.297) -- 0:00:34
      445000 -- (-1256.536) [-1256.629] (-1258.287) (-1260.990) * (-1257.823) [-1257.737] (-1257.192) (-1256.683) -- 0:00:34

      Average standard deviation of split frequencies: 0.011129

      445500 -- (-1262.055) (-1260.074) [-1258.332] (-1261.169) * (-1262.873) [-1259.347] (-1256.654) (-1257.440) -- 0:00:34
      446000 -- [-1260.522] (-1259.688) (-1257.476) (-1262.115) * (-1259.805) [-1258.048] (-1260.286) (-1259.959) -- 0:00:34
      446500 -- (-1259.089) (-1259.789) [-1256.918] (-1263.393) * [-1261.919] (-1258.365) (-1263.524) (-1260.702) -- 0:00:34
      447000 -- (-1264.556) (-1258.963) (-1256.990) [-1260.417] * [-1256.706] (-1261.146) (-1258.642) (-1257.501) -- 0:00:34
      447500 -- (-1264.329) (-1260.958) [-1256.987] (-1259.134) * (-1261.194) (-1256.751) [-1257.244] (-1256.658) -- 0:00:34
      448000 -- (-1262.677) (-1257.789) [-1256.554] (-1259.132) * (-1257.843) [-1258.025] (-1260.364) (-1256.622) -- 0:00:34
      448500 -- (-1256.912) (-1256.590) (-1257.719) [-1262.246] * (-1256.818) [-1258.336] (-1257.679) (-1257.111) -- 0:00:34
      449000 -- [-1257.335] (-1258.285) (-1256.492) (-1258.430) * (-1259.316) (-1257.936) (-1256.486) [-1256.724] -- 0:00:34
      449500 -- (-1259.796) [-1257.636] (-1257.144) (-1258.100) * (-1259.575) [-1263.059] (-1257.063) (-1257.476) -- 0:00:34
      450000 -- (-1261.075) [-1257.729] (-1257.697) (-1259.086) * (-1257.245) (-1259.361) (-1258.064) [-1257.144] -- 0:00:34

      Average standard deviation of split frequencies: 0.010829

      450500 -- (-1261.420) (-1259.213) [-1258.218] (-1260.090) * [-1257.463] (-1262.294) (-1259.209) (-1258.374) -- 0:00:35
      451000 -- (-1261.895) (-1260.482) (-1261.830) [-1258.590] * [-1257.536] (-1258.741) (-1257.169) (-1259.214) -- 0:00:35
      451500 -- (-1257.343) (-1259.533) (-1261.668) [-1258.623] * (-1257.779) (-1261.123) [-1260.583] (-1258.529) -- 0:00:35
      452000 -- (-1256.963) (-1262.658) [-1257.607] (-1259.162) * (-1261.893) (-1256.348) [-1257.848] (-1256.546) -- 0:00:35
      452500 -- [-1257.195] (-1258.802) (-1259.299) (-1258.183) * (-1260.757) (-1256.103) [-1259.443] (-1257.249) -- 0:00:35
      453000 -- [-1257.195] (-1259.539) (-1260.836) (-1261.701) * [-1258.091] (-1258.054) (-1258.784) (-1259.816) -- 0:00:35
      453500 -- (-1260.234) (-1257.786) (-1258.755) [-1257.489] * (-1267.508) [-1258.874] (-1259.124) (-1256.763) -- 0:00:34
      454000 -- (-1261.743) (-1258.815) (-1257.902) [-1256.948] * (-1257.966) [-1258.885] (-1259.614) (-1258.778) -- 0:00:34
      454500 -- (-1256.860) (-1258.598) (-1257.109) [-1258.713] * (-1258.334) (-1260.222) (-1262.045) [-1261.507] -- 0:00:34
      455000 -- [-1257.877] (-1258.706) (-1256.228) (-1256.180) * [-1259.273] (-1261.429) (-1264.078) (-1259.723) -- 0:00:34

      Average standard deviation of split frequencies: 0.011242

      455500 -- (-1257.295) (-1258.134) [-1257.841] (-1256.749) * (-1256.359) (-1257.315) (-1256.759) [-1259.600] -- 0:00:34
      456000 -- (-1259.045) [-1258.903] (-1262.017) (-1257.475) * (-1256.819) (-1256.847) [-1257.546] (-1258.857) -- 0:00:34
      456500 -- [-1256.504] (-1260.590) (-1264.663) (-1259.044) * (-1257.330) (-1258.058) [-1258.319] (-1257.916) -- 0:00:34
      457000 -- (-1260.603) (-1258.721) [-1256.860] (-1260.894) * (-1257.158) [-1256.909] (-1261.284) (-1257.320) -- 0:00:34
      457500 -- (-1258.003) (-1258.391) [-1256.737] (-1257.239) * (-1257.919) (-1259.911) (-1256.871) [-1256.474] -- 0:00:34
      458000 -- (-1257.379) (-1258.041) [-1256.609] (-1260.425) * (-1259.389) (-1259.568) (-1261.781) [-1256.326] -- 0:00:34
      458500 -- (-1258.952) (-1256.690) [-1257.945] (-1259.567) * (-1258.834) (-1259.304) (-1258.254) [-1256.790] -- 0:00:34
      459000 -- (-1256.811) [-1256.179] (-1261.898) (-1257.686) * (-1256.862) [-1256.747] (-1256.599) (-1257.266) -- 0:00:34
      459500 -- (-1257.546) (-1256.171) (-1258.897) [-1257.163] * (-1261.023) (-1256.742) [-1259.532] (-1259.272) -- 0:00:34
      460000 -- [-1258.593] (-1258.908) (-1258.902) (-1257.138) * (-1257.665) [-1257.120] (-1257.100) (-1256.474) -- 0:00:34

      Average standard deviation of split frequencies: 0.011738

      460500 -- [-1257.052] (-1261.849) (-1257.869) (-1257.026) * (-1256.773) (-1259.218) [-1258.753] (-1256.977) -- 0:00:33
      461000 -- (-1260.839) (-1259.005) (-1257.580) [-1256.816] * (-1258.870) (-1257.510) (-1257.396) [-1262.136] -- 0:00:33
      461500 -- [-1256.940] (-1256.742) (-1257.343) (-1258.000) * (-1259.004) [-1257.715] (-1259.611) (-1264.017) -- 0:00:33
      462000 -- (-1257.004) (-1257.352) [-1257.380] (-1258.326) * (-1258.931) [-1256.879] (-1262.350) (-1258.940) -- 0:00:33
      462500 -- (-1257.807) (-1257.306) [-1259.947] (-1256.600) * [-1257.948] (-1256.990) (-1270.925) (-1258.081) -- 0:00:33
      463000 -- (-1257.969) (-1257.161) [-1256.977] (-1256.759) * (-1257.730) (-1257.458) (-1266.455) [-1257.715] -- 0:00:33
      463500 -- (-1260.562) [-1259.414] (-1257.248) (-1261.060) * (-1257.740) [-1266.310] (-1265.991) (-1256.771) -- 0:00:33
      464000 -- (-1258.027) (-1257.782) [-1256.224] (-1257.012) * (-1259.397) (-1258.279) (-1265.002) [-1256.060] -- 0:00:33
      464500 -- (-1256.873) (-1259.564) (-1257.592) [-1257.154] * (-1259.465) [-1258.854] (-1262.157) (-1257.347) -- 0:00:33
      465000 -- (-1259.893) (-1257.890) (-1256.719) [-1257.557] * (-1260.870) (-1259.478) (-1257.620) [-1258.906] -- 0:00:33

      Average standard deviation of split frequencies: 0.012080

      465500 -- (-1260.551) (-1257.911) [-1256.940] (-1259.113) * [-1259.572] (-1262.797) (-1259.637) (-1257.807) -- 0:00:33
      466000 -- (-1258.382) [-1259.037] (-1256.448) (-1256.744) * (-1258.579) [-1258.344] (-1258.708) (-1259.727) -- 0:00:33
      466500 -- (-1258.062) [-1257.188] (-1258.158) (-1257.955) * (-1259.678) [-1260.383] (-1257.386) (-1258.430) -- 0:00:34
      467000 -- (-1259.624) [-1257.440] (-1256.220) (-1257.470) * (-1256.739) (-1258.711) (-1259.660) [-1257.127] -- 0:00:34
      467500 -- (-1260.459) (-1257.357) [-1256.478] (-1257.186) * (-1259.806) [-1259.179] (-1259.388) (-1259.378) -- 0:00:34
      468000 -- (-1266.402) [-1259.718] (-1257.661) (-1258.823) * (-1257.380) (-1257.921) [-1259.071] (-1258.743) -- 0:00:34
      468500 -- [-1259.463] (-1256.782) (-1258.454) (-1256.110) * (-1258.269) (-1259.185) [-1262.996] (-1261.845) -- 0:00:34
      469000 -- (-1265.001) [-1257.339] (-1257.965) (-1256.588) * (-1257.319) (-1257.023) (-1258.424) [-1259.834] -- 0:00:33
      469500 -- (-1262.823) (-1257.322) (-1257.727) [-1258.612] * (-1258.369) (-1256.550) [-1258.244] (-1258.211) -- 0:00:33
      470000 -- (-1259.948) (-1258.280) (-1257.976) [-1259.375] * (-1259.822) [-1259.806] (-1264.114) (-1260.094) -- 0:00:33

      Average standard deviation of split frequencies: 0.011783

      470500 -- (-1257.815) (-1257.069) [-1260.372] (-1263.980) * (-1260.593) (-1260.671) (-1259.448) [-1258.365] -- 0:00:33
      471000 -- (-1260.663) [-1256.564] (-1256.476) (-1256.951) * (-1257.311) (-1262.912) [-1259.029] (-1256.878) -- 0:00:33
      471500 -- [-1258.185] (-1256.197) (-1256.572) (-1256.679) * (-1257.514) (-1259.041) (-1256.310) [-1257.257] -- 0:00:33
      472000 -- [-1260.335] (-1257.080) (-1257.599) (-1256.717) * (-1261.317) (-1259.321) (-1257.311) [-1259.075] -- 0:00:33
      472500 -- (-1259.159) (-1256.713) [-1257.599] (-1256.170) * [-1257.993] (-1258.988) (-1259.066) (-1255.993) -- 0:00:33
      473000 -- (-1257.893) (-1256.569) (-1260.741) [-1257.624] * (-1258.123) [-1260.081] (-1259.619) (-1258.908) -- 0:00:33
      473500 -- (-1266.153) (-1256.266) (-1264.669) [-1256.734] * (-1259.069) [-1257.088] (-1261.638) (-1259.756) -- 0:00:33
      474000 -- (-1259.359) (-1258.837) (-1257.583) [-1256.449] * (-1256.894) (-1260.682) [-1256.948] (-1260.127) -- 0:00:33
      474500 -- (-1260.220) (-1264.510) (-1257.792) [-1256.817] * (-1256.216) (-1257.262) [-1258.581] (-1259.360) -- 0:00:33
      475000 -- (-1258.355) (-1259.760) [-1261.822] (-1259.588) * (-1256.292) (-1260.274) (-1257.725) [-1258.011] -- 0:00:33

      Average standard deviation of split frequencies: 0.011302

      475500 -- [-1259.334] (-1258.922) (-1256.712) (-1259.325) * (-1256.993) [-1261.164] (-1256.351) (-1256.814) -- 0:00:33
      476000 -- [-1259.569] (-1259.339) (-1258.821) (-1259.530) * (-1256.841) [-1257.164] (-1260.201) (-1261.253) -- 0:00:33
      476500 -- (-1259.438) [-1258.853] (-1259.817) (-1263.492) * [-1257.183] (-1258.330) (-1259.468) (-1258.273) -- 0:00:32
      477000 -- (-1259.954) (-1257.130) [-1259.259] (-1259.691) * [-1257.347] (-1257.027) (-1258.311) (-1256.610) -- 0:00:32
      477500 -- (-1261.810) (-1256.699) (-1258.136) [-1259.694] * [-1259.697] (-1260.142) (-1260.075) (-1256.666) -- 0:00:32
      478000 -- (-1265.772) [-1257.150] (-1258.158) (-1258.386) * (-1258.410) [-1258.329] (-1259.553) (-1257.342) -- 0:00:32
      478500 -- (-1260.832) (-1267.365) [-1256.765] (-1257.222) * (-1259.697) (-1260.121) [-1259.597] (-1258.450) -- 0:00:32
      479000 -- (-1259.634) (-1259.787) [-1256.901] (-1263.080) * (-1259.697) (-1263.839) (-1258.878) [-1258.992] -- 0:00:32
      479500 -- (-1257.387) (-1258.459) [-1258.880] (-1260.080) * [-1259.965] (-1259.026) (-1258.769) (-1259.356) -- 0:00:32
      480000 -- (-1260.381) (-1256.621) (-1258.822) [-1259.667] * (-1259.957) (-1258.936) [-1255.851] (-1257.083) -- 0:00:32

      Average standard deviation of split frequencies: 0.011076

      480500 -- (-1258.854) (-1258.311) (-1261.609) [-1257.105] * (-1259.090) (-1258.358) (-1256.975) [-1259.134] -- 0:00:32
      481000 -- [-1262.854] (-1256.510) (-1258.825) (-1256.615) * (-1261.476) (-1256.868) [-1257.236] (-1257.048) -- 0:00:32
      481500 -- [-1259.063] (-1256.244) (-1259.201) (-1256.656) * (-1259.274) (-1261.443) (-1269.006) [-1257.330] -- 0:00:32
      482000 -- (-1257.174) (-1257.177) [-1257.959] (-1256.698) * (-1257.928) (-1261.240) (-1258.849) [-1259.503] -- 0:00:33
      482500 -- [-1258.584] (-1257.454) (-1258.530) (-1258.242) * (-1258.506) (-1259.373) (-1257.911) [-1258.430] -- 0:00:33
      483000 -- [-1257.652] (-1257.171) (-1258.696) (-1259.150) * (-1260.631) (-1262.051) (-1260.891) [-1257.783] -- 0:00:33
      483500 -- (-1257.653) (-1258.121) (-1261.983) [-1258.539] * (-1261.666) (-1258.185) (-1259.717) [-1258.877] -- 0:00:33
      484000 -- (-1258.169) (-1258.011) [-1258.449] (-1256.078) * (-1255.947) (-1259.926) [-1256.739] (-1256.689) -- 0:00:33
      484500 -- (-1259.796) [-1259.222] (-1256.435) (-1256.279) * (-1256.135) (-1257.170) [-1256.667] (-1257.800) -- 0:00:32
      485000 -- (-1257.505) [-1257.278] (-1258.588) (-1257.146) * (-1256.891) (-1256.911) [-1256.671] (-1257.477) -- 0:00:32

      Average standard deviation of split frequencies: 0.011411

      485500 -- (-1259.606) [-1258.936] (-1257.949) (-1259.667) * (-1256.198) (-1256.584) (-1256.615) [-1257.338] -- 0:00:32
      486000 -- (-1262.996) (-1258.200) [-1256.415] (-1260.529) * (-1260.116) (-1259.834) (-1258.639) [-1257.657] -- 0:00:32
      486500 -- [-1258.405] (-1259.402) (-1256.635) (-1258.756) * (-1261.160) (-1256.991) [-1259.525] (-1260.890) -- 0:00:32
      487000 -- (-1265.111) [-1256.786] (-1256.969) (-1257.105) * (-1258.109) [-1256.820] (-1266.240) (-1260.309) -- 0:00:32
      487500 -- (-1260.096) (-1260.476) [-1257.575] (-1257.464) * (-1261.199) [-1256.817] (-1261.206) (-1261.272) -- 0:00:32
      488000 -- (-1258.504) (-1258.381) (-1257.562) [-1256.945] * (-1261.357) (-1259.580) (-1263.130) [-1257.004] -- 0:00:32
      488500 -- [-1258.098] (-1259.568) (-1259.491) (-1258.972) * (-1261.717) (-1260.698) [-1260.174] (-1256.800) -- 0:00:32
      489000 -- (-1259.138) (-1257.046) [-1257.732] (-1259.382) * (-1262.252) (-1259.785) [-1260.359] (-1257.320) -- 0:00:32
      489500 -- (-1256.228) (-1259.804) (-1258.111) [-1257.702] * (-1260.840) (-1261.452) (-1259.860) [-1260.622] -- 0:00:32
      490000 -- (-1257.061) (-1256.340) (-1257.849) [-1256.351] * (-1257.307) [-1259.311] (-1261.482) (-1258.772) -- 0:00:32

      Average standard deviation of split frequencies: 0.011416

      490500 -- (-1258.022) (-1260.256) (-1257.811) [-1256.533] * (-1261.910) (-1262.285) [-1257.864] (-1259.270) -- 0:00:32
      491000 -- (-1258.173) (-1259.873) (-1258.607) [-1257.711] * (-1259.065) (-1260.150) [-1258.297] (-1258.778) -- 0:00:32
      491500 -- (-1259.087) (-1260.047) (-1264.957) [-1257.976] * (-1256.348) (-1258.134) [-1259.193] (-1258.880) -- 0:00:32
      492000 -- (-1257.994) (-1257.778) (-1259.746) [-1258.142] * [-1258.222] (-1257.666) (-1257.507) (-1256.574) -- 0:00:32
      492500 -- [-1256.156] (-1258.770) (-1256.089) (-1258.916) * (-1256.887) (-1259.321) [-1258.063] (-1257.462) -- 0:00:31
      493000 -- [-1260.565] (-1258.903) (-1258.087) (-1257.807) * (-1263.409) (-1258.428) (-1258.398) [-1258.991] -- 0:00:31
      493500 -- (-1258.314) [-1257.997] (-1257.151) (-1256.861) * (-1259.719) (-1261.018) (-1257.785) [-1257.169] -- 0:00:31
      494000 -- (-1259.533) (-1259.629) [-1258.362] (-1258.239) * (-1258.554) (-1256.425) [-1258.507] (-1257.167) -- 0:00:31
      494500 -- (-1259.717) [-1261.714] (-1260.909) (-1260.482) * [-1258.248] (-1258.103) (-1258.038) (-1262.597) -- 0:00:31
      495000 -- (-1256.175) (-1258.410) [-1259.956] (-1257.187) * (-1256.942) (-1258.429) [-1256.171] (-1261.324) -- 0:00:31

      Average standard deviation of split frequencies: 0.011461

      495500 -- (-1256.929) (-1257.159) [-1257.386] (-1256.839) * [-1258.304] (-1258.941) (-1258.875) (-1263.918) -- 0:00:31
      496000 -- (-1257.354) [-1258.139] (-1258.442) (-1257.160) * (-1256.548) (-1257.336) [-1259.994] (-1262.622) -- 0:00:31
      496500 -- [-1256.606] (-1258.562) (-1259.167) (-1258.535) * (-1262.915) [-1257.051] (-1259.465) (-1258.010) -- 0:00:31
      497000 -- (-1257.105) (-1258.538) (-1256.702) [-1259.369] * [-1259.333] (-1257.727) (-1260.437) (-1259.213) -- 0:00:32
      497500 -- (-1263.189) (-1257.165) (-1259.371) [-1258.029] * (-1261.853) (-1257.218) [-1259.207] (-1257.406) -- 0:00:32
      498000 -- [-1258.012] (-1260.222) (-1259.905) (-1261.165) * (-1257.447) [-1257.375] (-1259.205) (-1259.492) -- 0:00:32
      498500 -- (-1257.268) [-1260.500] (-1258.758) (-1257.595) * [-1257.244] (-1257.328) (-1258.201) (-1257.230) -- 0:00:32
      499000 -- (-1257.389) (-1262.390) [-1258.686] (-1258.333) * (-1259.698) [-1256.747] (-1257.795) (-1259.996) -- 0:00:32
      499500 -- (-1258.634) (-1257.043) (-1257.188) [-1257.287] * (-1257.757) (-1257.183) (-1257.107) [-1257.017] -- 0:00:32
      500000 -- [-1257.268] (-1257.547) (-1257.885) (-1258.415) * (-1258.868) (-1257.692) [-1257.672] (-1259.737) -- 0:00:32

      Average standard deviation of split frequencies: 0.011243

      500500 -- (-1256.496) (-1258.396) [-1257.410] (-1256.069) * [-1258.487] (-1258.229) (-1257.975) (-1260.571) -- 0:00:31
      501000 -- (-1262.859) (-1258.446) [-1258.135] (-1256.849) * [-1259.395] (-1259.503) (-1257.923) (-1262.245) -- 0:00:31
      501500 -- (-1256.717) (-1256.349) (-1259.889) [-1257.285] * [-1256.516] (-1256.887) (-1258.087) (-1259.081) -- 0:00:31
      502000 -- [-1258.896] (-1258.541) (-1260.360) (-1259.042) * [-1257.235] (-1256.738) (-1259.445) (-1257.446) -- 0:00:31
      502500 -- (-1256.943) (-1260.482) (-1257.270) [-1256.824] * (-1259.951) (-1258.739) (-1260.905) [-1257.551] -- 0:00:31
      503000 -- (-1256.282) (-1258.136) (-1256.773) [-1260.053] * (-1257.087) [-1259.559] (-1260.475) (-1258.170) -- 0:00:31
      503500 -- (-1256.876) (-1259.234) (-1257.911) [-1260.053] * (-1258.396) [-1258.131] (-1257.811) (-1258.502) -- 0:00:31
      504000 -- (-1260.259) [-1257.763] (-1257.764) (-1258.024) * (-1256.504) [-1256.965] (-1259.572) (-1260.765) -- 0:00:31
      504500 -- (-1264.800) [-1256.196] (-1258.440) (-1256.998) * (-1256.533) (-1261.660) [-1260.928] (-1257.048) -- 0:00:31
      505000 -- [-1260.198] (-1259.570) (-1261.937) (-1259.597) * [-1257.834] (-1259.985) (-1256.961) (-1256.911) -- 0:00:31

      Average standard deviation of split frequencies: 0.011180

      505500 -- (-1256.492) (-1259.646) [-1258.003] (-1257.083) * (-1258.450) [-1257.342] (-1259.947) (-1260.091) -- 0:00:31
      506000 -- [-1257.016] (-1258.609) (-1258.404) (-1259.065) * (-1257.731) (-1258.943) (-1256.869) [-1258.248] -- 0:00:31
      506500 -- (-1257.925) (-1258.180) (-1258.117) [-1258.804] * (-1256.488) [-1258.426] (-1261.290) (-1258.817) -- 0:00:31
      507000 -- (-1257.943) (-1257.943) [-1256.757] (-1259.084) * [-1257.203] (-1258.851) (-1260.828) (-1258.216) -- 0:00:31
      507500 -- (-1257.801) [-1256.876] (-1258.469) (-1260.302) * [-1257.061] (-1258.026) (-1260.437) (-1257.500) -- 0:00:31
      508000 -- (-1257.432) [-1257.162] (-1258.790) (-1260.189) * (-1256.865) (-1258.467) (-1260.011) [-1257.354] -- 0:00:30
      508500 -- (-1256.674) (-1257.030) [-1259.209] (-1258.296) * (-1260.394) (-1257.797) (-1261.522) [-1257.423] -- 0:00:30
      509000 -- (-1257.625) [-1257.067] (-1256.690) (-1259.326) * (-1256.834) (-1257.019) (-1257.029) [-1259.533] -- 0:00:30
      509500 -- (-1259.098) [-1260.272] (-1256.809) (-1258.147) * [-1263.335] (-1259.026) (-1258.921) (-1257.925) -- 0:00:30
      510000 -- (-1258.756) [-1257.846] (-1260.128) (-1257.782) * (-1257.270) [-1260.803] (-1257.749) (-1258.677) -- 0:00:30

      Average standard deviation of split frequencies: 0.011132

      510500 -- (-1256.803) [-1259.396] (-1257.527) (-1258.124) * (-1256.944) [-1263.833] (-1263.010) (-1259.518) -- 0:00:30
      511000 -- [-1257.376] (-1258.310) (-1258.449) (-1257.155) * (-1256.620) (-1258.293) (-1260.087) [-1259.168] -- 0:00:30
      511500 -- (-1257.113) (-1259.739) [-1257.914] (-1258.140) * (-1256.492) (-1259.673) (-1257.268) [-1257.144] -- 0:00:30
      512000 -- [-1258.760] (-1267.425) (-1258.922) (-1259.673) * (-1256.796) [-1260.016] (-1257.590) (-1256.604) -- 0:00:30
      512500 -- [-1258.639] (-1264.133) (-1258.375) (-1258.918) * (-1262.262) [-1258.713] (-1257.607) (-1259.307) -- 0:00:31
      513000 -- (-1259.921) (-1258.709) [-1256.571] (-1257.032) * (-1262.990) (-1258.791) (-1259.793) [-1257.996] -- 0:00:31
      513500 -- (-1258.631) (-1257.527) (-1259.950) [-1256.572] * [-1257.629] (-1257.420) (-1259.791) (-1259.942) -- 0:00:31
      514000 -- (-1259.410) (-1263.560) [-1261.295] (-1258.724) * (-1261.200) (-1258.999) (-1261.113) [-1258.560] -- 0:00:31
      514500 -- (-1261.248) (-1260.110) [-1258.517] (-1261.675) * (-1257.350) (-1258.962) (-1259.751) [-1259.237] -- 0:00:31
      515000 -- (-1260.537) (-1260.116) [-1256.154] (-1262.671) * (-1257.353) (-1257.657) [-1256.784] (-1257.774) -- 0:00:31

      Average standard deviation of split frequencies: 0.011178

      515500 -- (-1258.169) (-1257.955) [-1257.473] (-1258.236) * [-1258.285] (-1257.631) (-1257.511) (-1259.330) -- 0:00:31
      516000 -- (-1258.010) [-1258.651] (-1256.145) (-1260.454) * (-1257.280) (-1256.927) [-1258.626] (-1258.617) -- 0:00:30
      516500 -- (-1259.075) [-1257.035] (-1261.375) (-1260.381) * [-1257.951] (-1257.718) (-1257.185) (-1256.818) -- 0:00:30
      517000 -- (-1260.054) (-1258.853) [-1258.504] (-1261.401) * [-1257.285] (-1258.545) (-1257.468) (-1258.029) -- 0:00:30
      517500 -- (-1259.230) (-1256.919) [-1257.247] (-1258.389) * (-1259.415) [-1257.322] (-1256.733) (-1257.061) -- 0:00:30
      518000 -- (-1256.208) [-1259.455] (-1257.093) (-1259.095) * (-1260.185) (-1259.341) [-1256.733] (-1258.789) -- 0:00:30
      518500 -- (-1257.079) (-1260.596) [-1257.559] (-1257.562) * (-1262.578) (-1259.401) [-1257.495] (-1264.330) -- 0:00:30
      519000 -- (-1259.856) (-1257.979) (-1259.220) [-1257.129] * (-1261.560) [-1258.345] (-1260.029) (-1260.117) -- 0:00:30
      519500 -- (-1266.222) [-1260.104] (-1260.178) (-1258.415) * (-1259.232) (-1258.345) (-1263.037) [-1258.584] -- 0:00:30
      520000 -- (-1260.309) [-1261.745] (-1258.685) (-1261.379) * [-1257.331] (-1259.661) (-1262.772) (-1257.511) -- 0:00:30

      Average standard deviation of split frequencies: 0.010492

      520500 -- (-1259.970) [-1261.813] (-1261.345) (-1259.347) * (-1257.790) [-1256.284] (-1260.966) (-1256.380) -- 0:00:30
      521000 -- (-1258.602) (-1260.200) [-1258.882] (-1261.029) * (-1257.866) (-1257.378) [-1257.858] (-1258.351) -- 0:00:30
      521500 -- (-1259.548) (-1258.917) [-1257.099] (-1256.886) * (-1262.653) [-1259.839] (-1258.916) (-1257.201) -- 0:00:30
      522000 -- (-1256.906) (-1258.017) [-1261.619] (-1257.205) * (-1261.004) (-1256.718) [-1258.862] (-1259.658) -- 0:00:30
      522500 -- (-1256.978) [-1257.311] (-1261.332) (-1258.695) * (-1258.745) (-1256.848) (-1257.741) [-1257.529] -- 0:00:30
      523000 -- (-1258.052) (-1257.461) [-1261.591] (-1260.044) * (-1263.645) [-1257.802] (-1259.152) (-1259.383) -- 0:00:30
      523500 -- (-1258.038) [-1259.314] (-1260.855) (-1258.733) * (-1258.974) (-1258.259) (-1257.940) [-1258.501] -- 0:00:30
      524000 -- [-1258.476] (-1260.188) (-1259.423) (-1258.916) * (-1256.821) (-1259.140) (-1256.513) [-1256.058] -- 0:00:29
      524500 -- [-1258.954] (-1260.443) (-1263.947) (-1259.566) * [-1257.162] (-1259.301) (-1257.288) (-1256.911) -- 0:00:29
      525000 -- (-1258.308) (-1257.682) [-1259.988] (-1256.451) * (-1261.811) (-1257.621) (-1260.653) [-1256.329] -- 0:00:29

      Average standard deviation of split frequencies: 0.010702

      525500 -- [-1257.321] (-1261.188) (-1261.686) (-1258.204) * (-1262.748) (-1257.064) (-1258.572) [-1256.266] -- 0:00:29
      526000 -- (-1257.321) (-1261.129) [-1259.911] (-1256.464) * (-1257.093) (-1256.602) (-1261.116) [-1256.826] -- 0:00:29
      526500 -- (-1258.795) (-1257.050) (-1259.621) [-1256.397] * [-1256.087] (-1256.588) (-1258.518) (-1259.803) -- 0:00:29
      527000 -- (-1262.929) [-1256.869] (-1259.567) (-1257.350) * (-1256.834) (-1256.323) (-1256.928) [-1261.772] -- 0:00:29
      527500 -- (-1258.525