--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 16:22:27 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0232/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1109.95 -1113.43 2 -1109.94 -1113.87 -------------------------------------- TOTAL -1109.94 -1113.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902065 0.088072 0.386960 1.494742 0.870721 1305.03 1403.02 1.000 r(A<->C){all} 0.178531 0.022157 0.000094 0.482802 0.142521 218.37 250.19 1.001 r(A<->G){all} 0.179582 0.022355 0.000100 0.485219 0.141037 115.28 200.53 1.000 r(A<->T){all} 0.160966 0.018394 0.000121 0.439138 0.126247 194.67 259.64 1.006 r(C<->G){all} 0.157485 0.017005 0.000124 0.415606 0.126470 219.39 227.39 1.000 r(C<->T){all} 0.165162 0.019629 0.000044 0.456782 0.126685 96.65 189.01 1.006 r(G<->T){all} 0.158274 0.019104 0.000076 0.436428 0.121012 214.31 278.53 1.001 pi(A){all} 0.160965 0.000167 0.136336 0.186529 0.160425 1297.17 1399.09 1.000 pi(C){all} 0.278230 0.000242 0.249051 0.309356 0.278067 1214.56 1265.08 1.000 pi(G){all} 0.344266 0.000291 0.311446 0.377867 0.344278 1150.27 1206.52 1.000 pi(T){all} 0.216539 0.000207 0.187748 0.242739 0.216363 1385.71 1406.61 1.000 alpha{1,2} 0.417241 0.242077 0.000204 1.366887 0.240380 1200.86 1269.74 1.000 alpha{3} 0.455620 0.225402 0.000152 1.420161 0.294439 1245.73 1345.97 1.000 pinvar{all} 0.998119 0.000005 0.993808 0.999998 0.998834 1129.29 1248.66 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1063.605986 Model 2: PositiveSelection -1063.60576 Model 0: one-ratio -1063.605786 Model 7: beta -1063.605535 Model 8: beta&w>1 -1063.605535 Model 0 vs 1 3.999999998995918E-4 Model 2 vs 1 4.5200000022305176E-4 Model 8 vs 7 0.0
>C1 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C2 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C3 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C4 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C5 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C6 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=274 C1 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C2 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C3 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C4 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C5 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C6 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL ************************************************** C1 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C2 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C3 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C4 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C5 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C6 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL ************************************************** C1 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C2 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C3 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C4 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C5 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C6 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG ************************************************** C1 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C2 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C3 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C4 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C5 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C6 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG ************************************************** C1 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C2 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C3 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C4 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C5 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C6 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL ************************************************** C1 TLHGLRLVFERNREAQRGRLKTAR C2 TLHGLRLVFERNREAQRGRLKTAR C3 TLHGLRLVFERNREAQRGRLKTAR C4 TLHGLRLVFERNREAQRGRLKTAR C5 TLHGLRLVFERNREAQRGRLKTAR C6 TLHGLRLVFERNREAQRGRLKTAR ************************ PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] Relaxation Summary: [8220]--->[8220] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.500 Mb, Max= 30.831 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C2 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C3 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C4 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C5 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL C6 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL ************************************************** C1 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C2 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C3 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C4 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C5 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL C6 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL ************************************************** C1 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C2 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C3 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C4 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C5 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG C6 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG ************************************************** C1 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C2 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C3 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C4 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C5 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG C6 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG ************************************************** C1 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C2 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C3 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C4 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C5 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL C6 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL ************************************************** C1 TLHGLRLVFERNREAQRGRLKTAR C2 TLHGLRLVFERNREAQRGRLKTAR C3 TLHGLRLVFERNREAQRGRLKTAR C4 TLHGLRLVFERNREAQRGRLKTAR C5 TLHGLRLVFERNREAQRGRLKTAR C6 TLHGLRLVFERNREAQRGRLKTAR ************************ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT C2 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT C3 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT C4 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT C5 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT C6 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT ************************************************** C1 GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA C2 GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA C3 GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA C4 GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA C5 GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA C6 GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA ************************************************** C1 CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG C2 CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG C3 CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG C4 CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG C5 CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG C6 CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ************************************************** C1 ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT C2 ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT C3 ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT C4 ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT C5 ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT C6 ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT ************************************************** C1 CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT C2 CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT C3 CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT C4 CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT C5 CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT C6 CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT ************************************************** C1 CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG C2 CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG C3 CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG C4 CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG C5 CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG C6 CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG ************************************************** C1 CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT C2 CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT C3 CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT C4 CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT C5 CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT C6 CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT ************************************************** C1 GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT C2 GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT C3 GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT C4 GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT C5 GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT C6 GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT ************************************************** C1 CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT C2 CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT C3 CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT C4 CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT C5 CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT C6 CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT ************************************************** C1 GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC C2 GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC C3 GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC C4 GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC C5 GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC C6 GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC ************************************************** C1 TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA C2 TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA C3 TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA C4 TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA C5 TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA C6 TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA ************************************************** C1 AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG C2 AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG C3 AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG C4 AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG C5 AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG C6 AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG ************************************************** C1 CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC C2 CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC C3 CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC C4 CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC C5 CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC C6 CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC ************************************************** C1 CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC C2 CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC C3 CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC C4 CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC C5 CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC C6 CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC ************************************************** C1 CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG C2 CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG C3 CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG C4 CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG C5 CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG C6 CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ************************************************** C1 ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG C2 ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG C3 ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG C4 ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG C5 ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG C6 ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG ************************************************** C1 TGGCCGGTTGAAGACGGCGCGC C2 TGGCCGGTTGAAGACGGCGCGC C3 TGGCCGGTTGAAGACGGCGCGC C4 TGGCCGGTTGAAGACGGCGCGC C5 TGGCCGGTTGAAGACGGCGCGC C6 TGGCCGGTTGAAGACGGCGCGC ********************** >C1 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >C2 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >C3 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >C4 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >C5 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >C6 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >C1 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C2 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C3 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C4 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C5 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >C6 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 822 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579796472 Setting output file names to "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1698788827 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0622007634 Seed = 83754604 Swapseed = 1579796472 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1839.675402 -- -24.965149 Chain 2 -- -1839.675402 -- -24.965149 Chain 3 -- -1839.675295 -- -24.965149 Chain 4 -- -1839.675402 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1839.675402 -- -24.965149 Chain 2 -- -1839.675122 -- -24.965149 Chain 3 -- -1839.675402 -- -24.965149 Chain 4 -- -1839.675122 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1839.675] (-1839.675) (-1839.675) (-1839.675) * [-1839.675] (-1839.675) (-1839.675) (-1839.675) 500 -- (-1138.828) (-1138.499) (-1141.041) [-1124.203] * (-1139.035) (-1130.015) [-1133.703] (-1151.373) -- 0:00:00 1000 -- [-1117.241] (-1125.143) (-1126.239) (-1118.906) * (-1118.247) [-1120.346] (-1120.381) (-1132.460) -- 0:00:00 1500 -- (-1124.431) (-1123.673) (-1121.653) [-1117.253] * (-1123.932) (-1118.705) [-1122.414] (-1122.151) -- 0:00:00 2000 -- [-1119.440] (-1123.510) (-1116.953) (-1122.417) * [-1127.968] (-1118.468) (-1120.622) (-1128.345) -- 0:00:00 2500 -- (-1118.775) (-1121.860) (-1116.522) [-1124.183] * [-1117.879] (-1117.111) (-1115.160) (-1119.901) -- 0:00:00 3000 -- (-1120.026) (-1123.481) (-1118.908) [-1120.188] * (-1123.802) (-1115.237) [-1117.988] (-1119.338) -- 0:00:00 3500 -- (-1115.322) [-1115.825] (-1120.200) (-1123.152) * (-1116.984) (-1115.048) (-1114.769) [-1115.547] -- 0:00:00 4000 -- (-1123.457) (-1116.876) [-1123.128] (-1122.157) * (-1120.387) (-1124.844) [-1116.359] (-1123.961) -- 0:00:00 4500 -- [-1117.292] (-1123.901) (-1115.542) (-1119.268) * (-1120.902) [-1117.068] (-1118.798) (-1119.583) -- 0:00:00 5000 -- (-1121.327) (-1121.533) (-1115.674) [-1118.384] * (-1121.991) [-1113.518] (-1123.253) (-1124.136) -- 0:00:00 Average standard deviation of split frequencies: 0.092852 5500 -- [-1115.685] (-1125.238) (-1125.831) (-1117.847) * [-1121.996] (-1121.706) (-1119.713) (-1121.526) -- 0:00:00 6000 -- (-1118.924) (-1123.091) [-1120.292] (-1119.086) * (-1116.747) [-1118.205] (-1127.749) (-1128.932) -- 0:00:00 6500 -- (-1115.915) [-1123.320] (-1120.750) (-1117.200) * (-1122.765) [-1117.784] (-1117.385) (-1122.149) -- 0:00:00 7000 -- (-1116.678) [-1117.331] (-1124.738) (-1121.004) * (-1117.244) (-1118.820) [-1117.960] (-1125.052) -- 0:00:00 7500 -- (-1126.647) [-1115.621] (-1119.581) (-1121.207) * (-1117.450) (-1123.096) (-1120.129) [-1119.920] -- 0:00:00 8000 -- (-1123.778) (-1115.041) (-1122.231) [-1117.187] * (-1120.287) (-1120.727) [-1119.715] (-1115.913) -- 0:00:00 8500 -- [-1117.375] (-1124.559) (-1118.401) (-1114.470) * [-1117.819] (-1121.304) (-1120.485) (-1123.656) -- 0:00:00 9000 -- (-1123.764) (-1122.313) (-1120.242) [-1118.376] * [-1115.317] (-1120.218) (-1114.463) (-1123.141) -- 0:00:00 9500 -- (-1120.802) [-1120.871] (-1122.862) (-1115.508) * (-1121.260) [-1115.889] (-1127.122) (-1116.060) -- 0:00:00 10000 -- [-1120.204] (-1121.104) (-1124.831) (-1115.040) * (-1120.704) (-1122.048) (-1126.038) [-1120.722] -- 0:00:00 Average standard deviation of split frequencies: 0.067454 10500 -- (-1118.864) (-1118.160) [-1118.913] (-1124.069) * (-1119.898) (-1115.521) (-1116.589) [-1114.926] -- 0:00:00 11000 -- (-1117.565) [-1116.690] (-1124.647) (-1119.784) * (-1122.119) [-1119.949] (-1127.377) (-1126.878) -- 0:00:00 11500 -- [-1118.877] (-1119.374) (-1116.612) (-1115.916) * (-1122.209) (-1123.893) (-1119.603) [-1118.507] -- 0:00:00 12000 -- (-1121.005) [-1119.036] (-1119.952) (-1126.822) * (-1125.500) (-1117.463) (-1121.571) [-1122.016] -- 0:00:00 12500 -- (-1118.719) (-1118.555) [-1115.653] (-1114.736) * (-1119.440) (-1122.540) [-1119.006] (-1122.606) -- 0:00:00 13000 -- (-1123.587) [-1121.166] (-1114.769) (-1116.489) * (-1128.637) (-1122.435) (-1128.638) [-1124.726] -- 0:00:00 13500 -- (-1118.813) (-1119.520) [-1117.389] (-1122.597) * [-1121.480] (-1126.081) (-1126.660) (-1116.182) -- 0:00:00 14000 -- (-1125.503) [-1123.342] (-1113.206) (-1113.531) * (-1125.880) (-1115.768) (-1123.453) [-1119.483] -- 0:00:00 14500 -- (-1122.470) (-1127.046) (-1120.491) [-1118.978] * (-1120.813) [-1115.606] (-1114.250) (-1116.446) -- 0:00:00 15000 -- (-1123.681) [-1120.757] (-1127.347) (-1124.045) * [-1119.565] (-1126.552) (-1119.083) (-1135.765) -- 0:01:05 Average standard deviation of split frequencies: 0.060476 15500 -- [-1116.513] (-1118.954) (-1116.317) (-1119.256) * (-1114.031) (-1127.896) [-1118.852] (-1118.646) -- 0:01:03 16000 -- (-1120.626) (-1117.057) (-1120.493) [-1116.082] * (-1119.840) (-1120.132) [-1119.462] (-1116.939) -- 0:01:01 16500 -- (-1142.042) (-1119.679) (-1117.909) [-1124.128] * (-1119.406) (-1128.237) (-1125.047) [-1118.693] -- 0:00:59 17000 -- (-1119.913) (-1116.290) (-1114.690) [-1116.695] * (-1132.318) (-1121.194) [-1119.446] (-1124.155) -- 0:00:57 17500 -- (-1121.828) [-1113.973] (-1127.610) (-1118.594) * (-1123.659) (-1119.543) [-1120.174] (-1122.064) -- 0:00:56 18000 -- [-1121.349] (-1119.260) (-1120.166) (-1119.460) * [-1113.032] (-1115.967) (-1130.719) (-1133.131) -- 0:00:54 18500 -- (-1120.797) [-1116.314] (-1125.362) (-1119.677) * (-1122.900) [-1119.581] (-1121.934) (-1120.652) -- 0:00:53 19000 -- (-1122.504) [-1121.514] (-1124.402) (-1122.707) * (-1120.597) (-1115.167) [-1118.073] (-1125.619) -- 0:00:51 19500 -- (-1134.261) (-1117.399) (-1123.143) [-1119.257] * (-1126.260) [-1116.989] (-1117.186) (-1117.814) -- 0:00:50 20000 -- (-1120.204) [-1117.875] (-1120.011) (-1119.165) * (-1122.242) [-1126.558] (-1125.849) (-1121.310) -- 0:00:49 Average standard deviation of split frequencies: 0.035640 20500 -- (-1119.854) [-1118.759] (-1124.919) (-1116.552) * (-1124.813) (-1120.538) (-1117.487) [-1117.631] -- 0:00:47 21000 -- [-1119.422] (-1117.859) (-1125.864) (-1117.074) * (-1120.044) (-1123.895) (-1117.317) [-1116.923] -- 0:00:46 21500 -- [-1124.168] (-1121.198) (-1119.507) (-1122.355) * (-1124.184) (-1118.063) (-1115.302) [-1115.827] -- 0:00:45 22000 -- [-1115.317] (-1120.461) (-1124.798) (-1118.502) * (-1114.969) [-1117.315] (-1121.796) (-1115.905) -- 0:00:44 22500 -- (-1121.331) [-1118.807] (-1125.159) (-1118.126) * (-1122.570) [-1122.740] (-1119.676) (-1123.400) -- 0:00:43 23000 -- (-1120.467) (-1115.418) (-1115.766) [-1123.462] * (-1122.713) (-1124.298) (-1130.269) [-1124.496] -- 0:00:42 23500 -- (-1123.185) (-1117.559) [-1118.590] (-1117.396) * (-1118.480) (-1128.423) (-1113.784) [-1123.648] -- 0:00:41 24000 -- (-1118.292) (-1120.231) (-1117.630) [-1118.226] * (-1126.213) [-1123.050] (-1110.953) (-1126.019) -- 0:00:40 24500 -- (-1119.439) [-1125.115] (-1120.539) (-1123.548) * (-1116.862) (-1123.614) [-1110.404] (-1120.525) -- 0:00:39 25000 -- (-1132.092) (-1123.802) (-1117.355) [-1119.217] * (-1120.985) [-1124.561] (-1113.381) (-1117.867) -- 0:00:39 Average standard deviation of split frequencies: 0.035355 25500 -- [-1112.111] (-1121.982) (-1124.583) (-1115.325) * (-1127.430) (-1122.465) [-1112.255] (-1121.733) -- 0:00:38 26000 -- (-1110.966) (-1133.024) (-1128.978) [-1121.471] * (-1114.622) (-1124.795) [-1110.079] (-1124.589) -- 0:00:37 26500 -- (-1111.418) (-1123.627) [-1120.645] (-1116.454) * (-1120.602) (-1113.197) [-1110.205] (-1117.656) -- 0:00:36 27000 -- [-1108.844] (-1137.279) (-1123.369) (-1116.535) * (-1117.606) (-1122.431) [-1108.843] (-1118.496) -- 0:00:36 27500 -- [-1109.137] (-1114.272) (-1121.311) (-1122.020) * [-1113.679] (-1128.879) (-1109.718) (-1116.830) -- 0:00:35 28000 -- (-1113.316) [-1114.782] (-1124.728) (-1124.355) * (-1115.349) (-1122.032) (-1110.324) [-1117.879] -- 0:00:34 28500 -- (-1111.363) [-1111.521] (-1118.599) (-1128.380) * (-1113.760) (-1120.821) [-1111.250] (-1122.669) -- 0:00:34 29000 -- [-1109.109] (-1110.758) (-1114.635) (-1128.188) * (-1114.102) (-1110.742) [-1113.319] (-1124.053) -- 0:00:33 29500 -- (-1110.401) (-1110.186) (-1123.686) [-1119.058] * (-1110.733) (-1113.887) (-1111.492) [-1115.382] -- 0:00:32 30000 -- (-1110.293) [-1110.424] (-1118.397) (-1120.110) * (-1109.378) (-1112.401) (-1109.823) [-1117.691] -- 0:00:32 Average standard deviation of split frequencies: 0.036124 30500 -- [-1110.297] (-1110.798) (-1120.089) (-1119.977) * (-1109.928) (-1111.028) (-1111.132) [-1116.201] -- 0:01:03 31000 -- (-1109.878) (-1108.825) [-1122.515] (-1133.453) * (-1109.188) (-1112.129) [-1112.992] (-1113.507) -- 0:01:02 31500 -- (-1111.963) (-1113.095) [-1111.345] (-1117.667) * [-1109.464] (-1111.017) (-1109.823) (-1113.129) -- 0:01:01 32000 -- (-1112.572) [-1109.812] (-1109.843) (-1110.025) * [-1113.138] (-1109.999) (-1109.985) (-1111.923) -- 0:01:00 32500 -- (-1110.257) (-1108.721) [-1110.829] (-1108.273) * (-1112.438) (-1112.329) (-1111.103) [-1110.850] -- 0:00:59 33000 -- (-1109.313) (-1111.138) (-1110.383) [-1110.097] * (-1116.244) (-1113.998) (-1109.276) [-1111.942] -- 0:00:58 33500 -- [-1109.287] (-1111.646) (-1110.610) (-1109.081) * [-1109.396] (-1111.701) (-1111.242) (-1111.085) -- 0:00:57 34000 -- (-1112.567) (-1108.764) [-1110.388] (-1109.460) * [-1109.023] (-1112.655) (-1112.395) (-1109.256) -- 0:00:56 34500 -- (-1114.711) (-1109.452) [-1112.636] (-1111.018) * (-1109.704) (-1111.952) (-1114.565) [-1109.185] -- 0:00:55 35000 -- (-1110.636) (-1113.126) (-1110.265) [-1113.218] * [-1109.582] (-1110.658) (-1114.928) (-1108.742) -- 0:00:55 Average standard deviation of split frequencies: 0.028946 35500 -- (-1109.926) (-1111.422) [-1109.665] (-1110.673) * (-1111.542) (-1110.914) [-1109.263] (-1112.258) -- 0:00:54 36000 -- [-1111.371] (-1110.155) (-1110.339) (-1111.400) * (-1115.802) [-1111.017] (-1109.463) (-1114.104) -- 0:00:53 36500 -- (-1119.173) (-1112.888) [-1109.926] (-1113.090) * (-1115.357) (-1110.102) [-1110.946] (-1111.150) -- 0:00:52 37000 -- (-1115.394) (-1113.411) (-1110.322) [-1110.596] * (-1111.759) (-1110.007) [-1110.852] (-1111.060) -- 0:00:52 37500 -- (-1114.967) (-1113.062) (-1108.891) [-1112.214] * (-1112.975) [-1110.656] (-1110.583) (-1115.901) -- 0:00:51 38000 -- (-1115.567) [-1113.491] (-1112.259) (-1111.307) * (-1109.285) [-1108.716] (-1109.759) (-1110.050) -- 0:00:50 38500 -- (-1113.703) (-1111.871) (-1111.765) [-1109.686] * [-1109.575] (-1108.950) (-1110.186) (-1110.092) -- 0:00:49 39000 -- [-1111.615] (-1114.232) (-1111.622) (-1113.146) * (-1112.529) (-1117.847) (-1109.120) [-1110.167] -- 0:00:49 39500 -- (-1110.016) (-1111.371) [-1109.955] (-1110.628) * (-1112.421) (-1110.635) [-1109.645] (-1110.328) -- 0:00:48 40000 -- (-1112.334) (-1110.282) (-1113.673) [-1108.737] * [-1110.377] (-1110.631) (-1111.019) (-1112.340) -- 0:00:48 Average standard deviation of split frequencies: 0.031878 40500 -- (-1111.218) [-1109.243] (-1108.926) (-1108.971) * [-1109.427] (-1109.869) (-1109.411) (-1111.215) -- 0:00:47 41000 -- (-1109.543) [-1108.523] (-1109.440) (-1111.429) * [-1109.669] (-1108.835) (-1110.638) (-1109.896) -- 0:00:46 41500 -- (-1111.188) (-1108.368) (-1110.925) [-1111.009] * (-1109.596) (-1112.248) [-1111.900] (-1111.382) -- 0:00:46 42000 -- (-1110.512) (-1111.932) [-1110.292] (-1111.801) * [-1110.600] (-1114.186) (-1114.395) (-1111.358) -- 0:00:45 42500 -- (-1113.634) (-1109.766) (-1111.261) [-1110.817] * [-1109.796] (-1109.195) (-1114.107) (-1111.413) -- 0:00:45 43000 -- (-1113.299) [-1110.124] (-1112.247) (-1110.304) * (-1109.588) [-1111.469] (-1111.614) (-1111.202) -- 0:00:44 43500 -- (-1111.597) (-1109.155) [-1114.426] (-1110.098) * (-1109.260) [-1110.804] (-1111.271) (-1110.962) -- 0:00:43 44000 -- [-1112.428] (-1111.096) (-1113.771) (-1110.155) * (-1109.157) (-1111.282) [-1109.547] (-1109.491) -- 0:00:43 44500 -- (-1113.966) (-1112.146) (-1111.689) [-1110.643] * [-1109.264] (-1110.211) (-1108.783) (-1110.028) -- 0:00:42 45000 -- (-1111.550) (-1112.947) [-1110.624] (-1110.317) * (-1116.037) (-1113.911) [-1112.264] (-1110.923) -- 0:00:42 Average standard deviation of split frequencies: 0.033818 45500 -- (-1110.725) (-1112.373) (-1109.591) [-1109.697] * [-1112.145] (-1110.535) (-1109.156) (-1109.733) -- 0:00:41 46000 -- (-1109.458) [-1110.335] (-1109.688) (-1113.200) * (-1112.135) (-1113.042) [-1108.850] (-1109.733) -- 0:00:41 46500 -- (-1110.499) (-1114.494) (-1109.375) [-1110.393] * (-1109.336) (-1110.316) [-1108.955] (-1110.765) -- 0:00:41 47000 -- (-1108.918) [-1111.341] (-1111.763) (-1110.513) * (-1110.007) [-1110.318] (-1110.591) (-1111.341) -- 0:01:00 47500 -- (-1111.852) (-1111.775) (-1109.493) [-1109.093] * (-1111.407) (-1109.436) (-1109.370) [-1111.765] -- 0:01:00 48000 -- (-1110.193) [-1111.778] (-1112.282) (-1109.309) * (-1111.512) [-1111.619] (-1111.272) (-1113.529) -- 0:00:59 48500 -- (-1109.628) (-1117.341) (-1112.325) [-1108.389] * (-1109.593) (-1109.966) [-1112.822] (-1114.042) -- 0:00:58 49000 -- [-1108.594] (-1111.246) (-1110.198) (-1108.218) * (-1111.010) [-1111.987] (-1110.590) (-1108.748) -- 0:00:58 49500 -- (-1109.222) (-1110.209) (-1110.196) [-1108.342] * (-1110.152) [-1112.715] (-1110.330) (-1110.658) -- 0:00:57 50000 -- (-1110.982) (-1110.013) (-1110.505) [-1111.084] * (-1109.000) (-1111.816) (-1109.359) [-1110.094] -- 0:00:57 Average standard deviation of split frequencies: 0.033672 50500 -- (-1108.804) (-1109.672) [-1110.139] (-1112.025) * [-1111.551] (-1111.149) (-1111.050) (-1110.211) -- 0:00:56 51000 -- (-1110.120) [-1109.232] (-1112.455) (-1111.238) * (-1113.546) (-1112.102) (-1110.397) [-1109.860] -- 0:00:55 51500 -- [-1110.290] (-1108.465) (-1115.034) (-1110.899) * [-1112.984] (-1111.182) (-1110.589) (-1111.030) -- 0:00:55 52000 -- (-1110.593) [-1109.377] (-1114.088) (-1112.540) * [-1110.633] (-1111.821) (-1109.946) (-1109.902) -- 0:00:54 52500 -- (-1110.894) (-1110.116) (-1111.441) [-1113.103] * (-1110.624) [-1110.892] (-1108.449) (-1110.274) -- 0:00:54 53000 -- (-1110.693) [-1111.327] (-1112.157) (-1113.210) * (-1110.648) (-1109.060) (-1109.766) [-1109.712] -- 0:00:53 53500 -- (-1111.824) (-1110.853) (-1110.463) [-1112.790] * (-1111.258) (-1109.651) [-1116.177] (-1112.580) -- 0:00:53 54000 -- (-1114.479) (-1109.734) (-1110.353) [-1109.984] * (-1110.956) [-1109.114] (-1111.044) (-1113.705) -- 0:00:52 54500 -- (-1114.621) (-1110.698) [-1110.594] (-1112.445) * (-1112.861) [-1108.670] (-1110.518) (-1112.063) -- 0:00:52 55000 -- (-1111.377) (-1110.063) (-1114.320) [-1110.186] * [-1110.725] (-1111.993) (-1112.776) (-1111.115) -- 0:00:51 Average standard deviation of split frequencies: 0.030127 55500 -- (-1113.380) (-1111.868) [-1111.003] (-1111.449) * (-1110.831) (-1112.151) [-1111.774] (-1109.528) -- 0:00:51 56000 -- (-1110.192) (-1108.828) (-1110.320) [-1109.773] * (-1109.945) (-1111.058) (-1109.839) [-1109.480] -- 0:00:50 56500 -- (-1112.582) (-1116.378) [-1111.112] (-1111.244) * (-1113.911) (-1110.849) [-1110.336] (-1111.769) -- 0:00:50 57000 -- (-1112.819) (-1109.619) [-1109.080] (-1111.053) * (-1110.133) (-1111.067) [-1111.624] (-1110.222) -- 0:00:49 57500 -- (-1109.021) (-1112.123) (-1109.099) [-1112.307] * (-1110.528) (-1116.966) [-1111.549] (-1109.510) -- 0:00:49 58000 -- (-1109.065) (-1109.389) [-1111.316] (-1111.940) * (-1116.830) (-1120.702) [-1109.494] (-1109.855) -- 0:00:48 58500 -- (-1114.170) [-1109.767] (-1110.862) (-1111.139) * (-1114.787) [-1111.396] (-1110.686) (-1109.002) -- 0:00:48 59000 -- (-1113.783) [-1110.848] (-1109.981) (-1109.911) * (-1112.019) (-1112.571) [-1112.234] (-1110.231) -- 0:00:47 59500 -- (-1111.433) [-1110.606] (-1109.443) (-1110.778) * (-1110.060) (-1112.160) [-1110.302] (-1110.141) -- 0:00:47 60000 -- (-1111.362) [-1109.512] (-1112.665) (-1111.106) * (-1110.435) (-1112.450) (-1112.170) [-1108.730] -- 0:00:47 Average standard deviation of split frequencies: 0.022146 60500 -- (-1109.903) (-1110.259) (-1121.102) [-1109.725] * [-1108.653] (-1114.469) (-1115.334) (-1112.300) -- 0:00:46 61000 -- [-1109.223] (-1109.796) (-1117.201) (-1111.285) * [-1109.382] (-1109.835) (-1109.292) (-1114.360) -- 0:00:46 61500 -- (-1109.463) (-1111.568) (-1110.661) [-1110.439] * (-1110.591) [-1111.263] (-1110.305) (-1116.087) -- 0:00:45 62000 -- (-1110.887) (-1116.538) (-1109.595) [-1112.136] * (-1111.340) (-1110.911) [-1109.792] (-1111.991) -- 0:00:45 62500 -- (-1110.484) (-1116.742) [-1110.839] (-1110.327) * (-1109.317) [-1108.635] (-1108.664) (-1111.758) -- 0:00:45 63000 -- (-1111.007) (-1109.737) (-1111.681) [-1111.321] * (-1108.990) (-1108.567) [-1110.956] (-1108.686) -- 0:00:59 63500 -- (-1112.288) [-1113.249] (-1112.086) (-1108.892) * (-1110.126) [-1108.542] (-1111.077) (-1109.855) -- 0:00:58 64000 -- (-1113.383) [-1111.547] (-1109.627) (-1110.395) * (-1109.471) [-1110.163] (-1111.449) (-1109.681) -- 0:00:58 64500 -- (-1116.010) [-1109.695] (-1112.683) (-1110.188) * (-1112.001) (-1108.517) [-1109.614] (-1113.060) -- 0:00:58 65000 -- (-1112.954) (-1110.177) (-1110.599) [-1111.489] * (-1112.042) (-1108.824) [-1109.454] (-1111.166) -- 0:00:57 Average standard deviation of split frequencies: 0.024843 65500 -- [-1112.003] (-1109.540) (-1112.526) (-1113.438) * (-1110.085) [-1112.432] (-1109.277) (-1109.009) -- 0:00:57 66000 -- [-1110.953] (-1110.851) (-1112.217) (-1109.127) * (-1113.229) [-1109.576] (-1109.529) (-1109.991) -- 0:00:56 66500 -- [-1110.145] (-1110.013) (-1114.081) (-1109.409) * (-1113.246) (-1111.333) [-1108.858] (-1110.113) -- 0:00:56 67000 -- [-1111.902] (-1109.793) (-1110.582) (-1110.494) * (-1113.263) (-1110.760) (-1111.040) [-1111.924] -- 0:00:55 67500 -- [-1110.114] (-1110.320) (-1109.742) (-1110.272) * (-1112.305) (-1111.063) [-1110.973] (-1109.603) -- 0:00:55 68000 -- (-1110.454) [-1108.410] (-1110.958) (-1113.129) * (-1111.958) (-1109.239) [-1112.775] (-1122.411) -- 0:00:54 68500 -- (-1110.580) (-1109.446) [-1110.830] (-1111.367) * (-1108.815) (-1110.060) (-1110.747) [-1110.689] -- 0:00:54 69000 -- [-1110.409] (-1111.958) (-1110.055) (-1109.611) * (-1112.058) (-1109.894) [-1110.944] (-1110.678) -- 0:00:53 69500 -- (-1110.827) (-1113.723) (-1109.954) [-1110.496] * (-1109.743) [-1110.818] (-1111.750) (-1112.756) -- 0:00:53 70000 -- (-1111.781) (-1110.520) (-1116.350) [-1109.563] * (-1109.690) [-1111.224] (-1111.014) (-1111.814) -- 0:00:53 Average standard deviation of split frequencies: 0.026380 70500 -- (-1111.269) (-1109.944) (-1113.007) [-1109.618] * (-1109.584) [-1111.020] (-1115.855) (-1113.005) -- 0:00:52 71000 -- (-1109.653) (-1112.917) (-1112.175) [-1110.249] * (-1108.772) (-1111.280) [-1109.436] (-1111.354) -- 0:00:52 71500 -- [-1109.649] (-1112.543) (-1109.952) (-1111.061) * (-1109.038) [-1110.012] (-1109.402) (-1110.725) -- 0:00:51 72000 -- (-1110.396) (-1111.700) (-1111.001) [-1109.704] * (-1109.152) (-1111.306) [-1110.854] (-1109.813) -- 0:00:51 72500 -- (-1110.468) (-1112.326) [-1111.137] (-1110.280) * [-1108.933] (-1111.664) (-1111.384) (-1109.963) -- 0:00:51 73000 -- (-1109.734) (-1112.749) [-1112.248] (-1109.570) * [-1111.330] (-1112.886) (-1112.538) (-1109.064) -- 0:00:50 73500 -- (-1110.322) (-1109.227) (-1111.048) [-1109.692] * (-1118.862) (-1114.317) [-1110.755] (-1110.399) -- 0:00:50 74000 -- [-1111.752] (-1108.787) (-1110.067) (-1111.429) * (-1109.963) (-1111.010) [-1112.964] (-1109.274) -- 0:00:50 74500 -- [-1110.413] (-1108.715) (-1112.706) (-1111.581) * (-1110.000) (-1110.019) (-1113.746) [-1110.853] -- 0:00:49 75000 -- [-1110.022] (-1112.403) (-1112.907) (-1113.952) * (-1112.341) (-1110.865) [-1109.301] (-1111.048) -- 0:00:49 Average standard deviation of split frequencies: 0.024501 75500 -- (-1110.017) (-1112.594) (-1109.226) [-1113.063] * (-1110.219) (-1111.549) (-1109.371) [-1110.269] -- 0:00:48 76000 -- [-1111.940] (-1112.644) (-1109.105) (-1109.523) * (-1111.458) (-1111.515) (-1110.108) [-1109.474] -- 0:00:48 76500 -- (-1111.316) (-1112.554) [-1108.524] (-1108.651) * (-1111.840) [-1113.513] (-1111.474) (-1108.662) -- 0:00:48 77000 -- (-1109.943) [-1112.303] (-1110.189) (-1109.104) * (-1111.683) (-1111.829) (-1109.837) [-1109.370] -- 0:00:47 77500 -- (-1115.033) (-1108.710) (-1111.164) [-1108.804] * (-1110.297) (-1111.421) [-1110.191] (-1109.900) -- 0:00:47 78000 -- (-1111.380) (-1109.682) (-1111.013) [-1108.439] * (-1108.926) (-1108.785) [-1111.416] (-1112.475) -- 0:00:47 78500 -- (-1109.518) (-1108.862) (-1110.308) [-1108.439] * [-1109.742] (-1110.185) (-1111.711) (-1110.785) -- 0:00:46 79000 -- [-1110.843] (-1109.595) (-1111.171) (-1112.705) * [-1109.612] (-1110.492) (-1109.059) (-1111.703) -- 0:00:46 79500 -- [-1109.155] (-1109.683) (-1108.970) (-1114.713) * [-1109.614] (-1111.253) (-1110.160) (-1111.123) -- 0:00:57 80000 -- (-1109.424) (-1109.199) [-1109.489] (-1109.544) * [-1109.335] (-1111.654) (-1114.552) (-1110.554) -- 0:00:57 Average standard deviation of split frequencies: 0.028297 80500 -- (-1110.575) (-1110.460) (-1110.353) [-1108.686] * (-1110.677) [-1108.975] (-1110.526) (-1112.171) -- 0:00:57 81000 -- (-1112.355) [-1109.290] (-1110.482) (-1110.120) * (-1110.986) (-1109.750) (-1116.802) [-1112.472] -- 0:00:56 81500 -- [-1109.781] (-1111.698) (-1109.477) (-1110.532) * (-1110.803) [-1111.214] (-1119.122) (-1112.001) -- 0:00:56 82000 -- (-1109.474) [-1111.983] (-1109.400) (-1111.127) * (-1111.596) [-1111.537] (-1115.698) (-1112.205) -- 0:00:55 82500 -- (-1109.368) [-1110.348] (-1112.205) (-1109.115) * (-1111.511) (-1110.157) (-1114.549) [-1109.054] -- 0:00:55 83000 -- [-1110.839] (-1109.129) (-1112.882) (-1111.877) * (-1111.517) (-1109.709) [-1111.695] (-1110.436) -- 0:00:55 83500 -- (-1109.068) (-1108.541) [-1112.839] (-1109.095) * (-1109.156) (-1109.753) (-1108.663) [-1110.422] -- 0:00:54 84000 -- [-1112.385] (-1108.814) (-1110.275) (-1109.479) * (-1109.728) [-1109.206] (-1109.492) (-1109.264) -- 0:00:54 84500 -- (-1109.847) [-1109.362] (-1108.440) (-1111.135) * (-1110.675) (-1112.491) (-1111.980) [-1110.894] -- 0:00:54 85000 -- (-1110.227) [-1109.362] (-1108.855) (-1111.284) * [-1109.303] (-1112.502) (-1109.739) (-1110.422) -- 0:00:53 Average standard deviation of split frequencies: 0.027119 85500 -- (-1109.772) [-1113.513] (-1108.910) (-1112.811) * (-1109.582) (-1113.143) [-1110.490] (-1110.315) -- 0:00:53 86000 -- (-1110.482) (-1108.620) (-1109.617) [-1110.602] * (-1109.280) (-1110.715) [-1110.915] (-1109.900) -- 0:00:53 86500 -- (-1112.218) (-1110.031) [-1111.465] (-1109.920) * [-1111.440] (-1110.940) (-1112.009) (-1112.280) -- 0:00:52 87000 -- (-1112.078) [-1110.673] (-1112.289) (-1109.933) * (-1110.362) (-1111.057) [-1108.825] (-1110.814) -- 0:00:52 87500 -- [-1109.829] (-1110.598) (-1111.718) (-1112.401) * (-1113.781) (-1113.680) (-1110.279) [-1109.296] -- 0:00:52 88000 -- [-1110.774] (-1109.039) (-1110.193) (-1108.966) * (-1111.732) (-1109.825) [-1110.379] (-1112.104) -- 0:00:51 88500 -- [-1110.822] (-1110.547) (-1113.869) (-1113.707) * (-1112.094) [-1112.366] (-1110.769) (-1112.187) -- 0:00:51 89000 -- (-1112.915) (-1114.413) [-1112.815] (-1115.389) * (-1112.634) [-1110.282] (-1109.347) (-1112.521) -- 0:00:51 89500 -- (-1108.797) (-1111.268) (-1110.350) [-1111.454] * (-1110.115) [-1112.373] (-1109.659) (-1109.418) -- 0:00:50 90000 -- (-1109.290) [-1111.050] (-1110.057) (-1112.148) * (-1109.995) (-1109.978) [-1110.915] (-1110.702) -- 0:00:50 Average standard deviation of split frequencies: 0.027091 90500 -- (-1109.256) (-1110.255) [-1109.759] (-1109.143) * (-1110.695) (-1114.567) (-1112.961) [-1109.003] -- 0:00:50 91000 -- [-1110.181] (-1112.060) (-1109.187) (-1108.902) * (-1112.528) (-1111.767) (-1111.314) [-1111.308] -- 0:00:49 91500 -- (-1108.627) (-1110.718) [-1108.689] (-1108.943) * (-1110.167) (-1109.887) (-1108.872) [-1108.831] -- 0:00:49 92000 -- (-1111.174) (-1111.443) (-1111.188) [-1109.318] * (-1110.569) (-1110.580) [-1108.265] (-1109.390) -- 0:00:49 92500 -- (-1110.790) (-1111.213) [-1109.952] (-1108.965) * (-1114.637) [-1109.266] (-1109.833) (-1110.138) -- 0:00:49 93000 -- (-1111.402) (-1110.784) [-1109.575] (-1108.873) * (-1109.173) (-1110.742) (-1110.453) [-1111.157] -- 0:00:48 93500 -- (-1111.833) [-1112.317] (-1109.953) (-1110.023) * [-1109.303] (-1110.576) (-1113.199) (-1110.878) -- 0:00:48 94000 -- (-1116.570) (-1109.580) [-1110.222] (-1110.308) * (-1110.053) (-1115.361) [-1112.087] (-1110.311) -- 0:00:48 94500 -- (-1113.185) [-1112.348] (-1109.989) (-1111.218) * (-1108.457) (-1109.136) (-1110.034) [-1109.850] -- 0:00:47 95000 -- (-1115.582) (-1112.551) [-1109.669] (-1110.182) * (-1112.124) [-1112.694] (-1112.903) (-1109.938) -- 0:00:47 Average standard deviation of split frequencies: 0.025916 95500 -- [-1109.274] (-1112.845) (-1111.095) (-1112.137) * (-1110.280) (-1112.256) [-1109.136] (-1109.185) -- 0:00:56 96000 -- (-1112.082) (-1109.725) [-1113.727] (-1111.837) * (-1112.839) (-1111.259) [-1111.005] (-1109.185) -- 0:00:56 96500 -- (-1110.675) [-1110.348] (-1114.908) (-1110.237) * (-1109.248) [-1110.874] (-1111.666) (-1111.355) -- 0:00:56 97000 -- [-1110.273] (-1111.990) (-1111.460) (-1108.815) * (-1109.238) (-1111.426) (-1109.262) [-1110.163] -- 0:00:55 97500 -- [-1109.942] (-1113.722) (-1110.571) (-1108.371) * (-1111.711) (-1111.082) [-1110.880] (-1110.175) -- 0:00:55 98000 -- [-1110.874] (-1110.588) (-1110.095) (-1114.250) * (-1110.099) (-1111.561) [-1112.681] (-1112.893) -- 0:00:55 98500 -- [-1111.029] (-1109.518) (-1115.746) (-1114.965) * (-1113.071) (-1110.692) (-1112.106) [-1110.847] -- 0:00:54 99000 -- (-1110.361) [-1110.373] (-1109.699) (-1111.237) * [-1113.186] (-1111.474) (-1110.663) (-1112.177) -- 0:00:54 99500 -- (-1111.265) (-1109.484) (-1111.354) [-1112.143] * (-1110.715) (-1109.742) (-1113.079) [-1115.078] -- 0:00:54 100000 -- (-1111.709) (-1109.337) (-1108.617) [-1108.910] * (-1109.335) [-1110.144] (-1112.522) (-1110.800) -- 0:00:54 Average standard deviation of split frequencies: 0.024455 100500 -- (-1115.472) (-1112.931) [-1109.215] (-1108.819) * (-1108.544) (-1111.546) [-1117.053] (-1109.074) -- 0:00:53 101000 -- (-1111.267) [-1111.981] (-1112.010) (-1108.819) * (-1112.022) (-1112.855) (-1114.026) [-1110.109] -- 0:00:53 101500 -- (-1110.972) [-1112.919] (-1109.801) (-1111.626) * (-1110.529) (-1109.981) [-1113.687] (-1113.920) -- 0:00:53 102000 -- (-1112.053) (-1111.936) [-1109.353] (-1112.366) * (-1110.984) (-1109.661) [-1113.880] (-1110.401) -- 0:00:52 102500 -- [-1110.179] (-1120.278) (-1111.660) (-1110.224) * (-1110.663) (-1114.143) (-1112.777) [-1112.715] -- 0:00:52 103000 -- [-1109.185] (-1119.002) (-1109.798) (-1110.188) * (-1110.773) [-1111.095] (-1112.071) (-1111.483) -- 0:00:52 103500 -- [-1108.806] (-1114.267) (-1113.456) (-1112.635) * (-1111.753) (-1111.834) (-1111.384) [-1113.760] -- 0:00:51 104000 -- [-1108.834] (-1110.913) (-1112.903) (-1111.862) * (-1113.516) (-1109.953) (-1109.651) [-1110.679] -- 0:00:51 104500 -- (-1109.482) [-1110.914] (-1110.340) (-1111.455) * (-1112.054) [-1109.673] (-1109.927) (-1111.128) -- 0:00:51 105000 -- (-1109.580) [-1110.230] (-1113.228) (-1111.400) * (-1109.930) [-1110.156] (-1110.075) (-1109.656) -- 0:00:51 Average standard deviation of split frequencies: 0.022483 105500 -- [-1111.577] (-1112.415) (-1114.072) (-1115.301) * [-1111.631] (-1109.404) (-1112.290) (-1109.636) -- 0:00:50 106000 -- (-1109.780) [-1113.679] (-1114.955) (-1114.472) * [-1111.042] (-1110.011) (-1110.671) (-1110.175) -- 0:00:50 106500 -- (-1110.158) (-1111.107) (-1109.237) [-1111.486] * (-1116.860) [-1109.654] (-1112.018) (-1115.503) -- 0:00:50 107000 -- [-1111.529] (-1110.894) (-1110.836) (-1111.034) * (-1113.257) [-1110.622] (-1110.819) (-1111.091) -- 0:00:50 107500 -- (-1109.324) (-1109.592) (-1111.808) [-1110.199] * [-1109.822] (-1111.261) (-1116.400) (-1109.798) -- 0:00:49 108000 -- [-1109.193] (-1109.991) (-1110.512) (-1111.745) * (-1110.380) [-1108.954] (-1111.066) (-1109.839) -- 0:00:49 108500 -- (-1110.571) (-1109.053) (-1110.080) [-1111.879] * (-1110.044) (-1108.963) [-1109.075] (-1110.444) -- 0:00:49 109000 -- [-1109.164] (-1109.098) (-1111.320) (-1110.783) * (-1111.521) (-1109.034) (-1109.366) [-1108.968] -- 0:00:49 109500 -- [-1109.985] (-1108.849) (-1109.490) (-1111.064) * (-1111.560) (-1111.185) [-1108.977] (-1109.104) -- 0:00:48 110000 -- [-1109.539] (-1109.688) (-1108.700) (-1110.992) * (-1114.473) (-1108.643) (-1109.017) [-1112.927] -- 0:00:48 Average standard deviation of split frequencies: 0.021298 110500 -- (-1112.843) (-1110.478) [-1109.102] (-1109.633) * [-1111.155] (-1110.100) (-1109.546) (-1111.626) -- 0:00:48 111000 -- (-1111.035) [-1110.758] (-1110.250) (-1109.428) * (-1109.101) (-1110.085) (-1111.954) [-1109.561] -- 0:00:48 111500 -- (-1117.058) [-1113.602] (-1109.199) (-1110.810) * (-1109.966) (-1110.062) (-1112.503) [-1110.497] -- 0:00:55 112000 -- (-1109.440) [-1109.020] (-1109.352) (-1110.387) * (-1111.772) [-1111.314] (-1113.143) (-1114.843) -- 0:00:55 112500 -- (-1108.681) (-1115.001) [-1113.910] (-1110.937) * (-1109.960) (-1109.317) [-1110.864] (-1112.074) -- 0:00:55 113000 -- (-1110.796) [-1109.785] (-1117.170) (-1110.373) * [-1109.066] (-1110.126) (-1116.576) (-1113.750) -- 0:00:54 113500 -- (-1108.829) [-1110.296] (-1113.403) (-1110.359) * [-1115.651] (-1110.431) (-1115.065) (-1110.881) -- 0:00:54 114000 -- (-1108.406) (-1115.834) (-1113.535) [-1111.459] * (-1111.226) (-1108.627) [-1111.837] (-1111.304) -- 0:00:54 114500 -- (-1112.114) (-1112.182) (-1115.587) [-1109.774] * (-1120.551) [-1110.841] (-1112.931) (-1111.820) -- 0:00:54 115000 -- (-1110.907) (-1110.102) [-1115.693] (-1109.744) * (-1111.195) (-1109.380) [-1113.517] (-1109.648) -- 0:00:53 Average standard deviation of split frequencies: 0.022232 115500 -- (-1110.159) [-1109.872] (-1110.964) (-1109.786) * (-1111.506) (-1108.337) (-1113.045) [-1110.573] -- 0:00:53 116000 -- (-1112.869) [-1109.651] (-1112.345) (-1109.889) * [-1113.071] (-1109.351) (-1109.185) (-1109.965) -- 0:00:53 116500 -- (-1111.111) [-1110.882] (-1111.757) (-1108.967) * (-1113.831) [-1110.459] (-1108.832) (-1110.882) -- 0:00:53 117000 -- (-1110.628) (-1109.360) [-1109.413] (-1112.282) * (-1113.029) [-1109.362] (-1109.673) (-1110.325) -- 0:00:52 117500 -- (-1118.235) (-1110.741) [-1110.778] (-1109.520) * (-1112.677) (-1108.325) (-1108.930) [-1109.462] -- 0:00:52 118000 -- [-1109.169] (-1113.802) (-1110.684) (-1115.505) * (-1110.441) [-1108.473] (-1108.678) (-1110.374) -- 0:00:52 118500 -- (-1108.788) [-1111.017] (-1111.792) (-1110.231) * (-1112.938) [-1108.928] (-1113.614) (-1110.784) -- 0:00:52 119000 -- (-1109.908) (-1111.732) (-1111.120) [-1109.148] * (-1111.688) (-1109.078) [-1113.330] (-1109.323) -- 0:00:51 119500 -- (-1109.959) [-1113.226] (-1110.943) (-1110.415) * [-1109.415] (-1109.382) (-1113.563) (-1108.676) -- 0:00:51 120000 -- [-1109.476] (-1111.630) (-1109.707) (-1110.187) * [-1108.534] (-1109.980) (-1118.174) (-1109.013) -- 0:00:51 Average standard deviation of split frequencies: 0.023440 120500 -- (-1108.821) (-1109.413) (-1109.034) [-1109.221] * (-1113.856) [-1111.290] (-1113.823) (-1111.044) -- 0:00:51 121000 -- (-1111.309) (-1108.641) [-1108.760] (-1110.184) * (-1111.035) (-1110.409) [-1109.133] (-1112.848) -- 0:00:50 121500 -- [-1109.660] (-1108.745) (-1109.617) (-1108.572) * (-1112.730) (-1110.745) (-1109.030) [-1112.373] -- 0:00:50 122000 -- (-1110.004) (-1110.431) (-1112.634) [-1109.876] * (-1112.907) (-1111.616) (-1110.799) [-1112.072] -- 0:00:50 122500 -- (-1111.975) (-1111.786) (-1109.758) [-1109.769] * [-1109.903] (-1110.262) (-1109.420) (-1114.436) -- 0:00:50 123000 -- (-1113.726) (-1111.814) (-1111.831) [-1112.317] * (-1112.470) [-1108.246] (-1108.879) (-1111.808) -- 0:00:49 123500 -- (-1113.954) (-1110.732) (-1111.658) [-1109.929] * (-1113.162) [-1108.930] (-1109.843) (-1113.760) -- 0:00:49 124000 -- (-1113.633) [-1111.008] (-1110.060) (-1108.850) * (-1109.203) (-1111.965) (-1109.372) [-1116.947] -- 0:00:49 124500 -- (-1111.928) (-1109.617) [-1110.034] (-1109.327) * (-1108.891) [-1111.302] (-1111.226) (-1111.345) -- 0:00:49 125000 -- (-1110.895) (-1108.699) (-1109.891) [-1110.147] * (-1113.146) (-1113.069) (-1110.877) [-1112.761] -- 0:00:49 Average standard deviation of split frequencies: 0.020951 125500 -- (-1110.871) [-1109.671] (-1108.831) (-1111.012) * (-1111.627) (-1110.813) (-1111.597) [-1108.853] -- 0:00:48 126000 -- (-1111.276) (-1110.739) (-1108.831) [-1111.917] * (-1111.054) [-1109.256] (-1111.524) (-1108.923) -- 0:00:48 126500 -- (-1112.442) [-1113.307] (-1110.229) (-1109.282) * [-1114.774] (-1113.649) (-1109.521) (-1109.986) -- 0:00:48 127000 -- (-1117.565) (-1109.729) [-1111.343] (-1113.549) * (-1111.231) (-1110.215) [-1110.037] (-1112.462) -- 0:00:48 127500 -- (-1113.937) (-1108.970) [-1111.292] (-1115.593) * (-1110.660) (-1110.215) (-1111.535) [-1112.251] -- 0:00:47 128000 -- (-1108.945) [-1109.113] (-1111.416) (-1113.169) * (-1112.897) (-1110.215) (-1109.980) [-1111.513] -- 0:00:54 128500 -- (-1108.550) (-1109.843) (-1110.277) [-1111.392] * (-1109.380) (-1110.388) (-1116.583) [-1112.475] -- 0:00:54 129000 -- (-1109.273) [-1109.712] (-1112.600) (-1110.582) * [-1109.226] (-1110.185) (-1109.794) (-1109.945) -- 0:00:54 129500 -- [-1111.381] (-1108.556) (-1112.251) (-1113.077) * [-1110.347] (-1111.271) (-1110.733) (-1110.208) -- 0:00:53 130000 -- (-1109.999) (-1109.498) [-1111.050] (-1111.114) * [-1108.867] (-1113.201) (-1109.573) (-1118.601) -- 0:00:53 Average standard deviation of split frequencies: 0.019482 130500 -- (-1110.331) [-1108.593] (-1115.569) (-1109.871) * [-1109.373] (-1109.268) (-1111.760) (-1115.507) -- 0:00:53 131000 -- (-1109.921) (-1109.429) (-1119.200) [-1111.896] * [-1109.115] (-1108.943) (-1113.750) (-1112.040) -- 0:00:53 131500 -- (-1109.759) [-1108.800] (-1110.218) (-1113.658) * (-1109.713) [-1108.617] (-1112.401) (-1109.756) -- 0:00:52 132000 -- (-1110.293) [-1108.560] (-1111.882) (-1111.935) * [-1108.539] (-1108.938) (-1112.862) (-1111.836) -- 0:00:52 132500 -- (-1110.420) [-1110.601] (-1110.855) (-1110.247) * [-1109.210] (-1109.913) (-1113.130) (-1111.858) -- 0:00:52 133000 -- [-1109.846] (-1115.186) (-1110.064) (-1110.069) * (-1112.426) (-1108.910) (-1110.766) [-1111.544] -- 0:00:52 133500 -- [-1109.455] (-1116.508) (-1109.111) (-1110.979) * [-1109.303] (-1108.910) (-1109.948) (-1112.986) -- 0:00:51 134000 -- (-1111.165) [-1109.711] (-1109.375) (-1109.200) * [-1108.916] (-1109.750) (-1110.467) (-1115.444) -- 0:00:51 134500 -- [-1109.877] (-1110.866) (-1109.776) (-1108.980) * (-1110.736) (-1110.208) (-1109.814) [-1110.721] -- 0:00:51 135000 -- (-1111.454) [-1110.967] (-1112.403) (-1115.840) * (-1109.940) (-1112.787) (-1111.743) [-1109.023] -- 0:00:51 Average standard deviation of split frequencies: 0.020797 135500 -- (-1109.540) [-1111.148] (-1112.308) (-1109.533) * (-1108.794) (-1116.672) [-1111.616] (-1108.632) -- 0:00:51 136000 -- (-1110.638) [-1110.877] (-1109.644) (-1108.949) * [-1109.929] (-1112.634) (-1110.050) (-1109.691) -- 0:00:50 136500 -- [-1113.182] (-1112.968) (-1113.752) (-1110.218) * (-1110.351) (-1110.763) [-1109.308] (-1109.270) -- 0:00:50 137000 -- (-1113.852) (-1110.327) (-1112.119) [-1110.023] * (-1109.058) (-1111.723) [-1110.194] (-1110.093) -- 0:00:50 137500 -- (-1114.647) (-1110.945) (-1111.537) [-1110.355] * [-1111.257] (-1111.852) (-1112.073) (-1113.138) -- 0:00:50 138000 -- (-1108.884) (-1110.664) (-1108.933) [-1108.784] * (-1113.674) (-1112.677) [-1111.835] (-1112.836) -- 0:00:49 138500 -- (-1108.922) (-1112.100) (-1109.656) [-1109.155] * (-1111.573) (-1109.596) (-1110.704) [-1108.827] -- 0:00:49 139000 -- [-1110.515] (-1111.401) (-1110.393) (-1114.232) * (-1109.595) (-1110.672) [-1110.472] (-1108.472) -- 0:00:49 139500 -- (-1113.800) [-1110.871] (-1110.393) (-1110.003) * (-1108.848) [-1109.632] (-1114.417) (-1109.929) -- 0:00:49 140000 -- [-1110.574] (-1112.428) (-1112.153) (-1109.825) * (-1109.326) [-1109.879] (-1109.818) (-1108.692) -- 0:00:49 Average standard deviation of split frequencies: 0.018618 140500 -- [-1111.667] (-1110.572) (-1110.087) (-1110.464) * (-1109.298) (-1109.647) [-1109.924] (-1109.296) -- 0:00:48 141000 -- [-1109.898] (-1109.017) (-1110.941) (-1112.096) * (-1111.772) (-1109.581) (-1110.174) [-1112.300] -- 0:00:48 141500 -- (-1112.140) (-1113.855) [-1115.178] (-1112.565) * (-1112.233) (-1109.406) [-1109.985] (-1110.987) -- 0:00:48 142000 -- (-1111.470) [-1110.302] (-1110.248) (-1110.303) * [-1110.362] (-1111.287) (-1109.730) (-1110.206) -- 0:00:48 142500 -- (-1110.656) (-1115.300) [-1114.169] (-1113.473) * (-1111.014) (-1110.829) [-1109.755] (-1109.665) -- 0:00:48 143000 -- (-1112.221) [-1110.056] (-1115.250) (-1110.078) * (-1109.157) (-1113.846) [-1114.961] (-1110.495) -- 0:00:47 143500 -- (-1109.106) [-1111.189] (-1112.560) (-1115.438) * [-1109.262] (-1111.403) (-1117.763) (-1111.546) -- 0:00:47 144000 -- (-1110.119) [-1111.093] (-1111.972) (-1113.904) * (-1109.277) (-1110.066) [-1108.905] (-1112.037) -- 0:00:47 144500 -- (-1110.061) [-1109.471] (-1110.517) (-1114.897) * (-1109.877) (-1110.624) (-1109.029) [-1111.299] -- 0:00:53 145000 -- (-1111.569) (-1109.864) [-1113.243] (-1111.078) * (-1114.280) (-1110.645) [-1109.267] (-1113.627) -- 0:00:53 Average standard deviation of split frequencies: 0.017164 145500 -- (-1112.907) (-1109.260) (-1112.811) [-1109.129] * (-1112.584) (-1113.484) (-1108.909) [-1111.684] -- 0:00:52 146000 -- [-1111.559] (-1108.598) (-1112.586) (-1112.573) * (-1111.873) (-1116.351) (-1109.184) [-1109.200] -- 0:00:52 146500 -- (-1111.997) (-1110.970) [-1110.016] (-1110.671) * (-1112.419) [-1112.572] (-1109.215) (-1110.788) -- 0:00:52 147000 -- [-1110.096] (-1111.661) (-1109.171) (-1115.014) * (-1110.350) (-1110.621) [-1108.995] (-1110.230) -- 0:00:52 147500 -- (-1110.804) (-1109.456) [-1112.254] (-1111.009) * (-1109.742) [-1110.277] (-1110.402) (-1110.281) -- 0:00:52 148000 -- (-1108.570) (-1109.873) (-1110.158) [-1111.565] * (-1111.661) [-1111.795] (-1109.928) (-1112.729) -- 0:00:51 148500 -- (-1108.567) [-1113.200] (-1111.876) (-1114.161) * (-1111.555) [-1111.642] (-1109.821) (-1110.168) -- 0:00:51 149000 -- [-1108.919] (-1110.582) (-1110.755) (-1114.212) * [-1110.656] (-1110.310) (-1109.736) (-1113.620) -- 0:00:51 149500 -- (-1108.642) (-1110.276) [-1111.525] (-1113.737) * (-1110.624) [-1109.730] (-1109.377) (-1109.608) -- 0:00:51 150000 -- [-1112.741] (-1109.033) (-1113.782) (-1115.286) * (-1110.909) (-1114.195) [-1111.395] (-1109.224) -- 0:00:51 Average standard deviation of split frequencies: 0.015818 150500 -- (-1114.196) [-1109.069] (-1111.643) (-1118.497) * (-1113.877) [-1114.413] (-1112.417) (-1113.436) -- 0:00:50 151000 -- [-1108.999] (-1110.854) (-1112.639) (-1118.900) * (-1110.040) [-1110.029] (-1113.106) (-1110.771) -- 0:00:50 151500 -- (-1109.463) (-1115.769) [-1110.547] (-1110.476) * (-1110.420) [-1110.966] (-1110.126) (-1111.184) -- 0:00:50 152000 -- (-1108.602) (-1119.823) [-1112.052] (-1112.749) * (-1109.558) (-1110.151) [-1112.911] (-1114.364) -- 0:00:50 152500 -- (-1109.886) (-1110.634) (-1109.642) [-1109.098] * [-1112.133] (-1109.395) (-1109.467) (-1109.938) -- 0:00:50 153000 -- (-1110.565) [-1110.850] (-1109.524) (-1109.272) * (-1111.022) (-1115.728) (-1109.660) [-1109.846] -- 0:00:49 153500 -- (-1110.881) [-1109.631] (-1109.762) (-1110.679) * [-1112.056] (-1114.543) (-1111.665) (-1111.789) -- 0:00:49 154000 -- (-1110.046) [-1109.482] (-1109.825) (-1109.696) * (-1113.534) (-1108.559) [-1108.414] (-1109.079) -- 0:00:49 154500 -- [-1109.993] (-1110.810) (-1108.559) (-1110.877) * (-1117.942) [-1110.676] (-1109.643) (-1111.880) -- 0:00:49 155000 -- (-1110.255) (-1108.921) [-1108.971] (-1111.339) * (-1110.604) (-1109.031) [-1109.122] (-1110.199) -- 0:00:49 Average standard deviation of split frequencies: 0.017654 155500 -- [-1112.480] (-1110.105) (-1110.266) (-1110.413) * (-1113.161) [-1111.503] (-1112.042) (-1111.438) -- 0:00:48 156000 -- (-1111.408) (-1110.891) (-1109.833) [-1110.165] * (-1111.079) [-1108.818] (-1108.664) (-1112.876) -- 0:00:48 156500 -- (-1110.781) (-1113.048) (-1109.056) [-1110.173] * [-1108.888] (-1113.432) (-1108.572) (-1112.791) -- 0:00:48 157000 -- (-1111.061) (-1112.376) (-1109.897) [-1115.023] * [-1108.889] (-1114.124) (-1109.227) (-1112.816) -- 0:00:48 157500 -- (-1109.572) (-1115.337) (-1109.875) [-1108.569] * (-1108.938) [-1109.445] (-1109.843) (-1111.921) -- 0:00:48 158000 -- [-1110.415] (-1112.730) (-1109.501) (-1110.210) * (-1109.345) (-1108.859) (-1113.087) [-1108.823] -- 0:00:47 158500 -- (-1112.429) [-1110.121] (-1109.743) (-1110.704) * (-1114.032) (-1110.188) (-1112.371) [-1108.852] -- 0:00:47 159000 -- (-1110.509) [-1109.803] (-1115.239) (-1109.557) * (-1110.511) (-1110.052) [-1110.114] (-1109.081) -- 0:00:47 159500 -- (-1110.170) (-1110.594) [-1108.489] (-1109.536) * [-1110.906] (-1109.482) (-1109.755) (-1109.294) -- 0:00:47 160000 -- (-1113.136) (-1109.093) (-1110.328) [-1109.755] * (-1112.820) (-1108.605) [-1110.725] (-1110.158) -- 0:00:47 Average standard deviation of split frequencies: 0.019457 160500 -- [-1111.347] (-1109.045) (-1110.632) (-1110.448) * (-1111.226) (-1110.147) [-1110.872] (-1109.434) -- 0:00:47 161000 -- (-1110.357) (-1111.039) [-1109.974] (-1118.184) * (-1110.474) (-1110.180) [-1109.624] (-1109.528) -- 0:00:52 161500 -- [-1112.555] (-1113.960) (-1109.724) (-1111.742) * (-1110.757) [-1112.995] (-1109.464) (-1109.354) -- 0:00:51 162000 -- (-1111.737) (-1110.296) [-1109.708] (-1112.642) * [-1111.463] (-1111.551) (-1111.407) (-1109.051) -- 0:00:51 162500 -- [-1108.702] (-1109.659) (-1108.748) (-1114.853) * (-1111.243) [-1109.375] (-1108.834) (-1109.185) -- 0:00:51 163000 -- (-1110.521) [-1111.632] (-1108.942) (-1109.084) * [-1113.336] (-1112.271) (-1109.587) (-1108.996) -- 0:00:51 163500 -- [-1112.912] (-1110.663) (-1108.942) (-1109.335) * [-1111.163] (-1110.246) (-1109.947) (-1110.997) -- 0:00:51 164000 -- [-1112.213] (-1113.186) (-1109.690) (-1110.398) * (-1111.195) [-1110.662] (-1110.356) (-1113.725) -- 0:00:50 164500 -- [-1109.158] (-1115.863) (-1113.268) (-1109.787) * (-1114.700) [-1110.839] (-1109.042) (-1112.605) -- 0:00:50 165000 -- [-1112.073] (-1112.887) (-1113.156) (-1109.007) * [-1111.798] (-1109.614) (-1111.473) (-1111.225) -- 0:00:50 Average standard deviation of split frequencies: 0.021440 165500 -- (-1111.064) (-1111.719) (-1110.847) [-1109.210] * (-1115.124) (-1110.576) [-1110.867] (-1111.518) -- 0:00:50 166000 -- (-1110.013) (-1109.818) [-1110.854] (-1111.725) * (-1110.682) (-1110.418) (-1110.863) [-1112.536] -- 0:00:50 166500 -- (-1109.978) (-1112.412) [-1112.428] (-1110.576) * [-1109.961] (-1110.092) (-1111.926) (-1111.271) -- 0:00:50 167000 -- (-1111.409) (-1110.678) [-1110.035] (-1113.337) * (-1110.778) [-1109.757] (-1111.893) (-1108.351) -- 0:00:49 167500 -- (-1110.182) [-1109.671] (-1109.870) (-1116.210) * (-1109.761) [-1109.562] (-1111.162) (-1108.351) -- 0:00:49 168000 -- (-1114.431) (-1111.283) [-1110.110] (-1110.644) * (-1109.786) (-1109.961) (-1111.437) [-1109.288] -- 0:00:49 168500 -- (-1113.467) [-1109.794] (-1112.047) (-1110.541) * (-1112.942) [-1110.670] (-1114.088) (-1110.903) -- 0:00:49 169000 -- [-1111.586] (-1108.650) (-1110.281) (-1111.149) * (-1110.197) (-1109.075) (-1109.743) [-1111.982] -- 0:00:49 169500 -- [-1109.574] (-1112.294) (-1109.018) (-1112.243) * [-1108.349] (-1109.564) (-1109.730) (-1112.201) -- 0:00:48 170000 -- (-1110.613) (-1110.188) [-1110.856] (-1109.953) * (-1111.819) [-1110.672] (-1112.478) (-1111.301) -- 0:00:48 Average standard deviation of split frequencies: 0.021959 170500 -- (-1109.733) [-1110.250] (-1111.455) (-1111.184) * (-1111.395) [-1111.253] (-1111.606) (-1108.901) -- 0:00:48 171000 -- (-1110.629) [-1109.273] (-1111.117) (-1110.366) * (-1110.711) (-1109.062) (-1110.837) [-1109.800] -- 0:00:48 171500 -- [-1114.780] (-1109.298) (-1111.234) (-1114.422) * [-1110.744] (-1111.657) (-1110.156) (-1109.428) -- 0:00:48 172000 -- (-1112.129) [-1109.754] (-1108.788) (-1114.767) * (-1111.853) (-1114.938) (-1109.372) [-1109.554] -- 0:00:48 172500 -- (-1112.744) (-1109.972) (-1111.931) [-1114.393] * (-1108.972) (-1113.326) [-1109.933] (-1109.171) -- 0:00:47 173000 -- (-1110.966) (-1109.465) (-1111.240) [-1112.986] * (-1109.382) [-1112.320] (-1110.977) (-1110.281) -- 0:00:47 173500 -- [-1109.159] (-1109.303) (-1109.279) (-1111.136) * (-1109.193) (-1113.635) (-1111.030) [-1109.905] -- 0:00:47 174000 -- (-1109.914) (-1110.567) (-1110.082) [-1111.961] * (-1108.356) [-1111.166] (-1111.090) (-1109.727) -- 0:00:47 174500 -- (-1109.299) (-1121.515) (-1110.873) [-1111.880] * [-1115.155] (-1112.740) (-1109.457) (-1110.354) -- 0:00:47 175000 -- (-1108.768) (-1110.213) (-1109.652) [-1109.824] * (-1108.850) (-1113.019) (-1111.445) [-1110.464] -- 0:00:47 Average standard deviation of split frequencies: 0.022414 175500 -- (-1112.541) (-1108.725) (-1112.054) [-1109.179] * (-1109.084) (-1113.854) [-1110.655] (-1116.718) -- 0:00:46 176000 -- (-1113.026) (-1109.432) (-1113.939) [-1109.174] * (-1110.299) (-1110.645) [-1110.067] (-1111.701) -- 0:00:46 176500 -- (-1113.844) [-1109.004] (-1113.003) (-1110.341) * (-1109.677) (-1110.231) (-1111.050) [-1111.290] -- 0:00:46 177000 -- (-1109.963) [-1109.966] (-1118.337) (-1111.496) * (-1109.897) (-1114.778) [-1111.826] (-1111.412) -- 0:00:51 177500 -- (-1110.556) [-1110.895] (-1112.122) (-1110.990) * [-1109.321] (-1112.876) (-1109.646) (-1110.344) -- 0:00:50 178000 -- (-1109.345) (-1111.677) (-1109.919) [-1114.485] * (-1109.570) (-1110.801) (-1109.720) [-1108.708] -- 0:00:50 178500 -- (-1109.695) [-1111.458] (-1110.641) (-1110.024) * (-1109.468) (-1110.096) (-1110.721) [-1110.438] -- 0:00:50 179000 -- (-1109.198) (-1108.869) [-1108.638] (-1110.271) * [-1109.603] (-1113.089) (-1111.489) (-1120.515) -- 0:00:50 179500 -- [-1112.369] (-1110.704) (-1110.794) (-1112.346) * [-1110.511] (-1110.141) (-1109.607) (-1111.505) -- 0:00:50 180000 -- (-1112.632) (-1110.464) [-1109.075] (-1114.465) * (-1111.053) (-1110.775) [-1111.866] (-1112.501) -- 0:00:50 Average standard deviation of split frequencies: 0.023071 180500 -- [-1111.014] (-1111.252) (-1109.963) (-1116.223) * (-1115.369) [-1109.692] (-1113.381) (-1109.167) -- 0:00:49 181000 -- (-1112.436) (-1109.896) [-1109.515] (-1110.275) * (-1112.078) [-1109.235] (-1110.907) (-1109.751) -- 0:00:49 181500 -- (-1109.457) [-1110.563] (-1113.465) (-1113.217) * (-1113.439) [-1109.332] (-1110.950) (-1113.499) -- 0:00:49 182000 -- (-1110.449) (-1112.600) (-1112.133) [-1112.128] * (-1113.439) (-1112.595) [-1110.515] (-1110.157) -- 0:00:49 182500 -- (-1110.829) (-1114.078) (-1111.400) [-1110.939] * (-1110.236) (-1114.625) (-1110.998) [-1110.467] -- 0:00:49 183000 -- (-1108.439) (-1110.684) (-1109.819) [-1109.277] * (-1110.285) [-1111.200] (-1111.378) (-1110.466) -- 0:00:49 183500 -- (-1109.685) (-1109.251) [-1110.319] (-1112.474) * (-1110.791) (-1111.751) (-1109.635) [-1111.102] -- 0:00:48 184000 -- (-1109.926) [-1110.552] (-1110.764) (-1110.411) * (-1114.590) (-1110.679) [-1110.764] (-1116.458) -- 0:00:48 184500 -- (-1110.879) [-1109.969] (-1110.875) (-1109.459) * (-1112.922) (-1111.121) [-1111.781] (-1111.899) -- 0:00:48 185000 -- (-1110.075) (-1108.848) [-1111.924] (-1109.510) * (-1111.230) (-1109.794) (-1110.632) [-1112.586] -- 0:00:48 Average standard deviation of split frequencies: 0.023063 185500 -- (-1109.405) (-1112.767) (-1112.566) [-1111.853] * (-1111.345) [-1109.215] (-1112.618) (-1110.593) -- 0:00:48 186000 -- (-1108.890) [-1110.439] (-1117.618) (-1108.828) * (-1111.097) [-1110.718] (-1112.456) (-1111.083) -- 0:00:48 186500 -- (-1109.313) (-1109.728) (-1120.450) [-1109.276] * (-1109.839) (-1110.059) (-1111.030) [-1109.794] -- 0:00:47 187000 -- [-1111.278] (-1109.380) (-1121.873) (-1111.420) * (-1109.683) [-1108.848] (-1111.611) (-1109.791) -- 0:00:47 187500 -- (-1109.976) [-1109.111] (-1119.690) (-1111.621) * [-1109.830] (-1109.908) (-1110.460) (-1110.926) -- 0:00:47 188000 -- (-1114.554) [-1111.351] (-1112.288) (-1109.712) * (-1109.870) (-1110.070) [-1112.670] (-1110.811) -- 0:00:47 188500 -- (-1115.883) (-1109.347) [-1109.427] (-1113.480) * (-1114.449) (-1109.287) (-1116.756) [-1111.928] -- 0:00:47 189000 -- (-1113.224) [-1109.878] (-1109.035) (-1109.745) * (-1109.805) (-1110.143) (-1110.266) [-1112.170] -- 0:00:47 189500 -- (-1108.785) [-1108.466] (-1110.248) (-1110.001) * (-1110.202) (-1110.002) [-1110.152] (-1109.186) -- 0:00:47 190000 -- (-1110.354) [-1108.912] (-1109.507) (-1109.912) * (-1111.458) (-1110.069) (-1111.438) [-1109.136] -- 0:00:46 Average standard deviation of split frequencies: 0.022382 190500 -- (-1112.482) [-1109.212] (-1110.105) (-1109.098) * (-1110.705) (-1109.250) [-1109.545] (-1109.885) -- 0:00:46 191000 -- (-1116.013) (-1109.500) [-1109.285] (-1108.959) * (-1110.865) (-1108.860) (-1109.673) [-1109.604] -- 0:00:46 191500 -- (-1111.301) (-1109.762) (-1109.078) [-1110.578] * [-1110.729] (-1109.207) (-1110.774) (-1109.608) -- 0:00:46 192000 -- [-1111.234] (-1108.925) (-1110.020) (-1110.811) * (-1110.281) (-1114.413) [-1112.121] (-1111.035) -- 0:00:46 192500 -- (-1113.071) [-1109.192] (-1109.832) (-1113.637) * (-1110.315) [-1108.957] (-1110.209) (-1110.941) -- 0:00:46 193000 -- (-1111.164) (-1110.393) (-1110.436) [-1109.545] * (-1109.187) [-1111.263] (-1116.322) (-1116.121) -- 0:00:50 193500 -- (-1111.706) [-1109.922] (-1110.439) (-1110.503) * (-1109.446) (-1112.442) [-1111.455] (-1110.904) -- 0:00:50 194000 -- (-1113.200) (-1110.296) [-1110.260] (-1110.521) * (-1111.077) (-1109.893) (-1111.897) [-1110.999] -- 0:00:49 194500 -- (-1110.273) (-1112.842) [-1110.038] (-1109.727) * (-1109.012) (-1110.668) [-1109.971] (-1109.525) -- 0:00:49 195000 -- (-1115.717) [-1114.457] (-1109.607) (-1112.017) * (-1109.295) [-1109.530] (-1109.959) (-1110.208) -- 0:00:49 Average standard deviation of split frequencies: 0.023690 195500 -- (-1112.100) (-1110.741) (-1111.205) [-1114.333] * [-1111.065] (-1113.791) (-1109.288) (-1109.683) -- 0:00:49 196000 -- [-1112.984] (-1113.032) (-1111.594) (-1109.859) * (-1113.058) [-1111.964] (-1110.256) (-1111.086) -- 0:00:49 196500 -- (-1110.465) (-1110.013) [-1110.970] (-1110.746) * (-1111.007) (-1112.306) [-1109.025] (-1112.014) -- 0:00:49 197000 -- [-1109.745] (-1111.601) (-1112.951) (-1111.401) * [-1108.890] (-1110.130) (-1109.565) (-1112.704) -- 0:00:48 197500 -- (-1109.447) (-1111.035) (-1109.951) [-1111.620] * (-1112.133) (-1112.410) (-1109.731) [-1110.427] -- 0:00:48 198000 -- (-1110.915) [-1111.114] (-1112.239) (-1119.402) * (-1113.041) (-1111.748) [-1108.947] (-1109.834) -- 0:00:48 198500 -- (-1109.467) [-1110.713] (-1110.220) (-1109.564) * (-1112.186) (-1113.420) (-1111.483) [-1109.801] -- 0:00:48 199000 -- [-1109.280] (-1111.372) (-1110.281) (-1110.926) * [-1109.263] (-1108.620) (-1109.888) (-1110.286) -- 0:00:48 199500 -- (-1109.751) (-1110.539) [-1109.507] (-1112.218) * [-1111.116] (-1109.973) (-1110.264) (-1110.198) -- 0:00:48 200000 -- (-1108.494) (-1110.437) (-1111.584) [-1111.292] * (-1115.900) (-1112.310) [-1109.594] (-1110.125) -- 0:00:48 Average standard deviation of split frequencies: 0.024549 200500 -- (-1109.659) (-1111.492) (-1112.808) [-1110.332] * (-1114.547) [-1111.779] (-1109.635) (-1111.950) -- 0:00:47 201000 -- [-1109.659] (-1117.769) (-1113.664) (-1113.049) * (-1112.626) (-1111.269) (-1109.130) [-1109.880] -- 0:00:47 201500 -- (-1109.771) (-1109.179) (-1111.355) [-1110.613] * (-1112.023) (-1109.173) (-1111.073) [-1109.185] -- 0:00:47 202000 -- (-1110.051) [-1109.555] (-1111.534) (-1109.279) * (-1112.020) [-1114.030] (-1110.594) (-1110.877) -- 0:00:47 202500 -- (-1110.141) (-1109.526) (-1111.249) [-1108.834] * (-1111.066) (-1113.305) (-1109.854) [-1109.249] -- 0:00:47 203000 -- (-1109.598) [-1110.779] (-1112.471) (-1108.741) * [-1111.478] (-1109.522) (-1108.759) (-1109.901) -- 0:00:47 203500 -- [-1109.599] (-1111.641) (-1114.394) (-1110.803) * (-1109.490) [-1110.899] (-1108.456) (-1112.577) -- 0:00:46 204000 -- (-1109.495) [-1111.221] (-1115.125) (-1111.677) * [-1109.272] (-1110.989) (-1109.749) (-1112.070) -- 0:00:46 204500 -- [-1109.546] (-1111.720) (-1112.039) (-1115.077) * (-1110.247) (-1111.581) (-1110.957) [-1110.311] -- 0:00:46 205000 -- (-1111.734) [-1109.968] (-1109.349) (-1110.520) * (-1111.087) (-1111.752) (-1111.594) [-1111.140] -- 0:00:46 Average standard deviation of split frequencies: 0.024627 205500 -- [-1110.443] (-1109.715) (-1109.837) (-1113.346) * (-1110.562) (-1111.890) [-1111.399] (-1108.993) -- 0:00:46 206000 -- [-1109.306] (-1111.787) (-1111.785) (-1109.577) * (-1111.823) [-1112.233] (-1114.038) (-1109.451) -- 0:00:46 206500 -- [-1108.427] (-1112.658) (-1112.019) (-1112.477) * [-1112.796] (-1113.169) (-1113.559) (-1110.994) -- 0:00:46 207000 -- (-1109.803) [-1113.061] (-1113.520) (-1109.875) * (-1112.154) (-1113.169) (-1112.768) [-1110.265] -- 0:00:45 207500 -- (-1110.336) [-1111.317] (-1118.997) (-1111.617) * (-1110.737) (-1110.103) [-1113.365] (-1109.272) -- 0:00:45 208000 -- (-1111.378) (-1108.622) (-1110.567) [-1112.112] * (-1109.956) [-1111.840] (-1109.854) (-1111.971) -- 0:00:45 208500 -- (-1111.995) [-1109.078] (-1111.030) (-1113.574) * (-1111.170) (-1110.867) [-1108.834] (-1109.470) -- 0:00:45 209000 -- (-1109.727) (-1114.554) (-1114.720) [-1110.233] * (-1110.677) (-1110.615) (-1109.044) [-1109.922] -- 0:00:49 209500 -- (-1109.310) (-1113.734) [-1112.380] (-1111.098) * (-1111.235) (-1111.557) [-1109.731] (-1110.300) -- 0:00:49 210000 -- (-1110.943) (-1109.841) [-1111.172] (-1111.629) * (-1111.155) (-1118.362) (-1110.403) [-1113.207] -- 0:00:48 Average standard deviation of split frequencies: 0.022848 210500 -- [-1110.262] (-1109.785) (-1113.134) (-1111.431) * [-1111.557] (-1116.661) (-1109.989) (-1112.337) -- 0:00:48 211000 -- (-1110.321) (-1110.386) (-1110.948) [-1111.160] * [-1112.063] (-1111.127) (-1108.516) (-1110.031) -- 0:00:48 211500 -- [-1113.176] (-1108.801) (-1112.154) (-1111.659) * (-1112.740) [-1110.153] (-1108.567) (-1113.672) -- 0:00:48 212000 -- (-1112.190) [-1108.943] (-1110.579) (-1109.765) * (-1110.831) (-1108.501) [-1112.188] (-1114.272) -- 0:00:48 212500 -- (-1112.226) [-1110.080] (-1110.771) (-1109.398) * [-1109.046] (-1110.176) (-1112.054) (-1113.260) -- 0:00:48 213000 -- [-1108.690] (-1108.848) (-1116.834) (-1109.778) * (-1110.235) (-1110.045) [-1109.886] (-1119.523) -- 0:00:48 213500 -- [-1111.189] (-1109.745) (-1110.087) (-1109.014) * [-1110.076] (-1110.244) (-1109.354) (-1114.265) -- 0:00:47 214000 -- (-1111.070) (-1108.522) [-1109.794] (-1108.830) * (-1109.836) (-1110.717) [-1110.258] (-1112.113) -- 0:00:47 214500 -- (-1110.677) (-1111.744) [-1110.825] (-1108.847) * (-1112.122) [-1110.819] (-1110.584) (-1109.704) -- 0:00:47 215000 -- (-1108.650) (-1112.474) (-1114.108) [-1110.493] * (-1110.647) [-1110.802] (-1112.415) (-1116.647) -- 0:00:47 Average standard deviation of split frequencies: 0.021097 215500 -- [-1108.558] (-1110.831) (-1111.497) (-1112.336) * (-1114.332) [-1111.769] (-1112.930) (-1114.175) -- 0:00:47 216000 -- [-1111.181] (-1110.946) (-1110.721) (-1112.733) * (-1112.139) [-1110.700] (-1110.818) (-1110.207) -- 0:00:47 216500 -- (-1110.025) [-1110.079] (-1109.903) (-1108.908) * [-1112.350] (-1109.261) (-1111.084) (-1115.164) -- 0:00:47 217000 -- (-1110.941) [-1109.648] (-1116.810) (-1109.098) * (-1113.506) [-1109.906] (-1110.921) (-1110.239) -- 0:00:46 217500 -- [-1110.920] (-1112.627) (-1115.101) (-1113.973) * (-1112.092) [-1109.943] (-1110.919) (-1110.651) -- 0:00:46 218000 -- (-1114.295) (-1112.302) [-1114.735] (-1111.197) * [-1109.135] (-1111.009) (-1112.069) (-1110.037) -- 0:00:46 218500 -- [-1110.234] (-1108.625) (-1118.660) (-1109.940) * [-1108.760] (-1110.370) (-1110.490) (-1110.037) -- 0:00:46 219000 -- [-1109.678] (-1108.499) (-1110.857) (-1110.073) * [-1109.025] (-1110.199) (-1111.370) (-1111.000) -- 0:00:46 219500 -- [-1110.864] (-1108.740) (-1109.127) (-1109.814) * (-1108.622) (-1112.685) [-1111.591] (-1112.701) -- 0:00:46 220000 -- (-1111.122) [-1108.731] (-1109.262) (-1109.986) * [-1108.731] (-1112.797) (-1113.132) (-1113.603) -- 0:00:46 Average standard deviation of split frequencies: 0.020801 220500 -- (-1111.389) (-1110.361) (-1109.084) [-1109.013] * (-1110.967) [-1111.207] (-1109.538) (-1110.193) -- 0:00:45 221000 -- [-1110.292] (-1109.632) (-1110.612) (-1110.189) * (-1109.644) (-1112.397) [-1108.601] (-1110.853) -- 0:00:45 221500 -- [-1109.639] (-1109.498) (-1109.581) (-1109.055) * (-1110.324) (-1110.107) (-1110.275) [-1111.906] -- 0:00:45 222000 -- [-1110.518] (-1111.213) (-1108.632) (-1109.394) * (-1109.647) (-1110.426) [-1111.442] (-1112.419) -- 0:00:45 222500 -- (-1111.528) [-1110.744] (-1114.294) (-1109.962) * (-1112.813) (-1111.390) (-1109.560) [-1111.270] -- 0:00:45 223000 -- (-1109.661) (-1113.233) (-1109.747) [-1109.904] * [-1110.809] (-1113.582) (-1109.124) (-1110.957) -- 0:00:45 223500 -- [-1112.572] (-1111.951) (-1112.220) (-1108.642) * [-1109.835] (-1113.932) (-1110.203) (-1111.644) -- 0:00:45 224000 -- [-1111.657] (-1111.647) (-1111.008) (-1109.765) * (-1110.350) (-1110.437) [-1109.536] (-1111.426) -- 0:00:45 224500 -- (-1111.235) (-1111.824) [-1108.755] (-1111.508) * (-1109.521) (-1109.939) (-1109.247) [-1109.529] -- 0:00:44 225000 -- [-1109.987] (-1108.764) (-1109.117) (-1112.292) * [-1110.103] (-1112.918) (-1108.859) (-1109.443) -- 0:00:44 Average standard deviation of split frequencies: 0.020200 225500 -- (-1110.546) [-1110.744] (-1112.203) (-1108.946) * [-1111.538] (-1114.063) (-1109.107) (-1112.106) -- 0:00:48 226000 -- [-1111.530] (-1110.194) (-1111.237) (-1109.077) * [-1113.162] (-1110.353) (-1110.080) (-1112.256) -- 0:00:47 226500 -- (-1112.523) (-1110.696) (-1113.096) [-1110.495] * (-1113.013) [-1109.655] (-1109.597) (-1110.403) -- 0:00:47 227000 -- [-1109.540] (-1112.820) (-1112.130) (-1112.271) * (-1113.735) (-1110.635) (-1110.823) [-1113.954] -- 0:00:47 227500 -- [-1109.276] (-1110.306) (-1112.310) (-1112.664) * [-1111.511] (-1112.257) (-1110.132) (-1110.733) -- 0:00:47 228000 -- (-1109.393) (-1108.511) [-1108.449] (-1111.886) * (-1109.435) (-1111.811) (-1111.927) [-1109.808] -- 0:00:47 228500 -- (-1110.855) (-1110.231) [-1111.096] (-1110.637) * [-1109.488] (-1111.837) (-1115.628) (-1112.169) -- 0:00:47 229000 -- [-1109.523] (-1110.679) (-1112.658) (-1110.500) * [-1109.925] (-1109.628) (-1116.635) (-1111.515) -- 0:00:47 229500 -- (-1109.923) [-1110.233] (-1111.219) (-1115.655) * (-1111.156) [-1109.459] (-1113.199) (-1109.566) -- 0:00:47 230000 -- (-1110.891) [-1109.277] (-1110.068) (-1110.700) * (-1112.371) [-1110.887] (-1112.602) (-1109.309) -- 0:00:46 Average standard deviation of split frequencies: 0.019791 230500 -- (-1110.884) (-1110.470) [-1109.937] (-1110.744) * (-1113.532) (-1110.899) [-1110.502] (-1108.983) -- 0:00:46 231000 -- (-1112.095) (-1109.158) (-1111.924) [-1109.332] * [-1114.177] (-1109.693) (-1110.150) (-1110.617) -- 0:00:46 231500 -- (-1112.468) (-1108.860) [-1114.011] (-1111.270) * (-1109.124) [-1111.028] (-1110.036) (-1108.822) -- 0:00:46 232000 -- (-1108.906) (-1108.330) [-1110.313] (-1109.403) * (-1108.731) [-1111.874] (-1111.764) (-1111.111) -- 0:00:46 232500 -- (-1111.114) [-1109.681] (-1111.172) (-1111.288) * [-1109.753] (-1110.979) (-1109.577) (-1111.653) -- 0:00:46 233000 -- (-1109.945) [-1110.147] (-1109.596) (-1110.833) * (-1110.481) [-1109.095] (-1113.095) (-1108.900) -- 0:00:46 233500 -- (-1114.335) (-1109.535) [-1111.250] (-1109.688) * (-1108.890) (-1108.853) [-1110.290] (-1108.900) -- 0:00:45 234000 -- (-1109.624) (-1109.427) (-1109.946) [-1111.224] * [-1113.378] (-1109.016) (-1110.129) (-1109.764) -- 0:00:45 234500 -- (-1113.594) (-1110.497) (-1109.099) [-1110.149] * (-1112.786) (-1113.570) [-1111.269] (-1108.576) -- 0:00:45 235000 -- (-1109.790) (-1109.554) [-1109.402] (-1112.629) * (-1109.972) [-1111.162] (-1109.621) (-1109.293) -- 0:00:45 Average standard deviation of split frequencies: 0.018398 235500 -- [-1110.138] (-1109.362) (-1112.723) (-1110.869) * [-1112.088] (-1111.725) (-1108.854) (-1111.235) -- 0:00:45 236000 -- (-1110.672) (-1108.872) (-1113.445) [-1109.768] * (-1111.202) (-1110.854) [-1109.295] (-1109.305) -- 0:00:45 236500 -- (-1110.786) (-1109.275) [-1109.328] (-1113.519) * [-1112.162] (-1109.641) (-1113.610) (-1110.296) -- 0:00:45 237000 -- (-1109.428) (-1108.838) [-1108.706] (-1111.782) * [-1110.626] (-1109.530) (-1113.632) (-1109.849) -- 0:00:45 237500 -- (-1110.103) [-1108.784] (-1108.641) (-1109.325) * (-1111.922) (-1114.491) [-1110.189] (-1109.763) -- 0:00:44 238000 -- (-1110.030) (-1108.527) (-1110.478) [-1108.794] * (-1114.399) (-1110.830) [-1109.909] (-1108.631) -- 0:00:44 238500 -- (-1110.087) (-1111.981) (-1109.495) [-1112.156] * (-1112.131) (-1114.906) [-1112.044] (-1110.058) -- 0:00:44 239000 -- (-1111.637) (-1109.668) (-1109.030) [-1110.140] * (-1112.243) [-1110.684] (-1111.653) (-1110.897) -- 0:00:44 239500 -- [-1108.856] (-1109.620) (-1109.711) (-1112.568) * (-1110.575) (-1113.696) [-1109.533] (-1109.593) -- 0:00:44 240000 -- (-1111.358) (-1109.829) [-1109.398] (-1112.449) * (-1108.992) (-1109.357) [-1111.690] (-1109.052) -- 0:00:44 Average standard deviation of split frequencies: 0.015888 240500 -- (-1109.386) [-1109.506] (-1116.335) (-1110.331) * (-1109.285) (-1111.306) (-1115.505) [-1110.261] -- 0:00:44 241000 -- (-1109.103) (-1109.644) (-1120.628) [-1110.743] * [-1110.397] (-1116.689) (-1116.011) (-1110.016) -- 0:00:44 241500 -- (-1109.490) [-1109.046] (-1121.914) (-1114.478) * (-1110.168) (-1120.042) [-1110.359] (-1109.350) -- 0:00:43 242000 -- (-1111.060) (-1109.667) [-1111.815] (-1109.448) * [-1113.051] (-1118.390) (-1113.641) (-1109.648) -- 0:00:46 242500 -- (-1112.022) (-1110.699) [-1110.298] (-1112.553) * (-1109.646) (-1112.040) (-1109.423) [-1109.698] -- 0:00:46 243000 -- [-1108.987] (-1109.763) (-1112.251) (-1114.032) * (-1109.523) (-1113.508) (-1110.926) [-1109.337] -- 0:00:46 243500 -- (-1109.355) (-1112.712) (-1112.649) [-1113.607] * (-1109.739) (-1113.219) [-1112.246] (-1109.771) -- 0:00:46 244000 -- (-1111.038) [-1109.986] (-1109.664) (-1109.994) * [-1111.809] (-1111.781) (-1110.287) (-1110.789) -- 0:00:46 244500 -- (-1113.082) (-1113.930) (-1116.993) [-1109.459] * [-1109.263] (-1109.338) (-1108.410) (-1108.716) -- 0:00:46 245000 -- (-1112.849) [-1113.023] (-1113.867) (-1110.867) * (-1109.288) (-1109.152) [-1109.110] (-1108.721) -- 0:00:46 Average standard deviation of split frequencies: 0.016608 245500 -- (-1114.079) (-1117.570) [-1113.992] (-1114.225) * [-1110.495] (-1109.358) (-1109.013) (-1109.814) -- 0:00:46 246000 -- (-1112.329) (-1112.403) (-1113.435) [-1113.329] * (-1116.725) [-1108.878] (-1109.046) (-1110.443) -- 0:00:45 246500 -- [-1113.925] (-1110.202) (-1109.431) (-1108.437) * (-1114.138) (-1111.621) (-1110.963) [-1108.551] -- 0:00:45 247000 -- (-1109.883) [-1110.147] (-1110.875) (-1110.568) * (-1114.334) (-1109.833) (-1110.230) [-1108.544] -- 0:00:45 247500 -- (-1108.946) [-1113.614] (-1111.548) (-1108.469) * [-1116.693] (-1119.168) (-1113.589) (-1110.931) -- 0:00:45 248000 -- (-1113.567) (-1110.056) [-1112.869] (-1111.948) * (-1112.630) [-1110.142] (-1108.617) (-1111.081) -- 0:00:45 248500 -- [-1109.595] (-1109.781) (-1112.186) (-1109.481) * (-1112.840) (-1112.663) [-1109.125] (-1113.295) -- 0:00:45 249000 -- [-1111.004] (-1109.129) (-1109.203) (-1109.815) * (-1113.620) (-1113.183) [-1109.117] (-1113.471) -- 0:00:45 249500 -- (-1111.687) [-1110.705] (-1109.980) (-1111.340) * (-1113.617) (-1109.930) [-1108.870] (-1110.189) -- 0:00:45 250000 -- (-1110.501) (-1110.754) (-1110.179) [-1109.749] * (-1108.582) [-1110.261] (-1108.616) (-1110.673) -- 0:00:45 Average standard deviation of split frequencies: 0.016716 250500 -- (-1111.103) (-1111.771) (-1109.319) [-1110.554] * [-1111.072] (-1112.506) (-1108.583) (-1109.264) -- 0:00:44 251000 -- (-1111.272) (-1112.286) [-1110.204] (-1117.224) * [-1110.132] (-1111.831) (-1108.616) (-1109.424) -- 0:00:44 251500 -- [-1108.967] (-1109.819) (-1113.191) (-1110.721) * (-1109.807) [-1108.330] (-1114.034) (-1109.402) -- 0:00:44 252000 -- (-1111.744) [-1109.793] (-1112.156) (-1114.257) * (-1110.192) (-1108.622) (-1111.783) [-1109.952] -- 0:00:44 252500 -- (-1110.873) (-1110.437) [-1108.859] (-1111.573) * [-1110.213] (-1109.361) (-1110.191) (-1111.640) -- 0:00:44 253000 -- (-1111.464) [-1108.823] (-1113.171) (-1110.520) * [-1109.608] (-1113.216) (-1114.472) (-1111.049) -- 0:00:44 253500 -- (-1109.434) (-1109.416) (-1111.718) [-1110.312] * (-1110.114) (-1111.749) (-1111.168) [-1109.881] -- 0:00:44 254000 -- (-1109.821) (-1111.107) (-1114.642) [-1109.460] * [-1113.480] (-1109.600) (-1110.568) (-1110.402) -- 0:00:44 254500 -- [-1109.501] (-1116.663) (-1111.507) (-1111.462) * (-1112.942) (-1109.093) (-1112.801) [-1111.621] -- 0:00:43 255000 -- [-1108.912] (-1113.853) (-1112.810) (-1111.060) * [-1114.185] (-1109.373) (-1113.588) (-1110.687) -- 0:00:43 Average standard deviation of split frequencies: 0.016675 255500 -- (-1109.092) (-1109.589) (-1110.089) [-1111.432] * (-1119.751) (-1110.483) (-1112.747) [-1112.621] -- 0:00:43 256000 -- [-1109.595] (-1112.381) (-1110.811) (-1110.745) * (-1110.630) (-1110.228) (-1108.928) [-1110.931] -- 0:00:43 256500 -- (-1108.936) (-1113.277) (-1111.176) [-1112.418] * (-1110.305) (-1109.970) [-1108.397] (-1116.710) -- 0:00:43 257000 -- (-1109.273) [-1109.317] (-1109.269) (-1108.644) * (-1111.929) (-1110.924) (-1109.319) [-1116.705] -- 0:00:43 257500 -- [-1109.145] (-1109.556) (-1109.050) (-1109.768) * [-1110.461] (-1111.879) (-1108.683) (-1114.183) -- 0:00:43 258000 -- (-1109.360) [-1109.149] (-1109.584) (-1110.732) * (-1109.389) [-1110.503] (-1110.037) (-1110.288) -- 0:00:46 258500 -- (-1109.513) (-1108.782) [-1110.806] (-1109.370) * [-1111.342] (-1114.089) (-1112.429) (-1109.682) -- 0:00:45 259000 -- (-1109.171) (-1110.954) [-1112.168] (-1109.696) * (-1110.699) [-1113.780] (-1112.678) (-1110.700) -- 0:00:45 259500 -- (-1109.445) (-1108.513) (-1112.728) [-1109.306] * (-1111.562) (-1109.429) (-1108.798) [-1111.088] -- 0:00:45 260000 -- [-1108.808] (-1109.924) (-1109.916) (-1108.770) * (-1110.705) (-1110.443) (-1112.330) [-1109.086] -- 0:00:45 Average standard deviation of split frequencies: 0.014970 260500 -- [-1108.911] (-1110.728) (-1112.160) (-1114.463) * (-1111.010) (-1111.792) [-1109.247] (-1109.188) -- 0:00:45 261000 -- (-1109.256) (-1110.607) (-1112.334) [-1109.482] * (-1110.860) [-1110.239] (-1110.513) (-1112.944) -- 0:00:45 261500 -- [-1109.600] (-1115.102) (-1110.192) (-1111.253) * (-1110.690) (-1110.442) [-1110.888] (-1110.663) -- 0:00:45 262000 -- [-1112.436] (-1112.870) (-1108.991) (-1110.438) * (-1108.892) (-1110.921) [-1109.066] (-1109.407) -- 0:00:45 262500 -- (-1111.879) (-1110.322) (-1109.378) [-1112.296] * (-1108.533) (-1112.665) [-1109.489] (-1113.591) -- 0:00:44 263000 -- [-1111.747] (-1109.281) (-1113.370) (-1113.270) * [-1108.924] (-1110.261) (-1108.320) (-1109.373) -- 0:00:44 263500 -- [-1111.229] (-1110.936) (-1110.383) (-1112.939) * (-1109.627) (-1113.621) (-1113.005) [-1109.368] -- 0:00:44 264000 -- [-1111.741] (-1111.276) (-1110.154) (-1109.816) * (-1111.267) (-1111.650) (-1108.994) [-1108.860] -- 0:00:44 264500 -- (-1111.811) (-1111.852) [-1110.377] (-1109.989) * (-1110.707) [-1109.008] (-1109.985) (-1108.945) -- 0:00:44 265000 -- (-1111.922) (-1113.119) (-1112.089) [-1109.484] * [-1110.335] (-1109.439) (-1110.083) (-1110.991) -- 0:00:44 Average standard deviation of split frequencies: 0.014374 265500 -- [-1110.297] (-1113.660) (-1112.457) (-1109.245) * (-1109.370) [-1110.512] (-1110.276) (-1109.230) -- 0:00:44 266000 -- (-1108.960) [-1114.346] (-1110.025) (-1109.518) * (-1111.017) (-1110.164) [-1109.936] (-1109.637) -- 0:00:44 266500 -- [-1114.569] (-1113.251) (-1111.446) (-1113.274) * (-1110.288) (-1115.727) [-1108.841] (-1109.805) -- 0:00:44 267000 -- (-1115.292) (-1110.036) [-1110.111] (-1114.385) * (-1112.657) (-1109.402) [-1111.663] (-1113.105) -- 0:00:43 267500 -- (-1115.064) (-1110.060) [-1110.129] (-1110.244) * (-1108.519) [-1109.484] (-1110.616) (-1114.893) -- 0:00:43 268000 -- (-1113.474) (-1109.892) (-1111.666) [-1109.155] * (-1111.978) [-1108.989] (-1108.897) (-1109.204) -- 0:00:43 268500 -- (-1112.092) (-1110.411) (-1111.845) [-1110.124] * [-1111.513] (-1112.044) (-1109.027) (-1110.010) -- 0:00:43 269000 -- (-1110.149) (-1109.472) (-1111.752) [-1111.835] * (-1110.771) (-1109.575) [-1110.817] (-1109.157) -- 0:00:43 269500 -- [-1110.886] (-1113.197) (-1110.738) (-1110.755) * [-1111.119] (-1109.955) (-1113.724) (-1116.078) -- 0:00:43 270000 -- [-1110.503] (-1112.399) (-1110.390) (-1109.543) * [-1109.969] (-1113.595) (-1111.338) (-1112.971) -- 0:00:43 Average standard deviation of split frequencies: 0.014417 270500 -- (-1111.290) (-1112.363) (-1109.198) [-1114.180] * (-1109.969) [-1110.882] (-1110.213) (-1111.078) -- 0:00:43 271000 -- (-1114.686) (-1110.342) (-1110.672) [-1115.557] * (-1113.936) (-1111.442) (-1108.684) [-1111.071] -- 0:00:43 271500 -- [-1113.806] (-1111.982) (-1112.217) (-1114.878) * (-1109.969) (-1114.787) (-1110.952) [-1108.891] -- 0:00:42 272000 -- (-1114.448) (-1108.974) [-1114.450] (-1114.595) * (-1111.633) [-1111.224] (-1111.455) (-1108.886) -- 0:00:42 272500 -- (-1112.561) (-1111.311) [-1116.748] (-1117.469) * [-1110.332] (-1109.995) (-1115.844) (-1111.753) -- 0:00:42 273000 -- (-1110.933) (-1117.033) (-1112.514) [-1110.233] * [-1110.015] (-1111.905) (-1109.467) (-1110.572) -- 0:00:42 273500 -- [-1109.806] (-1112.204) (-1111.208) (-1111.137) * [-1109.479] (-1111.659) (-1113.097) (-1111.349) -- 0:00:42 274000 -- (-1112.241) (-1116.433) (-1112.969) [-1109.031] * [-1109.727] (-1113.428) (-1110.554) (-1109.881) -- 0:00:45 274500 -- (-1109.610) (-1115.280) [-1110.763] (-1109.040) * (-1109.776) (-1112.080) (-1110.339) [-1109.835] -- 0:00:44 275000 -- (-1112.421) (-1111.723) [-1110.584] (-1109.120) * (-1112.293) (-1110.730) (-1114.350) [-1109.848] -- 0:00:44 Average standard deviation of split frequencies: 0.015182 275500 -- (-1114.953) (-1112.524) (-1109.485) [-1109.658] * (-1111.467) (-1111.427) [-1113.821] (-1111.282) -- 0:00:44 276000 -- (-1109.923) (-1111.800) [-1110.053] (-1110.177) * [-1109.550] (-1112.191) (-1110.808) (-1114.106) -- 0:00:44 276500 -- [-1109.306] (-1110.985) (-1111.814) (-1110.084) * [-1109.306] (-1111.933) (-1111.135) (-1110.926) -- 0:00:44 277000 -- (-1111.823) [-1109.175] (-1112.371) (-1109.155) * (-1114.714) (-1113.586) [-1110.830] (-1111.721) -- 0:00:44 277500 -- [-1113.578] (-1110.226) (-1109.318) (-1110.249) * [-1109.884] (-1109.653) (-1109.771) (-1111.944) -- 0:00:44 278000 -- (-1115.254) (-1108.948) [-1111.537] (-1114.582) * (-1109.995) (-1110.728) (-1111.533) [-1111.393] -- 0:00:44 278500 -- (-1113.421) (-1109.021) (-1111.723) [-1110.647] * (-1110.380) (-1110.629) (-1112.987) [-1109.789] -- 0:00:44 279000 -- [-1108.914] (-1110.173) (-1110.285) (-1110.322) * (-1109.826) (-1110.518) [-1112.900] (-1109.821) -- 0:00:43 279500 -- [-1109.044] (-1113.332) (-1110.085) (-1112.621) * (-1113.296) (-1109.578) [-1113.350] (-1112.616) -- 0:00:43 280000 -- (-1109.539) (-1110.477) (-1110.606) [-1112.164] * [-1111.447] (-1109.102) (-1114.843) (-1115.355) -- 0:00:43 Average standard deviation of split frequencies: 0.015583 280500 -- (-1109.883) (-1111.166) [-1110.439] (-1108.868) * (-1109.947) (-1109.079) [-1109.735] (-1112.814) -- 0:00:43 281000 -- (-1108.786) [-1111.880] (-1110.390) (-1112.682) * (-1108.512) [-1113.205] (-1108.725) (-1112.527) -- 0:00:43 281500 -- (-1111.574) [-1111.234] (-1110.953) (-1109.074) * (-1112.076) (-1109.489) (-1109.011) [-1113.350] -- 0:00:43 282000 -- (-1111.255) [-1109.844] (-1113.487) (-1109.787) * (-1111.924) [-1108.645] (-1112.190) (-1114.068) -- 0:00:43 282500 -- (-1111.785) (-1112.871) [-1113.356] (-1112.041) * (-1121.421) [-1108.902] (-1110.766) (-1110.421) -- 0:00:43 283000 -- (-1112.492) (-1115.944) (-1113.985) [-1110.817] * (-1110.094) [-1110.327] (-1112.457) (-1110.828) -- 0:00:43 283500 -- (-1111.011) [-1111.154] (-1109.749) (-1108.895) * (-1113.481) (-1111.812) (-1110.979) [-1110.949] -- 0:00:42 284000 -- [-1110.089] (-1109.753) (-1109.888) (-1111.122) * (-1111.670) (-1111.267) (-1110.557) [-1111.530] -- 0:00:42 284500 -- [-1110.629] (-1109.898) (-1111.082) (-1112.435) * (-1111.015) (-1112.264) (-1110.068) [-1111.974] -- 0:00:42 285000 -- [-1115.409] (-1114.711) (-1109.025) (-1108.671) * (-1112.032) (-1110.822) (-1110.563) [-1111.280] -- 0:00:42 Average standard deviation of split frequencies: 0.016116 285500 -- (-1114.238) (-1113.639) (-1109.598) [-1109.401] * (-1112.186) [-1108.734] (-1108.794) (-1115.219) -- 0:00:42 286000 -- [-1113.185] (-1117.658) (-1109.568) (-1109.010) * (-1112.135) (-1111.703) [-1110.912] (-1119.792) -- 0:00:42 286500 -- [-1109.446] (-1112.652) (-1118.987) (-1108.848) * (-1114.402) (-1111.112) [-1111.110] (-1118.660) -- 0:00:42 287000 -- (-1109.890) (-1109.849) [-1111.602] (-1110.738) * (-1109.157) [-1109.430] (-1113.498) (-1112.175) -- 0:00:42 287500 -- (-1108.798) [-1108.400] (-1113.310) (-1110.558) * [-1109.124] (-1112.982) (-1109.558) (-1115.648) -- 0:00:42 288000 -- (-1111.185) (-1109.049) (-1112.224) [-1111.948] * (-1111.618) [-1110.693] (-1110.361) (-1114.211) -- 0:00:42 288500 -- (-1114.580) [-1109.956] (-1110.108) (-1110.428) * (-1112.778) (-1109.612) (-1108.994) [-1109.929] -- 0:00:41 289000 -- (-1110.754) (-1110.541) [-1110.627] (-1113.154) * [-1110.294] (-1109.442) (-1109.948) (-1112.821) -- 0:00:41 289500 -- (-1109.907) (-1114.295) [-1110.280] (-1111.617) * (-1110.508) (-1109.567) [-1109.795] (-1111.439) -- 0:00:41 290000 -- (-1109.139) [-1110.076] (-1109.697) (-1111.245) * (-1109.885) (-1113.089) [-1109.715] (-1109.782) -- 0:00:41 Average standard deviation of split frequencies: 0.014957 290500 -- (-1110.687) [-1117.995] (-1110.538) (-1111.057) * (-1110.746) (-1113.170) [-1109.743] (-1111.360) -- 0:00:43 291000 -- [-1111.094] (-1117.697) (-1110.524) (-1112.582) * (-1112.384) [-1112.146] (-1110.239) (-1110.826) -- 0:00:43 291500 -- [-1111.585] (-1123.010) (-1110.808) (-1113.075) * (-1113.551) (-1111.644) [-1112.898] (-1108.973) -- 0:00:43 292000 -- (-1108.781) (-1110.806) [-1108.953] (-1108.897) * (-1114.613) (-1112.898) (-1112.055) [-1109.915] -- 0:00:43 292500 -- (-1109.688) [-1109.245] (-1108.952) (-1112.297) * (-1112.059) (-1113.087) (-1111.786) [-1109.178] -- 0:00:43 293000 -- (-1111.366) (-1109.246) (-1109.698) [-1110.889] * (-1110.588) (-1112.635) [-1111.913] (-1112.843) -- 0:00:43 293500 -- (-1111.179) (-1112.048) (-1111.078) [-1111.095] * (-1111.100) [-1114.564] (-1112.168) (-1117.411) -- 0:00:43 294000 -- (-1114.125) (-1108.655) [-1111.218] (-1110.918) * [-1111.309] (-1109.746) (-1114.704) (-1112.063) -- 0:00:43 294500 -- [-1112.284] (-1111.092) (-1111.445) (-1109.356) * (-1111.127) (-1110.286) (-1111.987) [-1110.795] -- 0:00:43 295000 -- (-1110.798) (-1108.807) [-1109.201] (-1110.960) * (-1113.490) (-1113.628) [-1110.067] (-1109.779) -- 0:00:43 Average standard deviation of split frequencies: 0.014333 295500 -- (-1113.140) [-1109.392] (-1109.460) (-1113.175) * (-1113.188) [-1113.333] (-1111.368) (-1110.390) -- 0:00:42 296000 -- (-1109.408) (-1109.166) [-1111.384] (-1110.046) * (-1114.766) (-1112.165) (-1112.901) [-1109.737] -- 0:00:42 296500 -- (-1115.128) [-1109.166] (-1111.715) (-1109.237) * (-1112.180) (-1110.227) (-1113.787) [-1108.924] -- 0:00:42 297000 -- (-1115.369) (-1109.425) (-1112.872) [-1111.840] * (-1113.515) (-1114.546) (-1114.904) [-1109.852] -- 0:00:42 297500 -- (-1113.691) (-1110.478) [-1111.878] (-1108.498) * [-1110.100] (-1115.918) (-1110.200) (-1110.044) -- 0:00:42 298000 -- (-1111.357) (-1109.861) [-1113.328] (-1110.506) * (-1114.200) (-1114.426) (-1109.787) [-1109.115] -- 0:00:42 298500 -- [-1109.623] (-1111.785) (-1109.576) (-1114.077) * [-1112.083] (-1114.461) (-1109.430) (-1109.095) -- 0:00:42 299000 -- (-1109.493) (-1112.507) (-1109.884) [-1110.032] * [-1111.886] (-1116.181) (-1113.220) (-1111.449) -- 0:00:42 299500 -- (-1108.859) (-1110.537) [-1109.495] (-1111.249) * (-1112.616) (-1117.626) [-1111.337] (-1110.307) -- 0:00:42 300000 -- (-1111.417) (-1111.845) (-1111.161) [-1110.339] * (-1112.157) (-1109.857) (-1113.634) [-1110.699] -- 0:00:42 Average standard deviation of split frequencies: 0.013588 300500 -- [-1112.543] (-1113.323) (-1111.633) (-1112.332) * (-1112.460) [-1110.282] (-1111.446) (-1110.759) -- 0:00:41 301000 -- (-1115.950) (-1115.866) [-1111.798] (-1109.182) * (-1110.374) (-1113.996) [-1113.427] (-1110.488) -- 0:00:41 301500 -- (-1115.133) [-1114.215] (-1109.050) (-1110.438) * (-1108.837) (-1109.757) (-1112.269) [-1115.033] -- 0:00:41 302000 -- (-1113.251) (-1114.662) [-1109.061] (-1110.967) * (-1109.714) (-1111.615) (-1113.483) [-1110.624] -- 0:00:41 302500 -- [-1110.883] (-1114.152) (-1111.028) (-1109.306) * [-1109.388] (-1110.827) (-1111.087) (-1110.901) -- 0:00:41 303000 -- [-1108.496] (-1110.004) (-1108.994) (-1109.787) * (-1110.211) (-1117.060) [-1109.538] (-1114.021) -- 0:00:41 303500 -- (-1108.628) (-1110.419) [-1109.193] (-1109.693) * (-1109.977) (-1114.692) (-1111.114) [-1115.667] -- 0:00:41 304000 -- (-1113.366) (-1110.010) [-1110.831] (-1111.237) * (-1112.200) [-1108.964] (-1114.154) (-1119.175) -- 0:00:41 304500 -- (-1110.646) (-1109.992) [-1114.581] (-1110.005) * (-1110.260) [-1110.352] (-1110.607) (-1110.116) -- 0:00:41 305000 -- (-1110.294) [-1114.097] (-1108.849) (-1110.245) * (-1118.949) (-1112.496) [-1110.797] (-1110.185) -- 0:00:41 Average standard deviation of split frequencies: 0.013522 305500 -- [-1110.114] (-1112.300) (-1108.780) (-1108.994) * (-1110.389) (-1111.770) (-1109.719) [-1109.371] -- 0:00:40 306000 -- [-1109.558] (-1109.884) (-1110.846) (-1109.088) * [-1110.011] (-1109.695) (-1110.009) (-1110.363) -- 0:00:43 306500 -- [-1108.770] (-1112.059) (-1110.550) (-1109.756) * (-1113.192) (-1110.362) [-1114.941] (-1110.462) -- 0:00:42 307000 -- (-1109.184) (-1112.882) [-1110.012] (-1109.275) * (-1112.226) (-1110.233) [-1110.367] (-1111.009) -- 0:00:42 307500 -- [-1113.874] (-1110.266) (-1110.484) (-1109.597) * [-1111.931] (-1110.792) (-1111.090) (-1110.729) -- 0:00:42 308000 -- (-1112.231) (-1110.610) [-1109.760] (-1109.207) * (-1110.245) [-1109.092] (-1111.867) (-1110.313) -- 0:00:42 308500 -- (-1109.954) (-1110.608) (-1110.138) [-1109.260] * (-1109.958) (-1109.871) [-1111.614] (-1110.068) -- 0:00:42 309000 -- (-1111.858) (-1110.970) [-1110.581] (-1111.573) * (-1109.279) (-1110.694) (-1112.766) [-1109.609] -- 0:00:42 309500 -- (-1112.469) (-1115.760) [-1111.589] (-1111.334) * (-1111.892) (-1112.824) [-1110.498] (-1109.392) -- 0:00:42 310000 -- [-1110.186] (-1113.007) (-1110.680) (-1110.920) * (-1111.082) [-1113.130] (-1110.307) (-1110.656) -- 0:00:42 Average standard deviation of split frequencies: 0.012814 310500 -- [-1109.646] (-1112.943) (-1110.214) (-1111.165) * (-1111.005) [-1113.823] (-1113.282) (-1109.123) -- 0:00:42 311000 -- (-1111.614) [-1110.001] (-1113.468) (-1110.552) * (-1108.706) (-1109.434) (-1113.629) [-1110.050] -- 0:00:42 311500 -- (-1111.283) (-1109.432) [-1111.404] (-1110.484) * (-1108.773) [-1110.639] (-1112.532) (-1110.504) -- 0:00:41 312000 -- (-1110.661) [-1109.144] (-1112.181) (-1111.831) * (-1109.127) (-1110.127) (-1115.519) [-1112.643] -- 0:00:41 312500 -- (-1111.146) [-1108.616] (-1111.686) (-1113.661) * (-1114.877) (-1110.146) (-1108.788) [-1110.251] -- 0:00:41 313000 -- (-1117.475) [-1110.063] (-1111.801) (-1109.989) * (-1113.759) [-1109.888] (-1112.672) (-1111.346) -- 0:00:41 313500 -- [-1111.754] (-1109.416) (-1110.885) (-1112.169) * (-1112.482) [-1115.295] (-1110.167) (-1110.360) -- 0:00:41 314000 -- (-1113.830) (-1112.438) (-1109.302) [-1114.241] * [-1114.056] (-1115.129) (-1112.489) (-1109.328) -- 0:00:41 314500 -- (-1109.059) (-1111.710) [-1111.511] (-1109.924) * (-1114.197) (-1113.511) (-1113.046) [-1109.687] -- 0:00:41 315000 -- [-1108.995] (-1112.169) (-1109.218) (-1110.291) * (-1111.212) (-1110.485) [-1111.270] (-1109.790) -- 0:00:41 Average standard deviation of split frequencies: 0.013012 315500 -- (-1111.341) (-1110.711) [-1109.696] (-1114.579) * (-1111.474) [-1109.508] (-1113.184) (-1110.447) -- 0:00:41 316000 -- (-1110.065) [-1109.266] (-1112.440) (-1115.407) * (-1111.562) (-1110.705) [-1113.261] (-1110.751) -- 0:00:41 316500 -- (-1109.206) (-1111.415) (-1111.555) [-1110.648] * [-1108.964] (-1108.833) (-1111.743) (-1110.172) -- 0:00:41 317000 -- (-1114.870) (-1112.515) [-1110.221] (-1113.985) * [-1109.597] (-1109.403) (-1110.685) (-1112.865) -- 0:00:40 317500 -- [-1116.414] (-1112.981) (-1113.091) (-1110.704) * (-1111.851) (-1111.542) [-1108.931] (-1112.336) -- 0:00:40 318000 -- (-1112.687) (-1113.324) (-1113.337) [-1110.535] * (-1110.808) (-1111.948) [-1109.803] (-1114.284) -- 0:00:40 318500 -- (-1111.621) (-1116.046) (-1109.918) [-1112.751] * (-1112.040) (-1110.372) [-1111.421] (-1112.415) -- 0:00:40 319000 -- (-1110.286) [-1113.625] (-1110.124) (-1115.632) * (-1113.728) (-1111.263) [-1112.243] (-1115.055) -- 0:00:40 319500 -- [-1110.139] (-1110.154) (-1109.502) (-1117.512) * (-1112.381) (-1111.792) (-1111.690) [-1110.851] -- 0:00:40 320000 -- (-1108.369) (-1110.002) (-1109.786) [-1109.481] * (-1109.427) (-1114.762) (-1110.495) [-1110.756] -- 0:00:40 Average standard deviation of split frequencies: 0.014009 320500 -- [-1109.130] (-1111.390) (-1109.964) (-1109.055) * (-1109.609) [-1109.709] (-1110.902) (-1115.887) -- 0:00:40 321000 -- (-1111.069) [-1109.192] (-1109.262) (-1108.471) * [-1112.885] (-1112.493) (-1112.177) (-1110.131) -- 0:00:40 321500 -- (-1110.848) (-1112.997) [-1109.441] (-1110.450) * (-1112.121) (-1109.020) (-1113.133) [-1110.180] -- 0:00:40 322000 -- (-1108.799) (-1111.470) (-1110.402) [-1110.530] * (-1113.772) (-1111.914) (-1115.586) [-1111.527] -- 0:00:40 322500 -- [-1110.400] (-1110.255) (-1111.958) (-1111.098) * (-1111.847) (-1113.000) (-1119.586) [-1110.258] -- 0:00:42 323000 -- [-1110.227] (-1110.327) (-1109.465) (-1113.276) * (-1111.757) (-1110.874) [-1110.061] (-1110.966) -- 0:00:41 323500 -- [-1110.692] (-1110.392) (-1113.339) (-1112.378) * (-1112.491) (-1110.071) (-1110.769) [-1113.029] -- 0:00:41 324000 -- (-1111.092) [-1109.933] (-1112.827) (-1111.063) * [-1109.844] (-1109.556) (-1111.797) (-1111.621) -- 0:00:41 324500 -- (-1109.072) (-1110.116) (-1116.402) [-1109.795] * (-1110.526) [-1109.574] (-1113.313) (-1110.939) -- 0:00:41 325000 -- (-1110.923) [-1111.240] (-1115.247) (-1110.715) * (-1109.536) (-1113.049) [-1110.749] (-1110.094) -- 0:00:41 Average standard deviation of split frequencies: 0.013416 325500 -- (-1109.295) (-1109.879) (-1110.166) [-1109.747] * (-1112.818) [-1109.065] (-1112.449) (-1109.375) -- 0:00:41 326000 -- (-1110.217) (-1111.458) (-1112.592) [-1109.064] * (-1112.584) (-1110.316) (-1110.310) [-1112.522] -- 0:00:41 326500 -- [-1109.955] (-1109.759) (-1111.705) (-1109.894) * (-1111.927) (-1110.398) [-1110.155] (-1113.652) -- 0:00:41 327000 -- (-1111.775) (-1112.116) (-1112.566) [-1110.673] * (-1110.334) [-1109.485] (-1110.911) (-1111.005) -- 0:00:41 327500 -- (-1111.932) [-1113.086] (-1112.635) (-1114.125) * (-1113.011) (-1110.668) (-1108.609) [-1114.561] -- 0:00:41 328000 -- [-1109.890] (-1112.882) (-1111.802) (-1112.701) * (-1111.139) (-1111.961) (-1109.434) [-1116.358] -- 0:00:40 328500 -- [-1108.834] (-1116.878) (-1113.244) (-1110.268) * (-1112.262) (-1111.009) (-1109.363) [-1110.278] -- 0:00:40 329000 -- (-1109.752) (-1114.927) (-1109.175) [-1109.610] * (-1114.033) [-1111.322] (-1108.869) (-1108.731) -- 0:00:40 329500 -- (-1110.585) (-1112.178) [-1109.301] (-1110.072) * (-1112.904) [-1109.072] (-1112.727) (-1108.507) -- 0:00:40 330000 -- (-1109.844) (-1112.732) (-1109.735) [-1110.247] * (-1111.107) (-1112.841) [-1109.770] (-1111.689) -- 0:00:40 Average standard deviation of split frequencies: 0.013147 330500 -- (-1109.581) (-1111.689) (-1109.340) [-1111.941] * (-1112.744) (-1112.175) (-1111.753) [-1108.318] -- 0:00:40 331000 -- (-1109.037) (-1110.639) [-1110.229] (-1109.573) * [-1113.413] (-1113.663) (-1111.796) (-1108.884) -- 0:00:40 331500 -- (-1110.502) [-1111.621] (-1111.150) (-1112.054) * (-1114.103) [-1115.829] (-1110.831) (-1112.402) -- 0:00:40 332000 -- (-1111.037) (-1110.956) [-1112.800] (-1111.896) * (-1111.341) (-1113.439) [-1110.522] (-1112.163) -- 0:00:40 332500 -- (-1114.537) [-1110.149] (-1112.651) (-1109.642) * (-1111.518) (-1115.976) [-1110.779] (-1112.434) -- 0:00:40 333000 -- [-1111.563] (-1110.577) (-1110.659) (-1110.952) * (-1111.678) [-1115.282] (-1109.509) (-1109.994) -- 0:00:40 333500 -- (-1110.741) [-1109.852] (-1110.582) (-1109.906) * (-1111.305) (-1110.566) (-1110.883) [-1110.851] -- 0:00:39 334000 -- (-1116.965) [-1112.772] (-1110.712) (-1114.658) * (-1109.623) (-1114.700) [-1109.886] (-1110.401) -- 0:00:39 334500 -- (-1109.352) (-1111.067) (-1112.362) [-1109.435] * (-1111.131) (-1118.758) (-1111.827) [-1111.579] -- 0:00:39 335000 -- [-1108.545] (-1111.469) (-1109.081) (-1110.576) * [-1109.164] (-1113.121) (-1110.251) (-1109.524) -- 0:00:39 Average standard deviation of split frequencies: 0.013562 335500 -- [-1108.712] (-1108.839) (-1109.418) (-1110.302) * (-1110.330) (-1114.404) (-1113.277) [-1110.894] -- 0:00:39 336000 -- [-1109.997] (-1108.773) (-1110.940) (-1112.311) * (-1110.735) (-1111.043) (-1111.731) [-1110.996] -- 0:00:39 336500 -- [-1112.179] (-1112.809) (-1110.994) (-1112.629) * (-1110.942) (-1110.387) (-1110.715) [-1112.290] -- 0:00:39 337000 -- (-1110.425) [-1112.865] (-1111.648) (-1112.407) * (-1111.000) (-1112.381) [-1111.581] (-1112.195) -- 0:00:39 337500 -- (-1109.445) (-1112.313) [-1111.709] (-1111.161) * (-1112.620) (-1111.512) [-1110.401] (-1113.141) -- 0:00:39 338000 -- [-1110.390] (-1109.835) (-1110.036) (-1110.146) * (-1111.527) (-1110.125) [-1110.354] (-1109.542) -- 0:00:39 338500 -- [-1109.814] (-1111.319) (-1111.166) (-1110.949) * [-1109.876] (-1109.728) (-1111.483) (-1112.118) -- 0:00:41 339000 -- (-1108.359) (-1112.571) [-1110.592] (-1111.516) * [-1109.239] (-1111.109) (-1112.203) (-1114.175) -- 0:00:40 339500 -- (-1108.344) [-1115.711] (-1109.176) (-1111.601) * (-1108.618) (-1112.636) (-1112.157) [-1111.117] -- 0:00:40 340000 -- (-1109.638) (-1113.246) [-1112.977] (-1109.351) * (-1111.436) (-1112.269) [-1110.232] (-1109.349) -- 0:00:40 Average standard deviation of split frequencies: 0.013530 340500 -- (-1112.219) [-1110.156] (-1112.811) (-1109.061) * (-1110.996) (-1112.008) [-1110.672] (-1109.998) -- 0:00:40 341000 -- [-1115.455] (-1110.196) (-1114.557) (-1108.693) * [-1108.801] (-1113.314) (-1110.605) (-1109.816) -- 0:00:40 341500 -- (-1112.341) [-1111.878] (-1114.280) (-1111.681) * (-1109.403) [-1113.252] (-1109.628) (-1108.865) -- 0:00:40 342000 -- (-1108.601) (-1111.473) (-1109.680) [-1113.046] * (-1108.781) [-1115.120] (-1109.352) (-1108.744) -- 0:00:40 342500 -- [-1109.637] (-1111.529) (-1109.603) (-1111.223) * (-1109.633) [-1111.016] (-1110.119) (-1110.385) -- 0:00:40 343000 -- [-1109.637] (-1110.037) (-1111.192) (-1111.702) * (-1109.756) (-1110.747) [-1109.916] (-1110.800) -- 0:00:40 343500 -- (-1109.989) [-1109.504] (-1113.254) (-1110.541) * [-1111.193] (-1109.272) (-1110.806) (-1109.778) -- 0:00:40 344000 -- (-1113.460) [-1111.033] (-1112.411) (-1111.651) * (-1110.863) (-1114.435) (-1111.002) [-1108.706] -- 0:00:40 344500 -- (-1114.076) (-1110.213) (-1112.460) [-1111.847] * (-1111.986) (-1112.852) [-1108.852] (-1113.003) -- 0:00:39 345000 -- [-1112.576] (-1112.073) (-1114.661) (-1110.839) * [-1110.601] (-1114.003) (-1111.746) (-1111.249) -- 0:00:39 Average standard deviation of split frequencies: 0.013051 345500 -- (-1116.970) [-1109.977] (-1108.498) (-1113.710) * (-1110.287) (-1110.016) (-1111.378) [-1114.701] -- 0:00:39 346000 -- (-1113.770) (-1109.395) (-1109.636) [-1110.778] * (-1109.766) [-1110.369] (-1112.076) (-1109.199) -- 0:00:39 346500 -- [-1110.510] (-1110.328) (-1113.108) (-1112.058) * (-1108.974) (-1108.531) [-1110.777] (-1110.145) -- 0:00:39 347000 -- (-1109.930) [-1110.143] (-1111.465) (-1113.947) * (-1108.929) [-1110.026] (-1110.022) (-1109.962) -- 0:00:39 347500 -- [-1110.692] (-1108.612) (-1111.479) (-1110.704) * [-1109.485] (-1111.045) (-1114.953) (-1112.042) -- 0:00:39 348000 -- (-1112.533) (-1109.002) (-1112.039) [-1110.710] * [-1110.653] (-1110.636) (-1113.276) (-1112.321) -- 0:00:39 348500 -- [-1111.884] (-1108.676) (-1111.527) (-1112.311) * (-1111.299) (-1110.486) (-1110.021) [-1112.465] -- 0:00:39 349000 -- (-1109.122) (-1108.515) [-1109.841] (-1115.364) * (-1109.649) (-1111.883) [-1110.917] (-1110.336) -- 0:00:39 349500 -- (-1108.797) (-1110.354) (-1111.154) [-1108.457] * (-1112.892) (-1111.575) (-1111.322) [-1109.451] -- 0:00:39 350000 -- [-1108.765] (-1109.171) (-1109.839) (-1109.358) * [-1112.741] (-1113.677) (-1109.680) (-1109.128) -- 0:00:39 Average standard deviation of split frequencies: 0.013726 350500 -- (-1109.716) [-1110.541] (-1111.352) (-1108.966) * [-1111.715] (-1110.961) (-1110.323) (-1108.343) -- 0:00:38 351000 -- (-1112.584) [-1109.012] (-1112.515) (-1109.267) * [-1112.498] (-1110.999) (-1114.945) (-1108.307) -- 0:00:38 351500 -- [-1110.609] (-1110.245) (-1113.195) (-1109.750) * (-1109.380) [-1110.863] (-1113.420) (-1112.911) -- 0:00:38 352000 -- (-1109.914) (-1113.605) [-1111.376] (-1110.746) * [-1111.010] (-1111.120) (-1112.181) (-1111.164) -- 0:00:38 352500 -- [-1111.411] (-1114.042) (-1111.456) (-1111.637) * (-1112.575) (-1112.231) (-1114.677) [-1112.433] -- 0:00:38 353000 -- (-1110.760) (-1109.365) [-1108.853] (-1111.943) * (-1112.118) (-1113.600) [-1108.637] (-1111.561) -- 0:00:38 353500 -- (-1108.878) (-1111.287) [-1109.354] (-1109.932) * (-1110.239) (-1110.113) (-1109.059) [-1110.851] -- 0:00:38 354000 -- [-1109.817] (-1113.509) (-1109.224) (-1110.979) * [-1109.092] (-1110.220) (-1109.869) (-1110.346) -- 0:00:38 354500 -- (-1110.051) (-1111.905) [-1109.195] (-1109.680) * (-1109.743) (-1109.464) [-1113.477] (-1111.819) -- 0:00:38 355000 -- (-1109.190) [-1110.482] (-1109.843) (-1111.171) * (-1109.943) [-1111.614] (-1112.740) (-1111.967) -- 0:00:39 Average standard deviation of split frequencies: 0.013451 355500 -- (-1109.343) (-1110.137) [-1109.011] (-1112.140) * [-1109.391] (-1108.778) (-1112.685) (-1109.986) -- 0:00:39 356000 -- (-1109.586) (-1109.480) (-1109.459) [-1108.816] * (-1110.299) (-1108.823) [-1111.503] (-1110.382) -- 0:00:39 356500 -- [-1111.688] (-1110.887) (-1114.093) (-1109.076) * (-1112.847) [-1110.059] (-1110.926) (-1111.445) -- 0:00:39 357000 -- (-1110.816) [-1109.355] (-1109.812) (-1109.494) * [-1109.390] (-1110.941) (-1111.716) (-1108.671) -- 0:00:39 357500 -- [-1109.826] (-1109.235) (-1112.086) (-1111.819) * (-1112.402) [-1109.669] (-1110.759) (-1109.447) -- 0:00:39 358000 -- [-1111.714] (-1111.483) (-1110.095) (-1114.167) * (-1111.791) (-1109.111) [-1110.495] (-1109.470) -- 0:00:39 358500 -- (-1112.274) (-1109.521) [-1112.489] (-1112.589) * (-1111.043) [-1111.725] (-1112.068) (-1111.109) -- 0:00:39 359000 -- (-1110.160) [-1111.258] (-1110.830) (-1110.096) * [-1110.177] (-1109.218) (-1110.037) (-1109.731) -- 0:00:39 359500 -- [-1110.030] (-1110.619) (-1110.154) (-1110.203) * (-1111.064) [-1109.166] (-1110.143) (-1112.394) -- 0:00:39 360000 -- (-1111.410) (-1109.115) (-1110.273) [-1109.208] * (-1110.738) (-1113.825) (-1112.772) [-1111.650] -- 0:00:39 Average standard deviation of split frequencies: 0.013277 360500 -- (-1111.153) [-1111.457] (-1111.768) (-1109.546) * (-1111.606) (-1111.309) [-1111.219] (-1111.637) -- 0:00:39 361000 -- (-1112.586) (-1113.670) (-1109.771) [-1112.511] * (-1112.139) (-1111.454) (-1109.524) [-1109.990] -- 0:00:38 361500 -- (-1109.957) (-1112.356) [-1111.724] (-1114.299) * [-1109.492] (-1113.027) (-1109.367) (-1110.689) -- 0:00:38 362000 -- (-1109.786) (-1113.188) [-1111.781] (-1112.538) * (-1110.190) (-1110.243) [-1109.779] (-1113.656) -- 0:00:38 362500 -- (-1109.657) (-1118.467) [-1110.733] (-1111.477) * (-1110.083) (-1110.289) [-1109.349] (-1112.306) -- 0:00:38 363000 -- [-1110.328] (-1121.376) (-1109.489) (-1110.235) * (-1109.984) (-1110.966) (-1109.307) [-1110.766] -- 0:00:38 363500 -- [-1109.994] (-1114.665) (-1109.257) (-1109.817) * (-1109.426) (-1108.908) [-1108.855] (-1112.071) -- 0:00:38 364000 -- (-1118.101) (-1109.945) (-1110.885) [-1109.827] * (-1111.082) (-1112.686) [-1108.830] (-1112.753) -- 0:00:38 364500 -- (-1112.665) (-1110.326) [-1109.737] (-1109.653) * [-1109.380] (-1110.432) (-1109.776) (-1109.891) -- 0:00:38 365000 -- (-1109.187) [-1112.881] (-1114.087) (-1110.564) * [-1109.528] (-1111.182) (-1109.242) (-1108.947) -- 0:00:38 Average standard deviation of split frequencies: 0.014032 365500 -- [-1108.900] (-1115.614) (-1111.640) (-1109.541) * [-1110.581] (-1109.607) (-1110.371) (-1110.739) -- 0:00:38 366000 -- (-1112.175) (-1113.439) [-1109.470] (-1113.705) * (-1108.685) [-1113.572] (-1109.771) (-1108.884) -- 0:00:38 366500 -- [-1111.507] (-1111.264) (-1111.227) (-1113.296) * (-1110.965) (-1111.050) (-1112.096) [-1109.931] -- 0:00:38 367000 -- [-1110.769] (-1108.596) (-1113.995) (-1111.592) * (-1109.673) (-1110.915) (-1112.356) [-1108.960] -- 0:00:37 367500 -- (-1110.362) (-1109.557) (-1110.844) [-1109.099] * (-1110.307) [-1109.932] (-1114.573) (-1109.352) -- 0:00:37 368000 -- (-1114.897) [-1111.104] (-1110.585) (-1109.181) * (-1112.983) [-1110.980] (-1110.309) (-1110.736) -- 0:00:37 368500 -- (-1113.007) [-1109.252] (-1111.135) (-1114.059) * (-1111.940) (-1113.510) (-1108.604) [-1111.125] -- 0:00:37 369000 -- (-1114.409) (-1109.703) (-1115.157) [-1115.636] * (-1112.031) (-1111.526) (-1109.854) [-1112.376] -- 0:00:37 369500 -- [-1109.682] (-1111.369) (-1115.074) (-1109.929) * (-1112.343) (-1111.931) [-1116.693] (-1115.874) -- 0:00:37 370000 -- (-1115.673) [-1108.682] (-1111.650) (-1109.532) * (-1111.870) [-1112.266] (-1111.184) (-1109.329) -- 0:00:37 Average standard deviation of split frequencies: 0.014659 370500 -- (-1110.778) (-1110.108) (-1112.613) [-1110.999] * (-1111.141) [-1109.022] (-1111.388) (-1110.340) -- 0:00:37 371000 -- (-1110.360) (-1112.686) (-1110.740) [-1112.489] * (-1110.411) [-1110.561] (-1113.334) (-1110.275) -- 0:00:38 371500 -- [-1109.134] (-1113.121) (-1109.755) (-1109.373) * (-1113.459) (-1110.044) [-1111.332] (-1117.502) -- 0:00:38 372000 -- (-1109.010) (-1115.115) (-1110.195) [-1109.233] * (-1110.230) (-1111.310) [-1109.199] (-1112.626) -- 0:00:38 372500 -- (-1110.201) (-1109.509) (-1112.613) [-1109.354] * (-1110.235) (-1110.790) [-1110.344] (-1112.041) -- 0:00:38 373000 -- (-1109.425) (-1109.756) (-1115.775) [-1112.579] * [-1110.912] (-1111.408) (-1110.586) (-1112.518) -- 0:00:38 373500 -- (-1113.343) (-1111.554) (-1110.403) [-1110.373] * (-1110.637) (-1110.215) [-1113.715] (-1112.263) -- 0:00:38 374000 -- (-1112.584) (-1114.584) [-1110.455] (-1109.848) * (-1111.137) (-1108.978) [-1109.272] (-1110.722) -- 0:00:38 374500 -- (-1112.071) (-1110.636) [-1110.168] (-1110.909) * (-1111.079) (-1110.852) [-1111.921] (-1111.404) -- 0:00:38 375000 -- [-1112.825] (-1113.487) (-1111.062) (-1110.454) * (-1109.351) [-1108.451] (-1109.575) (-1108.994) -- 0:00:38 Average standard deviation of split frequencies: 0.015243 375500 -- [-1113.462] (-1112.808) (-1110.610) (-1115.271) * [-1110.202] (-1109.591) (-1111.089) (-1108.894) -- 0:00:38 376000 -- (-1117.661) (-1110.611) (-1111.634) [-1113.830] * (-1110.108) [-1110.045] (-1109.050) (-1113.856) -- 0:00:38 376500 -- (-1112.161) (-1110.535) (-1111.284) [-1113.003] * (-1109.500) [-1112.301] (-1110.724) (-1113.581) -- 0:00:38 377000 -- (-1112.751) (-1112.636) [-1110.009] (-1110.332) * (-1111.369) [-1111.447] (-1111.536) (-1113.386) -- 0:00:38 377500 -- (-1111.467) [-1110.960] (-1109.531) (-1109.718) * [-1109.827] (-1113.074) (-1111.326) (-1111.431) -- 0:00:37 378000 -- (-1111.176) (-1110.377) [-1109.894] (-1111.051) * (-1112.094) (-1111.303) [-1110.763] (-1110.147) -- 0:00:37 378500 -- (-1112.826) (-1109.773) [-1110.082] (-1109.759) * (-1110.544) [-1108.442] (-1112.521) (-1109.565) -- 0:00:37 379000 -- [-1109.868] (-1111.141) (-1111.986) (-1109.759) * (-1111.435) [-1108.726] (-1110.111) (-1109.191) -- 0:00:37 379500 -- [-1109.872] (-1112.541) (-1108.589) (-1110.333) * (-1111.578) (-1110.494) [-1112.839] (-1109.085) -- 0:00:37 380000 -- (-1111.371) (-1110.461) [-1110.831] (-1109.103) * (-1109.233) (-1113.665) (-1111.451) [-1109.038] -- 0:00:37 Average standard deviation of split frequencies: 0.014926 380500 -- (-1112.199) (-1114.037) (-1110.384) [-1108.440] * (-1109.632) [-1112.288] (-1113.973) (-1109.792) -- 0:00:37 381000 -- (-1111.336) (-1109.705) [-1110.208] (-1111.805) * (-1110.866) (-1112.689) (-1113.399) [-1109.109] -- 0:00:37 381500 -- (-1109.669) (-1115.469) [-1109.911] (-1111.746) * (-1111.810) (-1109.323) (-1112.947) [-1109.259] -- 0:00:37 382000 -- (-1111.352) [-1109.933] (-1112.683) (-1111.659) * (-1110.554) [-1110.351] (-1112.855) (-1108.969) -- 0:00:37 382500 -- (-1110.787) (-1113.239) (-1113.578) [-1109.191] * (-1110.121) (-1110.389) (-1111.341) [-1110.263] -- 0:00:37 383000 -- (-1109.888) (-1109.542) (-1112.389) [-1109.266] * (-1108.823) (-1111.588) [-1112.887] (-1109.188) -- 0:00:37 383500 -- (-1112.240) [-1111.047] (-1110.676) (-1110.716) * (-1109.707) [-1109.618] (-1111.811) (-1111.206) -- 0:00:36 384000 -- [-1109.995] (-1114.341) (-1108.652) (-1109.110) * (-1111.467) [-1111.948] (-1109.219) (-1113.913) -- 0:00:36 384500 -- (-1108.629) (-1110.289) [-1109.421] (-1109.737) * (-1109.135) (-1112.660) [-1109.750] (-1113.591) -- 0:00:36 385000 -- (-1110.390) [-1111.035] (-1109.663) (-1110.356) * (-1109.584) (-1109.559) [-1112.722] (-1109.939) -- 0:00:36 Average standard deviation of split frequencies: 0.014269 385500 -- (-1109.239) (-1109.811) [-1111.051] (-1111.839) * (-1109.249) [-1112.261] (-1112.116) (-1109.619) -- 0:00:36 386000 -- (-1113.162) (-1111.261) [-1110.850] (-1109.276) * (-1111.514) (-1111.041) (-1109.701) [-1111.366] -- 0:00:36 386500 -- (-1113.823) [-1111.036] (-1110.195) (-1109.482) * (-1109.821) [-1112.942] (-1109.913) (-1108.601) -- 0:00:36 387000 -- (-1111.102) (-1114.168) (-1108.947) [-1111.974] * [-1109.234] (-1112.469) (-1109.610) (-1108.748) -- 0:00:36 387500 -- [-1108.351] (-1113.282) (-1112.031) (-1111.471) * [-1111.147] (-1111.992) (-1114.526) (-1108.739) -- 0:00:37 388000 -- (-1110.062) (-1112.695) (-1108.609) [-1109.732] * (-1110.518) [-1109.195] (-1111.069) (-1108.767) -- 0:00:37 388500 -- (-1112.288) (-1113.246) [-1108.675] (-1119.566) * (-1112.334) (-1108.823) (-1110.774) [-1109.933] -- 0:00:37 389000 -- (-1113.175) (-1115.051) [-1112.425] (-1115.357) * (-1110.403) (-1111.256) [-1108.511] (-1111.125) -- 0:00:37 389500 -- (-1111.557) [-1108.989] (-1112.123) (-1109.307) * [-1108.735] (-1113.302) (-1110.217) (-1108.882) -- 0:00:37 390000 -- (-1109.451) [-1109.016] (-1108.759) (-1110.143) * (-1112.319) (-1110.707) (-1113.737) [-1109.097] -- 0:00:37 Average standard deviation of split frequencies: 0.015179 390500 -- (-1112.060) (-1109.020) [-1109.165] (-1112.125) * (-1112.658) (-1111.976) (-1111.569) [-1110.080] -- 0:00:37 391000 -- (-1113.380) (-1112.901) [-1109.470] (-1112.534) * (-1111.111) [-1115.734] (-1111.470) (-1110.878) -- 0:00:37 391500 -- (-1111.686) (-1110.282) (-1109.336) [-1112.727] * [-1111.834] (-1111.547) (-1111.219) (-1109.072) -- 0:00:37 392000 -- (-1118.505) [-1109.408] (-1110.968) (-1112.801) * [-1110.832] (-1110.665) (-1108.810) (-1109.094) -- 0:00:37 392500 -- [-1110.734] (-1111.752) (-1109.409) (-1109.708) * (-1112.297) [-1110.258] (-1111.021) (-1109.094) -- 0:00:37 393000 -- (-1109.286) (-1110.830) (-1117.539) [-1109.149] * (-1111.526) [-1110.462] (-1111.890) (-1110.241) -- 0:00:37 393500 -- (-1110.155) (-1111.591) [-1112.938] (-1112.179) * [-1112.143] (-1108.622) (-1112.884) (-1108.736) -- 0:00:36 394000 -- (-1109.207) (-1109.709) [-1112.380] (-1111.239) * (-1112.158) (-1108.721) [-1110.343] (-1108.831) -- 0:00:36 394500 -- (-1109.222) (-1110.829) (-1111.940) [-1109.344] * [-1111.887] (-1109.686) (-1111.633) (-1110.775) -- 0:00:36 395000 -- (-1110.738) (-1109.609) (-1111.407) [-1111.815] * (-1115.836) [-1108.532] (-1110.555) (-1109.276) -- 0:00:36 Average standard deviation of split frequencies: 0.015663 395500 -- (-1116.607) [-1109.610] (-1109.988) (-1110.786) * (-1116.031) [-1108.529] (-1109.006) (-1109.071) -- 0:00:36 396000 -- [-1111.934] (-1114.425) (-1110.865) (-1112.014) * [-1113.279] (-1110.769) (-1108.635) (-1111.874) -- 0:00:36 396500 -- (-1109.534) [-1109.816] (-1114.998) (-1114.940) * (-1113.441) [-1110.099] (-1110.132) (-1109.523) -- 0:00:36 397000 -- (-1110.118) (-1110.811) [-1113.282] (-1108.742) * (-1114.195) (-1109.143) (-1108.702) [-1117.764] -- 0:00:36 397500 -- (-1111.110) [-1110.711] (-1112.690) (-1108.784) * (-1112.456) (-1110.798) (-1109.140) [-1114.722] -- 0:00:36 398000 -- (-1108.819) (-1111.829) (-1110.950) [-1112.218] * (-1111.992) [-1110.060] (-1109.107) (-1111.862) -- 0:00:36 398500 -- (-1108.910) (-1112.798) [-1109.952] (-1114.059) * [-1110.563] (-1110.916) (-1109.207) (-1114.261) -- 0:00:36 399000 -- (-1109.417) (-1115.910) [-1111.025] (-1112.379) * (-1112.442) (-1115.463) (-1109.825) [-1110.532] -- 0:00:36 399500 -- [-1111.091] (-1111.940) (-1110.622) (-1109.439) * (-1112.568) (-1112.933) [-1110.008] (-1110.301) -- 0:00:36 400000 -- (-1113.288) (-1112.342) [-1109.173] (-1109.638) * (-1110.569) (-1109.886) [-1111.306] (-1110.307) -- 0:00:36 Average standard deviation of split frequencies: 0.015605 400500 -- (-1109.873) [-1112.213] (-1109.236) (-1109.103) * (-1109.010) (-1109.371) [-1108.611] (-1111.274) -- 0:00:35 401000 -- [-1110.062] (-1110.267) (-1110.561) (-1113.004) * (-1115.624) (-1109.049) [-1109.464] (-1109.430) -- 0:00:35 401500 -- (-1115.700) (-1110.174) [-1109.259] (-1115.588) * (-1112.149) [-1110.102] (-1109.655) (-1110.480) -- 0:00:35 402000 -- (-1114.675) (-1111.059) [-1109.339] (-1112.844) * (-1111.852) (-1108.767) [-1112.088] (-1109.951) -- 0:00:35 402500 -- (-1115.714) [-1110.116] (-1110.301) (-1113.863) * (-1108.489) (-1110.547) (-1110.965) [-1109.619] -- 0:00:35 403000 -- (-1109.592) [-1114.010] (-1109.776) (-1114.914) * (-1109.098) (-1109.864) (-1108.996) [-1108.513] -- 0:00:35 403500 -- (-1109.839) (-1110.099) [-1110.204] (-1109.265) * (-1110.224) (-1111.824) [-1109.730] (-1109.694) -- 0:00:35 404000 -- [-1108.737] (-1109.923) (-1109.103) (-1111.019) * (-1108.960) (-1113.086) (-1110.888) [-1108.597] -- 0:00:36 404500 -- [-1109.634] (-1110.330) (-1113.091) (-1112.603) * [-1112.193] (-1108.845) (-1113.004) (-1112.505) -- 0:00:36 405000 -- [-1110.641] (-1113.308) (-1112.906) (-1116.190) * [-1109.877] (-1112.927) (-1109.818) (-1110.397) -- 0:00:36 Average standard deviation of split frequencies: 0.016561 405500 -- [-1109.243] (-1114.744) (-1114.402) (-1112.646) * [-1110.056] (-1111.138) (-1109.269) (-1109.713) -- 0:00:36 406000 -- (-1112.237) [-1109.533] (-1110.157) (-1116.166) * (-1112.722) [-1109.602] (-1111.140) (-1112.225) -- 0:00:36 406500 -- (-1110.941) (-1109.293) [-1114.481] (-1114.575) * (-1110.013) [-1110.578] (-1112.172) (-1111.729) -- 0:00:36 407000 -- (-1110.252) (-1112.131) [-1109.415] (-1113.794) * (-1109.774) (-1109.928) [-1110.634] (-1112.088) -- 0:00:36 407500 -- (-1113.509) [-1112.682] (-1112.202) (-1111.849) * (-1109.137) (-1110.812) (-1109.152) [-1110.931] -- 0:00:36 408000 -- (-1109.814) (-1110.097) [-1110.547] (-1110.965) * (-1113.204) (-1109.113) (-1111.586) [-1111.314] -- 0:00:36 408500 -- (-1109.710) (-1112.370) [-1108.800] (-1110.091) * (-1112.022) (-1109.298) [-1110.075] (-1112.674) -- 0:00:36 409000 -- (-1114.119) (-1112.389) (-1108.757) [-1109.035] * [-1109.097] (-1112.689) (-1109.557) (-1110.653) -- 0:00:36 409500 -- (-1113.688) (-1109.207) (-1110.441) [-1109.632] * (-1111.045) (-1111.197) [-1108.503] (-1112.251) -- 0:00:36 410000 -- (-1110.699) (-1113.707) (-1110.369) [-1114.902] * (-1112.274) (-1114.130) [-1109.227] (-1111.249) -- 0:00:35 Average standard deviation of split frequencies: 0.015527 410500 -- (-1108.808) [-1109.766] (-1110.320) (-1117.706) * (-1111.140) [-1112.865] (-1110.974) (-1109.792) -- 0:00:35 411000 -- (-1108.953) (-1108.932) (-1112.282) [-1111.355] * (-1118.024) (-1113.555) (-1111.145) [-1110.370] -- 0:00:35 411500 -- (-1111.594) [-1111.596] (-1111.931) (-1110.378) * [-1110.864] (-1117.674) (-1118.474) (-1110.649) -- 0:00:35 412000 -- (-1111.421) [-1111.242] (-1109.889) (-1120.378) * (-1109.951) (-1111.704) (-1110.908) [-1109.111] -- 0:00:35 412500 -- (-1111.785) [-1111.666] (-1111.771) (-1115.419) * (-1112.334) [-1111.055] (-1111.716) (-1111.219) -- 0:00:35 413000 -- [-1110.802] (-1112.429) (-1112.044) (-1115.820) * [-1109.718] (-1111.201) (-1112.765) (-1110.897) -- 0:00:35 413500 -- (-1113.546) [-1109.554] (-1112.723) (-1108.752) * (-1111.014) [-1112.268] (-1108.726) (-1114.549) -- 0:00:35 414000 -- (-1111.862) (-1108.662) [-1111.615] (-1110.700) * (-1114.526) (-1109.814) [-1111.271] (-1109.813) -- 0:00:35 414500 -- [-1112.361] (-1118.359) (-1110.241) (-1111.540) * (-1115.436) [-1111.311] (-1112.512) (-1111.807) -- 0:00:35 415000 -- [-1108.934] (-1109.868) (-1110.020) (-1112.736) * (-1113.147) (-1110.582) [-1111.657] (-1110.968) -- 0:00:35 Average standard deviation of split frequencies: 0.015566 415500 -- (-1110.023) (-1110.109) (-1113.689) [-1114.460] * (-1110.398) (-1110.069) [-1110.692] (-1111.122) -- 0:00:35 416000 -- [-1109.982] (-1109.462) (-1110.809) (-1109.794) * (-1116.803) (-1111.533) (-1110.848) [-1109.756] -- 0:00:35 416500 -- (-1116.044) [-1110.849] (-1111.047) (-1111.319) * (-1111.771) (-1109.347) [-1112.149] (-1112.102) -- 0:00:35 417000 -- (-1111.160) [-1113.653] (-1110.366) (-1112.952) * (-1109.990) (-1109.942) [-1109.865] (-1113.032) -- 0:00:34 417500 -- (-1110.929) [-1113.276] (-1111.847) (-1108.698) * (-1111.419) (-1112.835) [-1111.657] (-1111.422) -- 0:00:34 418000 -- (-1110.064) (-1111.019) (-1110.716) [-1110.734] * (-1112.575) (-1111.970) [-1109.363] (-1112.802) -- 0:00:34 418500 -- (-1114.482) (-1110.290) [-1111.630] (-1111.311) * (-1109.908) (-1114.647) [-1108.613] (-1110.478) -- 0:00:34 419000 -- [-1113.478] (-1111.807) (-1113.418) (-1111.311) * (-1109.562) (-1117.055) (-1109.882) [-1112.306] -- 0:00:34 419500 -- (-1111.078) (-1115.445) (-1111.786) [-1109.793] * [-1112.575] (-1110.427) (-1111.361) (-1113.004) -- 0:00:34 420000 -- [-1111.323] (-1112.521) (-1116.319) (-1109.779) * (-1112.120) (-1111.629) [-1109.842] (-1110.170) -- 0:00:34 Average standard deviation of split frequencies: 0.016042 420500 -- (-1110.312) [-1109.269] (-1113.555) (-1108.566) * (-1113.105) (-1113.235) (-1110.479) [-1109.636] -- 0:00:35 421000 -- (-1110.063) (-1109.015) (-1111.369) [-1109.135] * (-1109.855) (-1112.595) [-1111.065] (-1117.161) -- 0:00:35 421500 -- (-1111.022) (-1109.555) (-1109.620) [-1109.920] * (-1112.009) [-1108.759] (-1111.068) (-1114.519) -- 0:00:35 422000 -- [-1109.287] (-1110.503) (-1109.865) (-1108.852) * (-1110.203) [-1108.988] (-1110.622) (-1113.884) -- 0:00:35 422500 -- (-1111.527) (-1111.320) (-1108.847) [-1111.031] * [-1110.493] (-1117.107) (-1110.289) (-1109.591) -- 0:00:35 423000 -- (-1113.867) (-1114.499) (-1111.514) [-1108.718] * (-1114.822) [-1109.978] (-1110.056) (-1109.964) -- 0:00:35 423500 -- (-1111.973) (-1108.623) [-1111.125] (-1108.654) * (-1114.266) (-1111.009) [-1110.125] (-1109.952) -- 0:00:35 424000 -- [-1111.575] (-1108.741) (-1110.077) (-1109.343) * (-1109.388) (-1109.888) (-1109.073) [-1110.854] -- 0:00:35 424500 -- (-1111.604) [-1113.283] (-1111.308) (-1110.152) * [-1110.106] (-1111.115) (-1110.084) (-1110.500) -- 0:00:35 425000 -- [-1110.569] (-1111.620) (-1116.123) (-1112.170) * (-1110.235) (-1112.145) (-1108.921) [-1110.071] -- 0:00:35 Average standard deviation of split frequencies: 0.015990 425500 -- [-1109.304] (-1108.540) (-1117.478) (-1115.312) * (-1109.280) (-1112.011) [-1110.198] (-1115.408) -- 0:00:35 426000 -- (-1113.114) [-1112.429] (-1110.529) (-1111.871) * [-1110.083] (-1109.909) (-1110.206) (-1113.068) -- 0:00:35 426500 -- (-1112.762) (-1114.359) (-1109.920) [-1113.232] * [-1110.635] (-1115.169) (-1112.359) (-1114.497) -- 0:00:34 427000 -- [-1111.161] (-1113.942) (-1109.715) (-1110.785) * (-1109.917) (-1110.588) (-1112.537) [-1109.461] -- 0:00:34 427500 -- (-1115.260) [-1111.981] (-1108.686) (-1108.368) * (-1109.440) [-1113.286] (-1111.459) (-1109.064) -- 0:00:34 428000 -- (-1112.105) (-1109.766) (-1113.844) [-1108.360] * (-1112.474) (-1111.545) (-1112.715) [-1111.145] -- 0:00:34 428500 -- (-1110.019) [-1112.537] (-1110.616) (-1108.360) * (-1113.557) (-1114.075) (-1112.780) [-1110.566] -- 0:00:34 429000 -- (-1110.536) [-1113.493] (-1109.424) (-1111.526) * (-1109.920) (-1116.664) (-1112.491) [-1111.330] -- 0:00:34 429500 -- (-1109.131) (-1111.663) [-1110.716] (-1110.648) * (-1114.568) (-1110.031) (-1111.373) [-1112.158] -- 0:00:34 430000 -- (-1110.204) (-1110.684) [-1112.016] (-1114.493) * (-1112.246) (-1110.255) [-1112.826] (-1113.789) -- 0:00:34 Average standard deviation of split frequencies: 0.014886 430500 -- [-1112.503] (-1114.872) (-1123.432) (-1112.254) * (-1110.129) (-1110.879) [-1116.745] (-1110.104) -- 0:00:34 431000 -- (-1109.975) (-1110.334) [-1114.812] (-1109.378) * (-1111.511) [-1111.496] (-1110.498) (-1109.882) -- 0:00:34 431500 -- (-1111.462) (-1109.979) (-1109.962) [-1112.919] * (-1109.807) (-1113.843) [-1111.364] (-1110.010) -- 0:00:34 432000 -- [-1110.977] (-1109.190) (-1111.051) (-1111.003) * [-1114.131] (-1110.010) (-1115.571) (-1109.049) -- 0:00:34 432500 -- [-1109.959] (-1110.703) (-1108.550) (-1112.482) * (-1109.258) (-1110.115) (-1116.019) [-1108.451] -- 0:00:34 433000 -- [-1112.697] (-1112.994) (-1108.839) (-1110.978) * [-1110.723] (-1109.910) (-1114.361) (-1113.307) -- 0:00:34 433500 -- (-1111.606) (-1118.257) [-1109.463] (-1110.428) * [-1109.203] (-1109.497) (-1111.429) (-1109.027) -- 0:00:33 434000 -- (-1109.898) (-1109.756) [-1109.993] (-1110.509) * (-1110.493) (-1108.744) (-1113.448) [-1109.907] -- 0:00:33 434500 -- (-1110.281) [-1109.470] (-1118.403) (-1112.356) * (-1110.542) (-1114.316) (-1113.977) [-1110.658] -- 0:00:33 435000 -- (-1113.030) [-1109.955] (-1117.337) (-1115.601) * (-1110.333) (-1109.518) (-1109.646) [-1109.608] -- 0:00:33 Average standard deviation of split frequencies: 0.013996 435500 -- [-1111.127] (-1111.131) (-1114.648) (-1110.175) * (-1110.147) (-1112.522) (-1110.224) [-1110.150] -- 0:00:33 436000 -- (-1109.969) (-1109.562) [-1111.037] (-1109.169) * (-1109.627) [-1114.187] (-1112.648) (-1109.120) -- 0:00:33 436500 -- (-1111.550) (-1112.862) [-1112.880] (-1108.635) * (-1109.867) (-1110.801) (-1110.405) [-1108.681] -- 0:00:34 437000 -- [-1111.439] (-1110.673) (-1111.357) (-1109.318) * (-1112.766) (-1110.660) (-1110.549) [-1109.487] -- 0:00:34 437500 -- [-1110.645] (-1108.716) (-1109.890) (-1109.316) * (-1109.923) (-1110.219) (-1109.178) [-1109.480] -- 0:00:34 438000 -- [-1112.220] (-1108.842) (-1110.347) (-1111.976) * (-1112.127) (-1110.358) (-1108.828) [-1109.168] -- 0:00:34 438500 -- (-1111.904) [-1109.947] (-1113.310) (-1110.352) * (-1109.164) (-1110.358) (-1110.036) [-1110.848] -- 0:00:34 439000 -- [-1109.278] (-1110.611) (-1113.260) (-1110.888) * (-1114.621) (-1109.388) [-1110.858] (-1112.401) -- 0:00:34 439500 -- (-1114.003) (-1111.338) (-1110.672) [-1109.180] * (-1110.007) (-1110.074) [-1109.429] (-1116.029) -- 0:00:34 440000 -- (-1109.594) (-1109.432) (-1109.039) [-1110.103] * (-1110.061) (-1110.213) (-1109.865) [-1109.332] -- 0:00:34 Average standard deviation of split frequencies: 0.013669 440500 -- (-1113.281) (-1112.849) (-1110.068) [-1110.196] * [-1111.911] (-1108.645) (-1111.672) (-1110.204) -- 0:00:34 441000 -- (-1110.386) [-1109.932] (-1114.266) (-1108.916) * (-1109.585) (-1110.823) [-1111.154] (-1110.037) -- 0:00:34 441500 -- (-1112.540) [-1109.516] (-1109.350) (-1112.532) * (-1108.891) (-1110.045) (-1109.748) [-1110.100] -- 0:00:34 442000 -- (-1112.620) [-1115.764] (-1113.656) (-1111.286) * (-1110.034) [-1109.144] (-1109.235) (-1111.502) -- 0:00:34 442500 -- (-1113.766) (-1110.774) (-1111.219) [-1109.245] * (-1112.158) (-1110.152) (-1111.371) [-1110.027] -- 0:00:34 443000 -- (-1108.796) (-1110.877) [-1111.684] (-1109.264) * [-1110.153] (-1109.681) (-1110.152) (-1110.357) -- 0:00:33 443500 -- [-1110.171] (-1110.829) (-1111.373) (-1110.697) * (-1109.075) (-1109.523) (-1108.677) [-1109.936] -- 0:00:33 444000 -- (-1109.419) (-1109.960) [-1113.549] (-1112.671) * [-1111.155] (-1110.838) (-1108.710) (-1114.354) -- 0:00:33 444500 -- [-1109.716] (-1112.294) (-1114.328) (-1111.590) * (-1108.850) (-1112.474) [-1115.596] (-1111.100) -- 0:00:33 445000 -- [-1110.204] (-1110.821) (-1110.566) (-1111.479) * (-1109.616) (-1110.453) (-1110.360) [-1109.487] -- 0:00:33 Average standard deviation of split frequencies: 0.013963 445500 -- (-1109.188) [-1109.875] (-1110.977) (-1111.408) * [-1114.015] (-1109.563) (-1110.661) (-1108.812) -- 0:00:33 446000 -- (-1109.750) (-1109.103) (-1113.469) [-1114.581] * (-1109.663) (-1112.911) [-1110.347] (-1109.172) -- 0:00:33 446500 -- (-1112.386) (-1109.449) [-1110.894] (-1110.945) * (-1110.781) (-1108.998) (-1112.211) [-1108.942] -- 0:00:33 447000 -- [-1110.836] (-1109.700) (-1109.178) (-1110.933) * [-1111.220] (-1109.756) (-1113.499) (-1108.675) -- 0:00:33 447500 -- [-1111.588] (-1109.713) (-1109.044) (-1110.371) * (-1113.582) [-1111.485] (-1111.250) (-1112.326) -- 0:00:33 448000 -- (-1109.558) (-1109.444) [-1110.696] (-1114.583) * (-1110.020) [-1111.169] (-1111.430) (-1112.291) -- 0:00:33 448500 -- (-1108.808) (-1113.300) (-1111.688) [-1110.486] * (-1112.251) (-1110.731) (-1111.870) [-1110.009] -- 0:00:33 449000 -- (-1110.368) (-1110.796) [-1111.823] (-1108.992) * (-1110.125) (-1111.531) (-1109.550) [-1108.993] -- 0:00:33 449500 -- (-1115.014) [-1111.029] (-1110.526) (-1108.815) * (-1108.641) (-1111.359) (-1108.923) [-1112.087] -- 0:00:33 450000 -- (-1111.196) (-1111.249) (-1112.435) [-1109.686] * (-1109.559) (-1109.112) (-1110.826) [-1111.224] -- 0:00:33 Average standard deviation of split frequencies: 0.013929 450500 -- [-1111.764] (-1109.399) (-1111.766) (-1113.138) * (-1110.876) (-1109.027) [-1111.596] (-1109.418) -- 0:00:32 451000 -- (-1111.052) (-1110.195) (-1109.520) [-1111.843] * (-1111.928) [-1109.209] (-1112.860) (-1111.879) -- 0:00:32 451500 -- (-1111.599) (-1110.131) [-1110.591] (-1113.053) * (-1112.908) (-1110.062) [-1111.405] (-1110.007) -- 0:00:32 452000 -- (-1111.544) (-1108.899) [-1110.277] (-1114.612) * (-1114.210) (-1110.307) (-1112.354) [-1110.122] -- 0:00:32 452500 -- (-1111.215) (-1112.045) (-1110.709) [-1110.497] * (-1111.163) (-1113.485) [-1111.031] (-1111.817) -- 0:00:32 453000 -- [-1110.233] (-1110.310) (-1116.549) (-1109.672) * (-1110.640) (-1109.657) (-1112.303) [-1110.241] -- 0:00:33 453500 -- (-1110.048) (-1110.692) (-1110.215) [-1109.445] * (-1109.048) (-1111.139) [-1111.310] (-1109.936) -- 0:00:33 454000 -- [-1109.715] (-1110.347) (-1109.850) (-1109.554) * (-1109.525) [-1109.065] (-1111.918) (-1111.287) -- 0:00:33 454500 -- (-1110.000) [-1110.500] (-1111.122) (-1108.759) * (-1109.069) (-1112.638) [-1113.079] (-1109.049) -- 0:00:33 455000 -- [-1108.601] (-1110.683) (-1110.047) (-1109.296) * (-1109.221) [-1119.622] (-1113.827) (-1111.240) -- 0:00:33 Average standard deviation of split frequencies: 0.013439 455500 -- (-1108.632) [-1110.907] (-1110.254) (-1109.202) * (-1116.549) [-1114.084] (-1111.694) (-1110.448) -- 0:00:33 456000 -- (-1109.530) (-1109.885) [-1113.447] (-1114.827) * (-1110.589) (-1111.221) [-1111.811] (-1110.034) -- 0:00:33 456500 -- [-1109.103] (-1109.516) (-1113.274) (-1109.729) * (-1110.541) (-1112.269) [-1111.371] (-1110.517) -- 0:00:33 457000 -- (-1108.869) (-1109.500) [-1111.342] (-1110.392) * (-1113.804) [-1111.460] (-1118.466) (-1109.922) -- 0:00:33 457500 -- [-1110.356] (-1111.263) (-1114.235) (-1113.476) * [-1109.386] (-1109.357) (-1112.174) (-1110.508) -- 0:00:33 458000 -- (-1109.808) (-1110.043) (-1110.484) [-1112.263] * [-1109.900] (-1109.235) (-1110.528) (-1111.144) -- 0:00:33 458500 -- [-1111.178] (-1112.946) (-1113.184) (-1110.616) * (-1109.577) [-1111.233] (-1109.488) (-1110.063) -- 0:00:33 459000 -- (-1113.221) (-1109.778) (-1110.832) [-1110.481] * (-1112.128) (-1109.386) (-1111.558) [-1112.584] -- 0:00:33 459500 -- (-1113.098) (-1117.623) [-1110.125] (-1112.416) * (-1111.019) (-1112.085) [-1109.821] (-1108.656) -- 0:00:32 460000 -- (-1110.591) (-1112.107) [-1111.857] (-1111.278) * (-1114.452) (-1113.262) (-1109.754) [-1111.710] -- 0:00:32 Average standard deviation of split frequencies: 0.014326 460500 -- [-1111.930] (-1110.647) (-1109.026) (-1115.713) * (-1110.071) [-1109.724] (-1112.049) (-1108.673) -- 0:00:32 461000 -- (-1110.499) (-1109.934) (-1108.945) [-1111.143] * (-1109.159) (-1110.159) [-1110.877] (-1112.967) -- 0:00:32 461500 -- (-1110.077) [-1109.499] (-1109.702) (-1108.731) * (-1112.419) [-1113.252] (-1112.597) (-1112.838) -- 0:00:32 462000 -- [-1111.828] (-1109.173) (-1113.341) (-1113.973) * (-1111.735) [-1112.720] (-1113.808) (-1110.193) -- 0:00:32 462500 -- (-1114.074) (-1109.568) [-1112.457] (-1110.566) * (-1112.832) (-1111.380) [-1109.814] (-1109.996) -- 0:00:32 463000 -- (-1115.127) (-1113.504) (-1111.632) [-1110.222] * (-1109.238) (-1110.464) [-1111.744] (-1110.751) -- 0:00:32 463500 -- (-1113.122) (-1112.803) [-1109.314] (-1110.235) * (-1109.833) (-1109.894) [-1111.140] (-1110.121) -- 0:00:32 464000 -- [-1114.345] (-1111.758) (-1108.862) (-1110.670) * (-1109.929) (-1116.507) [-1111.807] (-1110.406) -- 0:00:32 464500 -- (-1111.624) (-1110.065) (-1110.920) [-1111.052] * (-1109.453) (-1109.452) (-1112.146) [-1114.392] -- 0:00:32 465000 -- [-1109.375] (-1113.514) (-1109.439) (-1110.098) * (-1109.653) (-1112.319) [-1111.317] (-1109.684) -- 0:00:32 Average standard deviation of split frequencies: 0.014216 465500 -- (-1109.360) (-1111.488) [-1109.636] (-1110.075) * (-1109.736) [-1110.123] (-1110.759) (-1110.431) -- 0:00:32 466000 -- (-1111.671) [-1109.775] (-1109.702) (-1110.685) * (-1109.649) (-1110.604) [-1111.109] (-1111.242) -- 0:00:32 466500 -- (-1109.569) [-1111.186] (-1110.854) (-1109.993) * [-1108.513] (-1109.798) (-1109.012) (-1112.080) -- 0:00:32 467000 -- [-1109.933] (-1113.928) (-1108.677) (-1109.097) * [-1108.662] (-1109.494) (-1109.099) (-1110.404) -- 0:00:31 467500 -- (-1109.281) (-1110.014) (-1110.330) [-1111.256] * (-1110.377) [-1108.754] (-1108.847) (-1109.509) -- 0:00:31 468000 -- (-1109.102) [-1109.343] (-1111.887) (-1113.130) * (-1111.725) (-1111.491) [-1110.564] (-1110.518) -- 0:00:31 468500 -- [-1109.621] (-1108.870) (-1111.373) (-1109.936) * (-1111.196) [-1111.812] (-1113.271) (-1111.646) -- 0:00:31 469000 -- [-1109.090] (-1108.933) (-1111.256) (-1110.124) * (-1112.199) (-1113.615) [-1112.744] (-1109.962) -- 0:00:32 469500 -- [-1110.380] (-1108.926) (-1110.324) (-1110.895) * [-1111.117] (-1112.084) (-1108.724) (-1108.767) -- 0:00:32 470000 -- (-1109.138) [-1110.600] (-1109.276) (-1111.144) * (-1109.657) [-1110.398] (-1114.043) (-1111.680) -- 0:00:32 Average standard deviation of split frequencies: 0.013600 470500 -- (-1110.627) [-1110.873] (-1110.464) (-1114.259) * [-1114.078] (-1112.442) (-1111.895) (-1109.743) -- 0:00:32 471000 -- (-1112.747) [-1109.940] (-1108.715) (-1113.385) * (-1112.759) (-1111.099) (-1110.265) [-1109.240] -- 0:00:32 471500 -- (-1111.371) (-1110.680) (-1109.497) [-1108.858] * [-1111.685] (-1111.609) (-1110.798) (-1109.357) -- 0:00:32 472000 -- [-1111.322] (-1115.594) (-1109.613) (-1109.610) * (-1111.231) (-1112.013) [-1109.946] (-1110.972) -- 0:00:32 472500 -- [-1111.942] (-1113.292) (-1110.235) (-1110.088) * (-1110.989) (-1109.234) [-1109.849] (-1108.765) -- 0:00:32 473000 -- (-1108.383) (-1109.942) (-1110.365) [-1109.468] * (-1111.050) (-1112.093) (-1110.153) [-1110.490] -- 0:00:32 473500 -- (-1112.429) [-1110.748] (-1111.355) (-1110.000) * (-1110.624) [-1109.974] (-1112.104) (-1112.291) -- 0:00:32 474000 -- (-1109.852) (-1119.549) [-1109.861] (-1113.381) * [-1110.621] (-1113.518) (-1109.968) (-1111.324) -- 0:00:32 474500 -- (-1113.501) [-1113.952] (-1110.626) (-1111.177) * (-1112.282) (-1113.737) [-1108.911] (-1109.559) -- 0:00:32 475000 -- (-1109.460) (-1114.901) (-1114.505) [-1109.327] * [-1112.261] (-1114.595) (-1120.074) (-1109.373) -- 0:00:32 Average standard deviation of split frequencies: 0.013344 475500 -- (-1110.493) [-1114.355] (-1115.866) (-1110.751) * (-1109.893) (-1115.859) [-1108.802] (-1113.054) -- 0:00:31 476000 -- (-1109.181) [-1110.041] (-1109.905) (-1113.616) * (-1110.502) (-1108.686) [-1109.941] (-1110.190) -- 0:00:31 476500 -- (-1108.575) [-1114.935] (-1110.465) (-1109.806) * (-1110.128) (-1109.692) [-1112.094] (-1114.301) -- 0:00:31 477000 -- [-1110.075] (-1114.976) (-1110.537) (-1108.836) * (-1110.270) (-1110.886) [-1110.361] (-1110.473) -- 0:00:31 477500 -- (-1112.757) (-1110.464) [-1113.064] (-1110.007) * (-1110.302) [-1109.628] (-1110.047) (-1110.276) -- 0:00:31 478000 -- [-1109.777] (-1110.515) (-1110.945) (-1110.092) * (-1109.452) (-1109.936) (-1110.115) [-1111.998] -- 0:00:31 478500 -- (-1109.817) [-1111.811] (-1110.972) (-1108.777) * [-1110.844] (-1113.538) (-1114.619) (-1112.105) -- 0:00:31 479000 -- (-1112.819) [-1110.795] (-1108.877) (-1111.601) * (-1109.300) [-1112.963] (-1112.493) (-1113.733) -- 0:00:31 479500 -- (-1115.006) (-1113.661) (-1109.330) [-1113.542] * (-1111.103) [-1109.619] (-1111.729) (-1109.429) -- 0:00:31 480000 -- (-1114.369) (-1113.764) (-1110.483) [-1109.696] * (-1111.184) [-1109.275] (-1109.896) (-1111.937) -- 0:00:31 Average standard deviation of split frequencies: 0.013679 480500 -- (-1113.104) [-1118.603] (-1114.379) (-1110.945) * [-1108.946] (-1117.394) (-1110.402) (-1111.237) -- 0:00:31 481000 -- (-1110.291) (-1110.169) (-1110.287) [-1112.799] * (-1110.140) (-1110.931) (-1110.235) [-1110.904] -- 0:00:31 481500 -- (-1113.789) [-1109.844] (-1109.211) (-1111.594) * (-1111.068) [-1110.421] (-1109.779) (-1109.607) -- 0:00:31 482000 -- (-1111.202) (-1110.684) (-1109.704) [-1110.144] * (-1109.420) (-1112.705) [-1112.356] (-1112.575) -- 0:00:31 482500 -- (-1112.539) [-1109.522] (-1110.866) (-1113.835) * (-1111.433) [-1114.904] (-1111.579) (-1113.282) -- 0:00:31 483000 -- (-1110.070) [-1109.076] (-1110.205) (-1114.326) * (-1113.302) [-1113.563] (-1110.746) (-1113.729) -- 0:00:31 483500 -- (-1112.197) [-1110.023] (-1111.884) (-1110.266) * [-1109.541] (-1113.162) (-1110.330) (-1110.211) -- 0:00:30 484000 -- (-1114.622) (-1110.679) [-1110.608] (-1109.704) * [-1109.699] (-1111.149) (-1110.468) (-1109.602) -- 0:00:30 484500 -- [-1110.586] (-1111.856) (-1112.710) (-1113.211) * (-1110.993) (-1111.104) [-1111.286] (-1109.574) -- 0:00:30 485000 -- (-1108.919) [-1112.948] (-1115.214) (-1119.847) * (-1110.959) (-1109.279) [-1109.139] (-1109.780) -- 0:00:30 Average standard deviation of split frequencies: 0.014090 485500 -- (-1108.791) [-1111.415] (-1113.116) (-1111.328) * [-1112.762] (-1110.951) (-1111.936) (-1109.520) -- 0:00:31 486000 -- [-1109.581] (-1111.985) (-1110.980) (-1115.087) * (-1111.403) (-1112.569) (-1112.650) [-1110.707] -- 0:00:31 486500 -- [-1108.740] (-1113.591) (-1109.442) (-1112.663) * (-1110.369) (-1111.709) [-1109.251] (-1108.500) -- 0:00:31 487000 -- [-1108.830] (-1109.617) (-1110.783) (-1110.579) * (-1109.173) (-1110.026) (-1113.131) [-1109.591] -- 0:00:31 487500 -- (-1110.045) (-1108.951) [-1113.743] (-1114.172) * [-1113.250] (-1110.480) (-1111.042) (-1109.620) -- 0:00:31 488000 -- (-1110.675) [-1109.295] (-1110.495) (-1109.738) * (-1109.739) (-1110.312) (-1110.205) [-1114.150] -- 0:00:31 488500 -- [-1110.100] (-1111.278) (-1110.822) (-1110.652) * (-1108.514) (-1110.453) (-1115.066) [-1109.598] -- 0:00:31 489000 -- (-1111.820) (-1114.756) [-1111.490] (-1109.287) * [-1109.599] (-1111.368) (-1113.356) (-1112.953) -- 0:00:31 489500 -- [-1110.912] (-1111.869) (-1110.435) (-1111.508) * (-1109.663) (-1109.772) (-1112.525) [-1111.251] -- 0:00:31 490000 -- (-1110.470) (-1112.037) (-1110.623) [-1111.336] * [-1112.365] (-1109.772) (-1115.120) (-1111.779) -- 0:00:31 Average standard deviation of split frequencies: 0.014108 490500 -- (-1112.978) [-1109.519] (-1110.177) (-1114.154) * (-1110.844) (-1110.311) [-1111.961] (-1112.944) -- 0:00:31 491000 -- (-1112.923) (-1112.148) (-1111.422) [-1109.335] * [-1109.585] (-1110.079) (-1112.162) (-1113.768) -- 0:00:31 491500 -- [-1110.133] (-1110.700) (-1115.057) (-1108.786) * (-1113.694) [-1110.541] (-1110.260) (-1110.196) -- 0:00:31 492000 -- (-1114.362) [-1111.575] (-1110.467) (-1109.158) * (-1109.954) (-1110.862) [-1109.399] (-1116.113) -- 0:00:30 492500 -- (-1112.406) (-1112.454) (-1111.007) [-1109.265] * (-1112.782) (-1110.864) (-1111.058) [-1110.810] -- 0:00:30 493000 -- (-1111.336) (-1111.613) [-1109.638] (-1108.967) * (-1113.173) (-1116.886) (-1112.332) [-1110.360] -- 0:00:30 493500 -- (-1114.273) (-1110.694) (-1110.882) [-1109.692] * (-1116.995) (-1109.708) [-1111.308] (-1108.940) -- 0:00:30 494000 -- (-1111.493) (-1111.134) [-1111.230] (-1111.656) * (-1108.723) (-1114.070) [-1109.886] (-1109.686) -- 0:00:30 494500 -- (-1109.710) (-1111.143) [-1110.834] (-1108.920) * [-1110.222] (-1109.128) (-1109.834) (-1113.829) -- 0:00:30 495000 -- [-1111.745] (-1109.359) (-1110.283) (-1111.261) * (-1109.950) (-1112.109) (-1110.823) [-1111.141] -- 0:00:30 Average standard deviation of split frequencies: 0.012831 495500 -- (-1111.116) (-1110.981) (-1109.692) [-1108.413] * [-1108.924] (-1108.880) (-1110.844) (-1110.330) -- 0:00:30 496000 -- (-1109.000) [-1111.467] (-1109.043) (-1108.441) * (-1109.923) (-1111.697) [-1111.830] (-1110.318) -- 0:00:30 496500 -- (-1109.827) [-1111.086] (-1109.132) (-1118.490) * (-1110.722) (-1115.514) [-1110.513] (-1109.428) -- 0:00:30 497000 -- (-1110.844) (-1110.111) [-1109.579] (-1117.992) * (-1110.034) (-1111.042) [-1111.617] (-1109.369) -- 0:00:30 497500 -- (-1114.385) [-1110.956] (-1111.450) (-1111.028) * (-1108.560) (-1110.905) (-1112.676) [-1110.807] -- 0:00:30 498000 -- [-1110.841] (-1110.333) (-1109.080) (-1109.257) * [-1110.053] (-1112.276) (-1109.278) (-1109.680) -- 0:00:30 498500 -- (-1109.696) [-1109.391] (-1111.997) (-1110.590) * [-1108.321] (-1110.002) (-1108.791) (-1112.770) -- 0:00:30 499000 -- (-1110.247) (-1111.852) [-1108.388] (-1112.591) * (-1111.970) (-1110.561) [-1108.856] (-1110.404) -- 0:00:30 499500 -- (-1113.348) [-1109.488] (-1108.458) (-1110.808) * [-1109.589] (-1110.115) (-1111.398) (-1111.815) -- 0:00:30 500000 -- (-1110.486) (-1109.767) [-1108.955] (-1110.348) * (-1110.185) [-1110.323] (-1109.705) (-1111.474) -- 0:00:30 Average standard deviation of split frequencies: 0.012406 500500 -- [-1109.628] (-1112.201) (-1116.213) (-1114.985) * (-1108.835) [-1111.010] (-1110.163) (-1116.313) -- 0:00:29 501000 -- (-1110.133) [-1111.124] (-1110.754) (-1113.569) * (-1111.080) (-1112.167) [-1111.019] (-1114.832) -- 0:00:29 501500 -- (-1108.555) [-1112.091] (-1111.503) (-1109.995) * (-1113.923) [-1109.707] (-1109.370) (-1118.159) -- 0:00:30 502000 -- (-1109.951) (-1109.916) (-1111.009) [-1109.070] * [-1115.217] (-1111.221) (-1111.078) (-1114.542) -- 0:00:30 502500 -- [-1108.650] (-1110.326) (-1109.456) (-1109.285) * (-1113.007) (-1111.108) [-1111.940] (-1110.913) -- 0:00:30 503000 -- (-1113.713) (-1112.680) (-1109.321) [-1109.501] * [-1112.460] (-1110.222) (-1115.889) (-1109.859) -- 0:00:30 503500 -- (-1110.114) [-1110.103] (-1111.849) (-1110.066) * (-1114.186) [-1112.147] (-1111.587) (-1111.280) -- 0:00:30 504000 -- [-1110.276] (-1109.733) (-1111.640) (-1110.065) * (-1112.972) (-1112.290) [-1111.373] (-1109.396) -- 0:00:30 504500 -- (-1112.599) (-1109.502) [-1109.497] (-1109.254) * (-1110.845) (-1112.256) (-1109.165) [-1109.605] -- 0:00:30 505000 -- [-1112.006] (-1111.132) (-1111.194) (-1109.830) * [-1111.173] (-1112.166) (-1112.013) (-1112.044) -- 0:00:30 Average standard deviation of split frequencies: 0.012276 505500 -- [-1110.042] (-1110.295) (-1110.144) (-1114.529) * (-1109.251) (-1114.191) (-1113.687) [-1112.525] -- 0:00:30 506000 -- (-1109.816) [-1111.273] (-1120.501) (-1113.137) * (-1112.409) (-1111.423) (-1111.576) [-1114.325] -- 0:00:30 506500 -- (-1110.889) (-1109.659) [-1111.861] (-1114.283) * (-1113.817) (-1111.492) [-1111.338] (-1121.315) -- 0:00:30 507000 -- (-1110.429) (-1112.547) [-1111.454] (-1112.865) * (-1112.405) (-1110.290) [-1109.787] (-1113.447) -- 0:00:30 507500 -- (-1110.846) (-1114.493) (-1110.287) [-1113.581] * (-1113.924) (-1108.604) (-1109.954) [-1109.501] -- 0:00:30 508000 -- (-1112.495) [-1110.010] (-1110.958) (-1109.830) * (-1109.909) [-1111.097] (-1111.974) (-1111.098) -- 0:00:30 508500 -- (-1110.496) (-1111.119) [-1110.335] (-1112.309) * (-1109.452) (-1108.463) [-1109.440] (-1110.663) -- 0:00:29 509000 -- (-1109.492) [-1115.425] (-1109.458) (-1117.593) * (-1109.797) (-1109.517) (-1109.707) [-1110.634] -- 0:00:29 509500 -- [-1112.203] (-1109.941) (-1110.923) (-1114.938) * [-1111.667] (-1109.608) (-1109.644) (-1111.520) -- 0:00:29 510000 -- (-1111.980) (-1111.727) [-1111.726] (-1111.821) * (-1108.761) [-1108.482] (-1110.895) (-1110.732) -- 0:00:29 Average standard deviation of split frequencies: 0.011729 510500 -- [-1119.539] (-1111.963) (-1112.556) (-1109.870) * [-1109.081] (-1110.920) (-1110.600) (-1113.311) -- 0:00:29 511000 -- (-1111.507) [-1110.834] (-1112.794) (-1112.923) * [-1110.544] (-1109.692) (-1110.331) (-1109.730) -- 0:00:29 511500 -- [-1112.044] (-1110.309) (-1110.843) (-1111.037) * (-1109.874) (-1109.721) (-1109.400) [-1111.378] -- 0:00:29 512000 -- (-1113.472) (-1112.670) [-1111.015] (-1112.999) * (-1111.014) (-1111.104) [-1110.247] (-1109.923) -- 0:00:29 512500 -- [-1110.763] (-1109.172) (-1111.594) (-1109.947) * (-1111.420) (-1108.633) (-1109.603) [-1112.944] -- 0:00:29 513000 -- (-1110.860) (-1109.828) [-1112.043] (-1110.238) * (-1111.667) (-1112.162) [-1110.471] (-1109.302) -- 0:00:29 513500 -- [-1112.098] (-1110.590) (-1113.380) (-1110.334) * (-1113.070) (-1115.009) [-1109.525] (-1110.221) -- 0:00:29 514000 -- [-1110.890] (-1114.193) (-1110.794) (-1110.213) * (-1115.867) [-1113.892] (-1109.211) (-1113.454) -- 0:00:29 514500 -- (-1110.190) [-1110.879] (-1113.512) (-1111.097) * [-1111.068] (-1112.549) (-1110.519) (-1109.232) -- 0:00:29 515000 -- (-1114.546) (-1108.402) [-1109.654] (-1109.172) * [-1108.881] (-1109.538) (-1110.446) (-1111.239) -- 0:00:29 Average standard deviation of split frequencies: 0.011232 515500 -- (-1110.544) [-1110.749] (-1109.825) (-1109.983) * [-1108.860] (-1110.271) (-1112.051) (-1115.985) -- 0:00:29 516000 -- (-1115.755) [-1112.723] (-1114.538) (-1113.300) * (-1110.376) (-1109.070) (-1114.644) [-1113.565] -- 0:00:29 516500 -- (-1112.888) (-1112.882) [-1109.871] (-1112.121) * (-1109.488) (-1110.861) (-1111.967) [-1113.251] -- 0:00:29 517000 -- [-1112.215] (-1112.558) (-1110.886) (-1111.281) * [-1111.345] (-1112.884) (-1112.526) (-1110.527) -- 0:00:28 517500 -- [-1111.708] (-1112.980) (-1117.161) (-1110.898) * (-1111.083) (-1109.349) [-1109.853] (-1112.559) -- 0:00:29 518000 -- (-1114.313) (-1111.711) (-1110.304) [-1115.476] * (-1115.781) (-1112.119) (-1108.985) [-1111.873] -- 0:00:29 518500 -- (-1111.008) [-1109.847] (-1110.328) (-1109.997) * (-1109.852) (-1111.869) (-1109.433) [-1108.643] -- 0:00:29 519000 -- (-1110.522) (-1110.754) [-1110.920] (-1109.555) * [-1110.208] (-1110.811) (-1110.951) (-1108.703) -- 0:00:29 519500 -- (-1109.705) [-1112.822] (-1110.683) (-1111.530) * (-1110.619) (-1110.768) (-1112.230) [-1111.147] -- 0:00:29 520000 -- (-1108.724) [-1109.191] (-1110.493) (-1108.801) * (-1109.254) (-1116.315) [-1109.852] (-1108.584) -- 0:00:29 Average standard deviation of split frequencies: 0.010172 520500 -- (-1111.454) (-1112.758) [-1108.896] (-1108.778) * (-1111.846) (-1116.472) (-1112.325) [-1112.732] -- 0:00:29 521000 -- [-1110.613] (-1112.280) (-1110.296) (-1108.961) * (-1110.408) (-1110.427) (-1110.740) [-1109.279] -- 0:00:29 521500 -- (-1112.841) (-1109.114) [-1110.551] (-1109.922) * [-1113.487] (-1113.071) (-1111.449) (-1113.270) -- 0:00:29 522000 -- (-1113.377) [-1109.885] (-1113.105) (-1108.491) * (-1111.040) (-1114.953) (-1112.654) [-1109.969] -- 0:00:29 522500 -- (-1109.934) (-1109.600) [-1114.890] (-1108.942) * (-1111.943) (-1111.333) (-1110.217) [-1111.852] -- 0:00:29 523000 -- (-1110.462) (-1114.597) (-1111.309) [-1109.382] * [-1110.301] (-1110.231) (-1108.846) (-1109.776) -- 0:00:29 523500 -- [-1111.757] (-1110.748) (-1109.250) (-1109.472) * (-1109.325) (-1112.092) (-1109.751) [-1109.035] -- 0:00:29 524000 -- (-1112.741) (-1114.472) [-1109.823] (-1110.544) * [-1111.579] (-1112.474) (-1110.672) (-1109.359) -- 0:00:29 524500 -- (-1110.040) (-1110.119) [-1112.353] (-1110.718) * (-1109.257) (-1112.418) (-1111.777) [-1110.765] -- 0:00:29 525000 -- (-1111.053) [-1110.633] (-1113.281) (-1108.502) * (-1111.312) (-1109.936) [-1111.640] (-1111.510) -- 0:00:28 Average standard deviation of split frequencies: 0.009015 525500 -- (-1109.957) (-1112.323) [-1108.918] (-1109.538) * (-1109.895) [-1109.021] (-1111.640) (-1111.747) -- 0:00:28 526000 -- (-1109.659) (-1115.675) (-1109.689) [-1112.390] * (-1112.144) (-1109.526) [-1112.020] (-1111.458) -- 0:00:28 526500 -- [-1110.619] (-1110.453) (-1110.865) (-1112.109) * (-1110.381) (-1111.108) (-1108.886) [-1111.067] -- 0:00:28 527000 -- (-1112.516) (-1109.129) [-1108.757] (-1109.911) * (-1109.671) (-1112.228) (-1108.814) [-1111.819] -- 0:00:28 527500 -- (-1109.494) (-1116.531) (-1112.145) [-1113.474] * (-1110.042) (-1110.237) [-1108.823] (-1110.033) -- 0:00:28 528000 -- (-1114.362) (-1114.362) (-1110.186) [-1110.166] * [-1109.503] (-1114.063) (-1108.878) (-1109.654) -- 0:00:28 528500 -- [-1112.077] (-1110.116) (-1110.547) (-1109.834) * (-1112.719) (-1110.342) [-1109.384] (-1109.820) -- 0:00:28 529000 -- (-1111.786) (-1108.589) [-1109.383] (-1111.005) * (-1110.548) (-1109.562) (-1112.564) [-1111.009] -- 0:00:28 529500 -- (-1110.385) [-1109.200] (-1109.975) (-1111.110) * [-1111.656] (-1110.792) (-1117.877) (-1110.646) -- 0:00:28 530000 -- [-1109.204] (-1110.640) (-1110.604) (-1111.932) * (-1109.049) (-1108.694) (-1109.528) [-1110.537] -- 0:00:28 Average standard deviation of split frequencies: 0.009130 530500 -- (-1110.197) (-1108.414) (-1109.327) [-1113.080] * (-1110.802) (-1109.521) (-1109.809) [-1111.285] -- 0:00:28 531000 -- (-1110.095) (-1109.394) [-1108.764] (-1112.987) * (-1114.870) [-1111.681] (-1112.200) (-1111.711) -- 0:00:28 531500 -- (-1112.772) [-1112.021] (-1110.172) (-1112.076) * (-1112.865) (-1111.463) (-1112.270) [-1109.373] -- 0:00:28 532000 -- [-1110.403] (-1112.000) (-1111.065) (-1111.098) * (-1114.880) (-1110.947) (-1111.962) [-1109.706] -- 0:00:28 532500 -- (-1110.374) (-1108.966) (-1113.187) [-1109.599] * (-1110.471) (-1115.464) (-1112.440) [-1109.207] -- 0:00:28 533000 -- (-1112.267) [-1109.164] (-1114.062) (-1111.743) * (-1111.240) [-1111.346] (-1109.445) (-1108.941) -- 0:00:28 533500 -- [-1110.345] (-1108.873) (-1109.564) (-1110.221) * (-1110.945) (-1110.115) [-1110.570] (-1111.521) -- 0:00:28 534000 -- (-1110.824) [-1109.114] (-1111.867) (-1112.303) * (-1116.979) (-1113.972) [-1110.980] (-1109.793) -- 0:00:28 534500 -- (-1109.721) [-1110.282] (-1112.683) (-1110.019) * (-1112.334) (-1112.623) (-1112.065) [-1109.661] -- 0:00:28 535000 -- [-1109.513] (-1109.460) (-1110.075) (-1109.800) * (-1113.110) [-1116.543] (-1112.234) (-1110.807) -- 0:00:28 Average standard deviation of split frequencies: 0.009364 535500 -- (-1109.679) (-1110.036) [-1110.122] (-1109.576) * [-1113.163] (-1111.312) (-1113.656) (-1110.332) -- 0:00:28 536000 -- (-1110.337) (-1112.325) [-1113.158] (-1111.794) * (-1112.540) (-1109.916) [-1111.017] (-1110.835) -- 0:00:28 536500 -- (-1109.720) [-1110.522] (-1109.939) (-1114.740) * [-1110.150] (-1109.076) (-1112.380) (-1111.213) -- 0:00:28 537000 -- [-1109.735] (-1113.945) (-1110.633) (-1115.436) * [-1109.187] (-1110.720) (-1110.152) (-1110.853) -- 0:00:28 537500 -- (-1110.297) (-1114.478) [-1109.460] (-1111.306) * (-1109.191) (-1115.597) (-1108.622) [-1111.209] -- 0:00:28 538000 -- (-1109.405) (-1111.050) [-1110.463] (-1108.920) * (-1110.632) (-1113.336) [-1114.576] (-1112.750) -- 0:00:28 538500 -- (-1108.568) [-1111.555] (-1113.001) (-1108.822) * (-1115.345) [-1114.176] (-1112.499) (-1109.254) -- 0:00:28 539000 -- [-1111.181] (-1111.917) (-1112.038) (-1109.304) * (-1108.816) (-1109.162) (-1113.628) [-1108.522] -- 0:00:28 539500 -- (-1111.158) [-1112.138] (-1110.416) (-1109.846) * (-1109.457) (-1109.152) (-1110.283) [-1110.835] -- 0:00:28 540000 -- (-1111.835) (-1113.024) (-1110.542) [-1110.567] * (-1113.682) (-1113.053) (-1109.965) [-1111.373] -- 0:00:28 Average standard deviation of split frequencies: 0.009010 540500 -- [-1110.317] (-1111.215) (-1111.168) (-1109.589) * (-1109.666) (-1114.397) (-1109.127) [-1109.545] -- 0:00:28 541000 -- (-1109.076) (-1110.119) (-1112.542) [-1109.800] * (-1114.654) (-1114.355) [-1108.758] (-1112.154) -- 0:00:27 541500 -- [-1109.484] (-1110.385) (-1114.504) (-1108.933) * (-1112.079) (-1116.452) (-1109.869) [-1112.986] -- 0:00:27 542000 -- (-1112.103) (-1109.595) (-1119.162) [-1109.889] * [-1113.000] (-1110.990) (-1110.206) (-1112.003) -- 0:00:27 542500 -- [-1111.554] (-1113.473) (-1112.251) (-1110.096) * (-1108.897) (-1111.789) [-1111.343] (-1110.216) -- 0:00:27 543000 -- (-1109.681) (-1110.216) (-1112.064) [-1110.571] * (-1112.020) (-1114.522) [-1113.437] (-1111.000) -- 0:00:27 543500 -- (-1111.319) [-1111.462] (-1108.609) (-1110.583) * [-1112.304] (-1111.597) (-1115.392) (-1113.612) -- 0:00:27 544000 -- [-1112.260] (-1109.714) (-1111.583) (-1109.779) * (-1113.558) (-1112.032) [-1114.437] (-1110.423) -- 0:00:27 544500 -- [-1116.983] (-1110.547) (-1111.931) (-1109.662) * (-1111.102) (-1113.710) (-1114.168) [-1109.099] -- 0:00:27 545000 -- (-1112.540) [-1108.939] (-1109.234) (-1111.211) * (-1112.317) (-1109.199) [-1112.746] (-1110.729) -- 0:00:27 Average standard deviation of split frequencies: 0.009209 545500 -- [-1117.318] (-1111.703) (-1112.925) (-1110.987) * [-1112.752] (-1116.666) (-1113.025) (-1109.286) -- 0:00:27 546000 -- (-1109.805) (-1118.446) [-1110.826] (-1111.394) * (-1115.160) [-1113.774] (-1109.397) (-1109.748) -- 0:00:27 546500 -- (-1109.300) [-1115.416] (-1112.975) (-1110.043) * (-1111.121) (-1111.352) [-1112.910] (-1109.127) -- 0:00:27 547000 -- [-1109.861] (-1109.144) (-1114.477) (-1109.475) * (-1111.251) [-1108.748] (-1110.176) (-1109.934) -- 0:00:27 547500 -- (-1109.852) (-1109.814) (-1116.167) [-1111.586] * [-1109.825] (-1109.948) (-1110.640) (-1112.455) -- 0:00:27 548000 -- [-1111.278] (-1110.009) (-1111.798) (-1109.850) * (-1108.656) (-1109.549) (-1111.064) [-1111.425] -- 0:00:27 548500 -- (-1111.695) [-1110.617] (-1110.675) (-1113.381) * [-1112.493] (-1110.718) (-1109.319) (-1110.010) -- 0:00:27 549000 -- (-1110.058) [-1110.327] (-1111.122) (-1113.446) * (-1111.238) (-1110.600) [-1110.641] (-1112.450) -- 0:00:27 549500 -- (-1112.542) [-1110.723] (-1109.254) (-1111.439) * [-1111.181] (-1109.828) (-1110.133) (-1110.006) -- 0:00:27 550000 -- (-1111.509) (-1110.553) [-1108.527] (-1110.967) * (-1109.765) [-1110.290] (-1109.847) (-1110.530) -- 0:00:27 Average standard deviation of split frequencies: 0.008359 550500 -- (-1112.302) (-1110.607) (-1109.991) [-1112.532] * (-1109.383) [-1111.235] (-1109.932) (-1109.607) -- 0:00:27 551000 -- (-1113.925) (-1110.290) [-1112.194] (-1109.850) * (-1112.112) [-1114.519] (-1111.043) (-1109.226) -- 0:00:27 551500 -- [-1111.940] (-1112.011) (-1111.941) (-1110.169) * (-1112.444) (-1111.109) (-1109.796) [-1111.290] -- 0:00:27 552000 -- (-1110.728) (-1111.822) [-1111.471] (-1111.758) * [-1111.040] (-1109.103) (-1110.039) (-1116.551) -- 0:00:27 552500 -- (-1113.621) (-1109.553) (-1114.469) [-1110.918] * (-1110.075) (-1109.275) (-1109.195) [-1111.533] -- 0:00:27 553000 -- (-1110.091) (-1111.327) (-1109.169) [-1113.817] * (-1110.423) [-1110.912] (-1111.853) (-1110.405) -- 0:00:27 553500 -- (-1112.227) [-1110.779] (-1109.169) (-1110.484) * (-1108.607) [-1109.889] (-1112.716) (-1110.164) -- 0:00:27 554000 -- (-1110.102) (-1111.799) [-1109.992] (-1111.604) * (-1109.169) (-1110.459) [-1110.821] (-1109.440) -- 0:00:27 554500 -- [-1110.379] (-1111.807) (-1111.385) (-1115.215) * (-1109.983) (-1112.943) [-1108.490] (-1109.321) -- 0:00:27 555000 -- (-1112.133) (-1109.140) (-1111.988) [-1111.358] * (-1108.528) (-1109.696) [-1110.302] (-1109.153) -- 0:00:27 Average standard deviation of split frequencies: 0.008877 555500 -- [-1110.344] (-1109.979) (-1116.758) (-1109.708) * [-1108.936] (-1110.839) (-1113.906) (-1111.451) -- 0:00:27 556000 -- (-1110.522) (-1109.144) (-1111.416) [-1112.457] * (-1110.164) [-1108.899] (-1109.560) (-1113.263) -- 0:00:27 556500 -- (-1111.148) (-1112.718) (-1110.083) [-1108.818] * (-1110.249) (-1110.298) (-1109.777) [-1111.795] -- 0:00:27 557000 -- [-1109.562] (-1109.666) (-1110.441) (-1110.370) * [-1112.296] (-1111.670) (-1113.353) (-1109.690) -- 0:00:27 557500 -- (-1109.595) (-1111.543) [-1109.497] (-1110.061) * (-1109.044) (-1109.681) [-1110.222] (-1112.431) -- 0:00:26 558000 -- (-1110.385) (-1111.366) [-1111.915] (-1109.436) * (-1108.963) (-1109.897) [-1111.259] (-1110.990) -- 0:00:26 558500 -- (-1111.181) (-1111.439) (-1110.561) [-1110.323] * [-1109.294] (-1110.151) (-1110.338) (-1111.153) -- 0:00:26 559000 -- [-1108.563] (-1111.280) (-1111.016) (-1110.020) * (-1109.443) (-1112.272) (-1112.097) [-1108.668] -- 0:00:26 559500 -- [-1109.104] (-1112.651) (-1109.939) (-1109.871) * [-1108.811] (-1112.092) (-1114.592) (-1109.601) -- 0:00:26 560000 -- (-1111.485) (-1112.188) [-1108.815] (-1109.079) * (-1109.169) (-1111.678) [-1111.526] (-1113.706) -- 0:00:26 Average standard deviation of split frequencies: 0.008355 560500 -- (-1111.405) (-1115.906) (-1112.049) [-1109.139] * (-1109.306) (-1111.691) (-1110.209) [-1111.677] -- 0:00:26 561000 -- [-1111.832] (-1116.317) (-1108.671) (-1113.178) * (-1111.862) (-1111.211) (-1113.560) [-1111.714] -- 0:00:26 561500 -- [-1110.978] (-1114.675) (-1109.630) (-1109.807) * (-1109.313) [-1117.398] (-1112.291) (-1109.503) -- 0:00:26 562000 -- (-1109.593) (-1110.733) (-1109.567) [-1110.385] * [-1109.329] (-1112.673) (-1112.921) (-1108.641) -- 0:00:26 562500 -- (-1110.471) [-1109.133] (-1109.338) (-1111.427) * [-1109.156] (-1109.225) (-1109.324) (-1109.726) -- 0:00:26 563000 -- (-1109.899) (-1114.198) [-1109.436] (-1110.988) * [-1109.684] (-1109.584) (-1109.686) (-1109.967) -- 0:00:26 563500 -- [-1111.469] (-1113.129) (-1109.330) (-1111.045) * (-1111.320) [-1109.753] (-1109.584) (-1110.568) -- 0:00:26 564000 -- (-1113.174) (-1115.378) [-1111.416] (-1115.064) * (-1111.810) (-1109.793) [-1108.502] (-1111.789) -- 0:00:26 564500 -- (-1111.497) (-1113.304) (-1110.131) [-1110.284] * (-1110.835) (-1111.188) [-1109.412] (-1110.575) -- 0:00:26 565000 -- (-1110.388) [-1109.344] (-1109.598) (-1109.050) * (-1111.305) (-1112.396) (-1108.863) [-1108.972] -- 0:00:26 Average standard deviation of split frequencies: 0.008525 565500 -- (-1109.949) (-1109.653) (-1109.822) [-1109.874] * [-1112.298] (-1110.557) (-1108.916) (-1110.744) -- 0:00:26 566000 -- (-1109.631) (-1111.067) [-1111.572] (-1108.444) * [-1111.199] (-1113.534) (-1110.299) (-1111.979) -- 0:00:26 566500 -- (-1112.194) [-1113.670] (-1109.562) (-1113.337) * [-1111.980] (-1109.649) (-1111.907) (-1109.421) -- 0:00:26 567000 -- [-1109.134] (-1114.350) (-1109.562) (-1109.994) * (-1110.776) (-1109.996) (-1112.491) [-1110.188] -- 0:00:26 567500 -- (-1110.692) [-1110.028] (-1109.446) (-1110.231) * (-1115.406) [-1109.727] (-1111.021) (-1113.339) -- 0:00:26 568000 -- [-1114.364] (-1112.837) (-1111.204) (-1109.036) * (-1109.507) [-1109.090] (-1110.094) (-1111.859) -- 0:00:26 568500 -- (-1115.066) (-1110.783) [-1109.315] (-1110.136) * (-1111.188) [-1108.660] (-1109.403) (-1111.037) -- 0:00:26 569000 -- (-1111.880) (-1109.548) [-1109.195] (-1110.924) * (-1115.504) [-1109.283] (-1110.807) (-1111.712) -- 0:00:26 569500 -- [-1109.242] (-1114.367) (-1109.106) (-1108.787) * (-1112.861) (-1109.623) [-1109.129] (-1112.756) -- 0:00:26 570000 -- [-1110.133] (-1113.311) (-1109.615) (-1110.972) * (-1113.326) (-1110.506) (-1113.223) [-1111.287] -- 0:00:26 Average standard deviation of split frequencies: 0.008622 570500 -- [-1110.451] (-1111.060) (-1109.735) (-1109.578) * (-1114.419) (-1109.631) (-1109.573) [-1112.857] -- 0:00:26 571000 -- (-1114.204) [-1108.857] (-1108.875) (-1109.492) * [-1119.960] (-1118.120) (-1115.023) (-1113.483) -- 0:00:26 571500 -- (-1108.917) (-1109.683) (-1112.943) [-1112.462] * (-1111.749) [-1111.123] (-1113.117) (-1113.567) -- 0:00:26 572000 -- (-1108.748) (-1112.691) (-1112.877) [-1111.212] * (-1113.118) [-1110.021] (-1110.325) (-1111.540) -- 0:00:26 572500 -- (-1109.935) (-1112.293) [-1110.696] (-1109.912) * (-1112.398) (-1109.936) [-1109.407] (-1110.437) -- 0:00:26 573000 -- (-1112.134) (-1111.853) [-1113.439] (-1110.089) * [-1110.043] (-1116.142) (-1113.804) (-1111.698) -- 0:00:26 573500 -- (-1111.114) (-1110.032) (-1112.456) [-1109.225] * [-1108.511] (-1109.184) (-1111.487) (-1111.836) -- 0:00:26 574000 -- [-1108.430] (-1110.591) (-1109.472) (-1110.163) * (-1112.835) [-1109.623] (-1108.852) (-1114.660) -- 0:00:25 574500 -- (-1110.442) [-1111.300] (-1109.887) (-1111.411) * (-1112.316) [-1110.078] (-1112.825) (-1110.070) -- 0:00:25 575000 -- (-1110.442) (-1112.038) [-1109.866] (-1109.861) * (-1114.372) (-1108.716) (-1110.236) [-1110.733] -- 0:00:25 Average standard deviation of split frequencies: 0.008491 575500 -- [-1110.360] (-1110.695) (-1109.872) (-1111.784) * (-1111.544) [-1109.334] (-1113.432) (-1112.391) -- 0:00:25 576000 -- (-1114.517) [-1109.667] (-1108.762) (-1109.707) * (-1112.629) (-1110.937) (-1109.948) [-1108.839] -- 0:00:25 576500 -- (-1115.303) (-1111.115) [-1111.888] (-1110.984) * (-1112.906) [-1113.790] (-1110.846) (-1110.320) -- 0:00:25 577000 -- (-1113.207) (-1112.870) (-1110.196) [-1111.622] * (-1109.197) [-1113.368] (-1109.970) (-1110.051) -- 0:00:25 577500 -- [-1109.311] (-1113.070) (-1111.819) (-1112.167) * (-1111.318) [-1110.864] (-1110.629) (-1109.330) -- 0:00:25 578000 -- (-1110.197) (-1109.205) (-1108.749) [-1111.407] * (-1111.016) (-1110.041) [-1110.400] (-1109.508) -- 0:00:25 578500 -- (-1109.367) (-1109.008) [-1109.248] (-1112.750) * (-1110.953) [-1110.396] (-1111.029) (-1111.776) -- 0:00:25 579000 -- [-1109.086] (-1110.646) (-1109.528) (-1115.625) * (-1111.101) (-1110.488) [-1109.141] (-1110.144) -- 0:00:25 579500 -- [-1109.362] (-1110.005) (-1109.262) (-1115.183) * (-1110.907) (-1113.779) (-1108.410) [-1110.816] -- 0:00:25 580000 -- (-1109.160) [-1112.141] (-1109.406) (-1112.373) * (-1112.663) (-1110.762) (-1109.000) [-1113.176] -- 0:00:25 Average standard deviation of split frequencies: 0.008644 580500 -- (-1110.223) (-1109.128) (-1113.916) [-1109.555] * (-1111.738) (-1110.784) [-1109.730] (-1111.112) -- 0:00:25 581000 -- (-1111.178) (-1108.719) (-1118.516) [-1109.591] * [-1113.989] (-1109.980) (-1111.180) (-1114.603) -- 0:00:25 581500 -- [-1112.831] (-1109.416) (-1111.626) (-1109.711) * (-1108.680) [-1110.628] (-1110.363) (-1112.850) -- 0:00:25 582000 -- (-1110.468) (-1109.484) (-1109.905) [-1110.028] * (-1108.782) (-1109.372) (-1111.843) [-1109.412] -- 0:00:25 582500 -- (-1110.277) (-1114.814) [-1108.794] (-1110.001) * [-1111.526] (-1109.374) (-1112.129) (-1111.296) -- 0:00:25 583000 -- [-1110.016] (-1110.221) (-1115.244) (-1112.884) * (-1111.669) [-1111.574] (-1113.464) (-1110.488) -- 0:00:25 583500 -- [-1112.312] (-1109.406) (-1118.649) (-1112.256) * [-1109.430] (-1110.425) (-1111.335) (-1110.708) -- 0:00:25 584000 -- (-1109.354) (-1109.190) (-1115.484) [-1109.596] * (-1108.360) (-1109.347) (-1112.149) [-1109.376] -- 0:00:25 584500 -- (-1110.109) (-1112.528) (-1115.721) [-1111.220] * [-1111.376] (-1111.342) (-1113.024) (-1109.970) -- 0:00:25 585000 -- [-1114.681] (-1113.202) (-1116.044) (-1111.459) * [-1112.918] (-1109.092) (-1111.055) (-1111.896) -- 0:00:25 Average standard deviation of split frequencies: 0.009275 585500 -- [-1110.130] (-1110.820) (-1109.911) (-1111.752) * (-1115.916) (-1110.308) (-1109.557) [-1111.325] -- 0:00:25 586000 -- (-1110.086) (-1109.201) [-1109.412] (-1110.079) * (-1113.612) (-1114.211) (-1112.439) [-1111.514] -- 0:00:25 586500 -- (-1111.954) (-1110.371) (-1113.533) [-1112.557] * (-1114.999) (-1112.040) (-1109.948) [-1109.090] -- 0:00:25 587000 -- (-1109.667) (-1109.334) [-1111.920] (-1111.811) * [-1109.551] (-1115.595) (-1119.362) (-1109.208) -- 0:00:25 587500 -- [-1109.789] (-1110.445) (-1113.043) (-1110.011) * [-1110.167] (-1114.323) (-1112.894) (-1110.090) -- 0:00:25 588000 -- [-1113.928] (-1114.152) (-1111.421) (-1112.616) * (-1108.607) [-1113.772] (-1109.743) (-1110.886) -- 0:00:25 588500 -- (-1110.587) (-1120.608) (-1110.513) [-1113.308] * (-1111.482) (-1114.454) [-1109.674] (-1112.851) -- 0:00:25 589000 -- (-1109.662) (-1115.660) [-1111.338] (-1115.395) * (-1112.300) (-1110.843) [-1110.927] (-1111.395) -- 0:00:25 589500 -- (-1108.916) (-1115.594) (-1110.240) [-1113.574] * [-1108.719] (-1112.216) (-1111.270) (-1111.013) -- 0:00:25 590000 -- [-1110.684] (-1112.956) (-1109.575) (-1115.301) * (-1108.526) [-1112.045] (-1110.577) (-1109.670) -- 0:00:25 Average standard deviation of split frequencies: 0.009248 590500 -- (-1109.706) (-1114.195) (-1110.063) [-1111.560] * [-1109.044] (-1111.894) (-1112.328) (-1109.349) -- 0:00:24 591000 -- (-1112.674) (-1110.352) (-1109.243) [-1113.451] * (-1108.668) (-1113.562) (-1110.162) [-1111.476] -- 0:00:24 591500 -- (-1111.127) (-1109.938) (-1108.751) [-1113.101] * (-1108.625) (-1115.094) [-1109.940] (-1112.164) -- 0:00:24 592000 -- (-1110.054) [-1108.850] (-1109.167) (-1109.852) * (-1115.767) (-1110.216) (-1113.097) [-1110.388] -- 0:00:24 592500 -- (-1109.046) [-1108.964] (-1112.260) (-1110.888) * (-1110.284) (-1111.138) [-1112.042] (-1109.979) -- 0:00:24 593000 -- (-1111.471) [-1110.682] (-1109.596) (-1112.259) * (-1109.964) [-1110.277] (-1113.716) (-1109.020) -- 0:00:24 593500 -- (-1110.423) [-1110.941] (-1112.395) (-1109.077) * (-1109.173) (-1115.287) [-1109.849] (-1113.189) -- 0:00:24 594000 -- [-1110.923] (-1111.105) (-1113.630) (-1108.575) * [-1111.370] (-1116.164) (-1112.024) (-1110.680) -- 0:00:24 594500 -- [-1109.349] (-1110.599) (-1112.503) (-1110.787) * (-1109.929) (-1111.369) (-1121.313) [-1109.601] -- 0:00:24 595000 -- (-1110.984) (-1111.053) (-1110.011) [-1110.731] * (-1109.614) (-1111.203) (-1111.843) [-1111.700] -- 0:00:24 Average standard deviation of split frequencies: 0.009259 595500 -- [-1110.320] (-1111.465) (-1110.963) (-1110.570) * (-1110.544) (-1111.117) [-1111.891] (-1110.301) -- 0:00:24 596000 -- (-1109.123) (-1109.777) (-1111.358) [-1110.063] * (-1109.804) [-1112.383] (-1111.145) (-1113.801) -- 0:00:24 596500 -- (-1108.811) (-1112.978) [-1110.580] (-1111.871) * (-1109.620) (-1112.016) [-1109.584] (-1118.603) -- 0:00:24 597000 -- (-1109.145) (-1110.890) [-1108.954] (-1109.985) * (-1109.693) [-1109.400] (-1111.641) (-1110.748) -- 0:00:24 597500 -- (-1111.804) (-1111.120) [-1110.183] (-1108.890) * (-1108.845) [-1114.383] (-1109.329) (-1110.694) -- 0:00:24 598000 -- (-1111.830) (-1109.901) [-1113.295] (-1110.579) * [-1110.493] (-1117.252) (-1110.066) (-1112.872) -- 0:00:24 598500 -- (-1109.162) (-1110.383) (-1110.142) [-1110.372] * (-1110.576) (-1111.627) [-1110.516] (-1110.547) -- 0:00:24 599000 -- (-1110.022) [-1108.450] (-1112.058) (-1111.998) * (-1117.549) (-1109.967) [-1109.725] (-1109.205) -- 0:00:24 599500 -- (-1109.217) [-1108.566] (-1111.411) (-1112.995) * (-1110.810) (-1111.263) (-1112.207) [-1112.475] -- 0:00:24 600000 -- (-1111.372) (-1113.684) (-1112.914) [-1113.394] * (-1111.988) (-1112.607) (-1110.305) [-1111.032] -- 0:00:24 Average standard deviation of split frequencies: 0.009663 600500 -- (-1110.521) (-1112.065) (-1114.572) [-1110.189] * (-1111.137) (-1111.495) (-1110.403) [-1112.939] -- 0:00:24 601000 -- (-1110.521) (-1111.611) (-1111.701) [-1111.043] * (-1110.852) [-1111.287] (-1111.539) (-1111.812) -- 0:00:24 601500 -- [-1109.787] (-1113.917) (-1109.634) (-1110.530) * [-1109.448] (-1112.433) (-1113.259) (-1109.498) -- 0:00:24 602000 -- [-1110.520] (-1113.085) (-1118.386) (-1110.074) * (-1108.999) (-1110.043) [-1112.186] (-1109.179) -- 0:00:24 602500 -- (-1111.623) (-1111.130) [-1111.483] (-1109.344) * (-1109.044) (-1109.288) (-1112.021) [-1109.058] -- 0:00:24 603000 -- (-1110.203) [-1110.656] (-1109.436) (-1109.583) * (-1115.577) [-1111.938] (-1111.125) (-1108.872) -- 0:00:24 603500 -- (-1110.551) [-1110.974] (-1109.385) (-1109.127) * (-1115.012) (-1111.428) (-1109.146) [-1112.254] -- 0:00:24 604000 -- (-1108.932) (-1109.058) (-1111.083) [-1110.707] * (-1109.028) (-1114.342) (-1109.628) [-1112.843] -- 0:00:24 604500 -- (-1108.530) [-1112.732] (-1111.714) (-1111.232) * [-1109.344] (-1111.228) (-1109.841) (-1111.173) -- 0:00:24 605000 -- (-1108.499) (-1112.048) [-1111.608] (-1112.190) * [-1108.469] (-1109.662) (-1108.720) (-1110.245) -- 0:00:24 Average standard deviation of split frequencies: 0.010204 605500 -- (-1108.396) (-1110.613) (-1110.537) [-1109.718] * (-1110.367) [-1112.000] (-1112.188) (-1111.045) -- 0:00:24 606000 -- (-1110.277) (-1109.287) (-1110.831) [-1110.742] * [-1109.600] (-1113.007) (-1108.594) (-1113.446) -- 0:00:24 606500 -- (-1108.429) (-1109.660) (-1110.504) [-1109.906] * (-1110.622) (-1112.977) (-1114.237) [-1112.351] -- 0:00:24 607000 -- [-1108.668] (-1110.849) (-1109.393) (-1111.221) * (-1110.237) (-1114.425) [-1109.847] (-1113.493) -- 0:00:23 607500 -- [-1108.963] (-1109.300) (-1108.808) (-1108.826) * (-1109.938) (-1114.597) [-1108.876] (-1108.978) -- 0:00:23 608000 -- (-1112.741) (-1110.611) [-1110.644] (-1109.460) * (-1110.194) [-1109.525] (-1113.316) (-1110.162) -- 0:00:23 608500 -- (-1109.536) [-1110.432] (-1110.686) (-1110.285) * (-1111.770) [-1113.777] (-1111.685) (-1115.312) -- 0:00:23 609000 -- (-1110.860) [-1109.533] (-1108.455) (-1112.870) * (-1109.314) (-1111.794) [-1113.102] (-1111.712) -- 0:00:23 609500 -- (-1109.242) (-1112.914) (-1110.990) [-1109.952] * [-1108.863] (-1111.623) (-1113.468) (-1112.598) -- 0:00:23 610000 -- (-1111.230) (-1109.976) (-1111.787) [-1110.833] * (-1110.835) [-1110.967] (-1109.734) (-1113.035) -- 0:00:23 Average standard deviation of split frequencies: 0.009842 610500 -- (-1109.217) (-1111.453) (-1110.706) [-1109.527] * (-1109.409) (-1110.022) [-1111.722] (-1111.425) -- 0:00:23 611000 -- [-1110.509] (-1110.921) (-1110.090) (-1112.992) * (-1110.066) (-1112.411) (-1111.208) [-1110.102] -- 0:00:23 611500 -- (-1108.821) (-1110.407) [-1110.685] (-1110.487) * (-1110.124) (-1110.706) [-1111.965] (-1113.194) -- 0:00:23 612000 -- (-1109.618) (-1108.987) (-1111.335) [-1109.826] * (-1110.362) (-1109.837) (-1110.866) [-1112.183] -- 0:00:23 612500 -- (-1109.414) (-1109.835) [-1113.444] (-1108.597) * (-1110.949) (-1110.056) [-1109.229] (-1110.123) -- 0:00:23 613000 -- (-1115.213) (-1114.748) (-1112.814) [-1110.241] * (-1110.107) (-1113.814) [-1111.073] (-1110.511) -- 0:00:23 613500 -- (-1113.111) [-1109.344] (-1110.249) (-1117.337) * (-1111.661) (-1109.729) [-1108.658] (-1112.426) -- 0:00:23 614000 -- (-1116.957) [-1110.025] (-1111.390) (-1111.526) * (-1112.180) (-1109.130) [-1108.636] (-1112.509) -- 0:00:23 614500 -- (-1111.106) [-1109.913] (-1109.924) (-1109.633) * (-1110.798) (-1114.533) [-1109.062] (-1112.024) -- 0:00:23 615000 -- (-1112.167) (-1108.828) (-1114.505) [-1110.709] * (-1114.195) (-1114.533) [-1112.223] (-1116.177) -- 0:00:23 Average standard deviation of split frequencies: 0.009906 615500 -- [-1109.782] (-1113.963) (-1113.471) (-1108.985) * (-1112.067) (-1115.302) [-1110.914] (-1118.464) -- 0:00:23 616000 -- (-1111.181) (-1113.532) (-1109.808) [-1109.494] * (-1110.590) (-1112.834) [-1108.562] (-1114.297) -- 0:00:23 616500 -- (-1112.339) (-1110.438) (-1110.195) [-1111.468] * (-1113.146) (-1109.853) [-1108.859] (-1110.041) -- 0:00:23 617000 -- (-1112.437) (-1111.937) [-1108.710] (-1111.975) * (-1108.971) (-1113.677) (-1109.950) [-1112.024] -- 0:00:23 617500 -- (-1110.482) [-1111.217] (-1111.996) (-1111.012) * [-1108.996] (-1108.846) (-1112.141) (-1125.885) -- 0:00:23 618000 -- (-1111.201) (-1111.345) [-1110.023] (-1110.959) * [-1108.968] (-1110.010) (-1111.287) (-1121.143) -- 0:00:23 618500 -- [-1110.561] (-1112.936) (-1112.559) (-1110.696) * (-1111.412) (-1109.022) (-1113.138) [-1110.980] -- 0:00:23 619000 -- [-1116.697] (-1108.457) (-1110.031) (-1109.169) * [-1108.920] (-1110.639) (-1108.426) (-1111.174) -- 0:00:23 619500 -- (-1109.503) [-1108.696] (-1109.021) (-1110.709) * (-1109.209) [-1109.282] (-1109.478) (-1109.741) -- 0:00:23 620000 -- [-1109.188] (-1109.343) (-1110.301) (-1111.731) * [-1109.209] (-1110.687) (-1109.179) (-1112.921) -- 0:00:23 Average standard deviation of split frequencies: 0.009606 620500 -- (-1110.059) [-1109.891] (-1112.053) (-1110.365) * (-1108.845) [-1114.042] (-1109.726) (-1109.426) -- 0:00:23 621000 -- (-1109.355) [-1110.635] (-1111.139) (-1110.377) * [-1108.851] (-1111.635) (-1110.152) (-1110.030) -- 0:00:23 621500 -- [-1109.489] (-1109.646) (-1110.094) (-1111.587) * (-1109.459) [-1109.750] (-1109.951) (-1112.350) -- 0:00:23 622000 -- (-1113.410) (-1109.005) (-1114.263) [-1109.774] * (-1111.889) (-1109.613) (-1110.286) [-1112.347] -- 0:00:23 622500 -- (-1111.893) (-1110.970) (-1110.757) [-1109.528] * (-1113.739) (-1109.875) (-1110.152) [-1113.823] -- 0:00:23 623000 -- (-1109.920) [-1109.997] (-1108.410) (-1111.908) * (-1110.337) (-1111.470) (-1117.334) [-1109.687] -- 0:00:22 623500 -- (-1112.851) (-1111.014) (-1109.773) [-1108.777] * (-1111.314) (-1109.271) [-1110.943] (-1110.631) -- 0:00:22 624000 -- (-1109.311) (-1113.810) (-1110.386) [-1109.101] * (-1117.026) (-1110.653) [-1112.365] (-1110.866) -- 0:00:22 624500 -- (-1109.811) [-1111.270] (-1108.510) (-1110.830) * [-1110.735] (-1112.804) (-1112.831) (-1110.102) -- 0:00:22 625000 -- (-1110.442) [-1109.461] (-1112.749) (-1110.766) * (-1110.220) (-1114.313) (-1110.638) [-1110.742] -- 0:00:22 Average standard deviation of split frequencies: 0.008948 625500 -- [-1114.488] (-1109.742) (-1110.729) (-1109.094) * (-1112.554) [-1109.132] (-1112.130) (-1108.775) -- 0:00:22 626000 -- [-1113.111] (-1109.034) (-1112.635) (-1111.374) * (-1110.984) (-1115.813) [-1111.960] (-1108.775) -- 0:00:22 626500 -- [-1111.381] (-1110.174) (-1110.532) (-1110.970) * (-1112.604) (-1111.006) [-1109.549] (-1115.257) -- 0:00:22 627000 -- (-1111.240) (-1111.017) (-1109.702) [-1109.277] * [-1112.466] (-1109.705) (-1114.533) (-1109.646) -- 0:00:22 627500 -- [-1108.432] (-1115.071) (-1115.501) (-1114.429) * [-1109.057] (-1109.048) (-1112.013) (-1109.229) -- 0:00:22 628000 -- (-1110.661) (-1112.802) (-1112.212) [-1111.244] * (-1108.614) (-1108.446) [-1113.512] (-1111.281) -- 0:00:22 628500 -- (-1112.493) (-1115.411) (-1112.380) [-1109.722] * (-1112.142) (-1108.587) (-1112.399) [-1110.565] -- 0:00:22 629000 -- [-1110.844] (-1114.385) (-1111.292) (-1110.448) * (-1108.920) (-1111.798) (-1126.806) [-1110.427] -- 0:00:22 629500 -- (-1115.849) (-1113.005) (-1111.833) [-1110.601] * [-1113.462] (-1109.606) (-1114.211) (-1110.638) -- 0:00:22 630000 -- (-1109.933) [-1114.786] (-1110.819) (-1110.096) * (-1112.793) (-1111.849) (-1111.854) [-1109.413] -- 0:00:22 Average standard deviation of split frequencies: 0.008662 630500 -- (-1109.505) (-1111.437) (-1112.223) [-1109.962] * (-1109.448) (-1109.760) [-1114.198] (-1111.643) -- 0:00:22 631000 -- [-1109.828] (-1115.082) (-1112.171) (-1110.468) * (-1114.023) (-1112.432) [-1108.885] (-1109.235) -- 0:00:22 631500 -- (-1109.309) (-1117.477) [-1110.867] (-1109.899) * (-1110.185) [-1109.735] (-1114.035) (-1112.981) -- 0:00:22 632000 -- (-1109.770) [-1110.908] (-1109.163) (-1110.719) * (-1115.364) [-1110.683] (-1110.774) (-1111.730) -- 0:00:22 632500 -- (-1113.862) [-1113.737] (-1111.220) (-1111.688) * (-1109.812) (-1109.812) (-1109.601) [-1112.439] -- 0:00:22 633000 -- (-1111.630) (-1111.444) [-1111.037] (-1110.045) * (-1111.591) (-1110.690) [-1110.432] (-1113.127) -- 0:00:22 633500 -- (-1110.842) (-1112.549) [-1111.263] (-1109.256) * (-1109.439) (-1109.373) [-1115.161] (-1111.817) -- 0:00:22 634000 -- (-1111.008) [-1110.380] (-1111.151) (-1109.265) * [-1109.960] (-1109.403) (-1115.315) (-1109.712) -- 0:00:22 634500 -- [-1111.082] (-1112.894) (-1113.863) (-1112.796) * (-1112.284) [-1110.712] (-1108.795) (-1109.749) -- 0:00:22 635000 -- [-1110.435] (-1109.549) (-1113.976) (-1112.190) * (-1110.559) [-1109.401] (-1109.207) (-1113.713) -- 0:00:22 Average standard deviation of split frequencies: 0.009025 635500 -- (-1111.747) (-1109.549) (-1111.329) [-1110.835] * (-1110.677) (-1109.039) [-1109.569] (-1111.864) -- 0:00:22 636000 -- (-1110.154) (-1108.810) (-1111.005) [-1109.967] * (-1110.875) (-1110.786) [-1111.180] (-1109.558) -- 0:00:22 636500 -- [-1109.019] (-1108.989) (-1113.521) (-1111.234) * (-1113.335) (-1110.697) (-1110.520) [-1108.645] -- 0:00:22 637000 -- (-1109.249) (-1109.007) [-1109.828] (-1118.699) * [-1112.836] (-1110.947) (-1108.309) (-1109.167) -- 0:00:22 637500 -- [-1111.716] (-1110.342) (-1111.492) (-1112.441) * (-1113.329) [-1110.181] (-1110.377) (-1109.167) -- 0:00:22 638000 -- (-1110.429) (-1109.195) (-1108.615) [-1110.033] * (-1111.981) [-1111.289] (-1114.385) (-1114.240) -- 0:00:22 638500 -- (-1111.678) (-1112.373) [-1109.893] (-1110.914) * (-1110.293) [-1110.159] (-1111.360) (-1111.522) -- 0:00:22 639000 -- (-1109.352) (-1113.658) [-1111.859] (-1111.201) * (-1111.183) (-1110.840) (-1109.684) [-1108.512] -- 0:00:22 639500 -- (-1109.066) (-1114.100) [-1110.090] (-1110.716) * [-1109.107] (-1112.762) (-1109.752) (-1111.621) -- 0:00:21 640000 -- [-1109.062] (-1112.760) (-1110.954) (-1110.521) * (-1109.151) (-1113.687) [-1111.552] (-1110.764) -- 0:00:21 Average standard deviation of split frequencies: 0.009003 640500 -- (-1110.802) (-1111.301) [-1110.774] (-1112.766) * (-1109.922) [-1109.206] (-1109.883) (-1109.921) -- 0:00:21 641000 -- (-1109.943) (-1110.694) [-1112.079] (-1111.529) * (-1112.618) (-1113.720) [-1109.452] (-1114.125) -- 0:00:21 641500 -- [-1109.316] (-1110.603) (-1110.759) (-1116.748) * (-1109.774) (-1112.167) (-1112.321) [-1110.772] -- 0:00:21 642000 -- (-1108.628) [-1113.779] (-1111.251) (-1121.529) * (-1109.778) [-1114.450] (-1110.876) (-1110.598) -- 0:00:21 642500 -- (-1116.093) [-1110.042] (-1112.211) (-1113.325) * (-1110.084) (-1109.893) [-1112.484] (-1110.850) -- 0:00:21 643000 -- (-1109.849) (-1108.928) (-1112.826) [-1110.122] * (-1110.945) (-1109.190) (-1110.962) [-1110.260] -- 0:00:21 643500 -- (-1115.407) [-1110.459] (-1111.643) (-1110.083) * [-1109.285] (-1112.031) (-1112.260) (-1109.533) -- 0:00:21 644000 -- (-1111.447) (-1112.400) [-1110.587] (-1109.256) * (-1115.427) [-1111.475] (-1109.021) (-1108.895) -- 0:00:21 644500 -- (-1115.949) (-1113.287) [-1109.264] (-1110.330) * (-1109.985) (-1111.957) (-1111.847) [-1109.275] -- 0:00:21 645000 -- [-1109.907] (-1110.194) (-1109.553) (-1111.517) * (-1110.823) (-1111.051) (-1113.884) [-1109.993] -- 0:00:21 Average standard deviation of split frequencies: 0.009272 645500 -- [-1109.069] (-1109.215) (-1111.488) (-1110.347) * (-1111.888) [-1111.002] (-1110.454) (-1109.996) -- 0:00:21 646000 -- (-1111.272) (-1110.835) (-1112.915) [-1112.000] * (-1109.655) (-1108.879) (-1110.111) [-1109.069] -- 0:00:21 646500 -- (-1112.441) (-1114.609) (-1114.427) [-1114.828] * (-1109.227) [-1110.117] (-1112.453) (-1110.082) -- 0:00:21 647000 -- (-1109.236) (-1109.659) (-1115.471) [-1112.688] * [-1109.831] (-1108.573) (-1111.411) (-1110.099) -- 0:00:21 647500 -- [-1108.962] (-1109.600) (-1113.063) (-1111.062) * (-1109.251) (-1110.396) (-1111.394) [-1109.538] -- 0:00:21 648000 -- [-1109.250] (-1112.619) (-1112.513) (-1108.994) * (-1109.552) (-1110.529) (-1112.730) [-1110.030] -- 0:00:21 648500 -- (-1110.489) (-1109.474) [-1110.797] (-1110.173) * [-1108.790] (-1110.471) (-1113.506) (-1110.950) -- 0:00:21 649000 -- (-1111.832) (-1110.229) (-1110.232) [-1108.554] * (-1110.588) (-1108.875) [-1111.206] (-1110.022) -- 0:00:21 649500 -- (-1110.785) (-1108.592) (-1111.061) [-1109.613] * (-1113.151) [-1108.896] (-1111.377) (-1110.529) -- 0:00:21 650000 -- (-1109.445) (-1108.834) (-1110.832) [-1110.724] * (-1111.325) (-1109.339) [-1109.034] (-1111.460) -- 0:00:21 Average standard deviation of split frequencies: 0.010100 650500 -- (-1109.055) (-1108.989) [-1109.142] (-1109.016) * [-1108.678] (-1110.201) (-1109.033) (-1111.158) -- 0:00:21 651000 -- (-1109.507) [-1109.461] (-1109.314) (-1110.205) * [-1113.321] (-1110.487) (-1108.988) (-1110.627) -- 0:00:21 651500 -- (-1114.273) (-1111.593) [-1110.299] (-1110.920) * (-1112.530) (-1108.800) [-1112.248] (-1109.982) -- 0:00:21 652000 -- (-1112.753) (-1110.052) (-1110.850) [-1114.046] * (-1114.163) (-1108.766) (-1109.638) [-1114.117] -- 0:00:21 652500 -- (-1111.963) (-1110.510) (-1110.281) [-1108.712] * (-1114.710) (-1111.392) [-1109.147] (-1113.667) -- 0:00:21 653000 -- (-1109.469) (-1112.994) [-1109.659] (-1109.368) * (-1120.003) (-1108.786) [-1110.507] (-1112.495) -- 0:00:21 653500 -- (-1110.181) (-1109.306) (-1110.723) [-1110.522] * (-1112.735) (-1109.048) (-1114.448) [-1110.898] -- 0:00:21 654000 -- (-1109.687) (-1110.478) (-1110.142) [-1110.110] * (-1109.160) (-1111.971) (-1112.228) [-1111.163] -- 0:00:21 654500 -- (-1112.919) (-1109.570) [-1110.093] (-1110.755) * (-1111.080) [-1110.943] (-1117.346) (-1111.261) -- 0:00:21 655000 -- [-1110.136] (-1110.960) (-1111.064) (-1111.165) * (-1111.816) (-1112.411) [-1110.553] (-1109.284) -- 0:00:21 Average standard deviation of split frequencies: 0.009891 655500 -- (-1109.963) (-1111.832) (-1108.568) [-1112.190] * (-1112.196) (-1110.221) (-1110.643) [-1109.100] -- 0:00:21 656000 -- (-1112.184) [-1108.780] (-1108.967) (-1109.044) * (-1113.910) [-1112.397] (-1111.674) (-1110.693) -- 0:00:20 656500 -- (-1111.298) [-1110.439] (-1109.858) (-1110.417) * [-1113.503] (-1110.056) (-1112.342) (-1111.446) -- 0:00:20 657000 -- (-1110.258) (-1109.046) [-1113.696] (-1111.764) * (-1110.757) (-1114.851) [-1114.467] (-1111.446) -- 0:00:20 657500 -- [-1109.787] (-1109.184) (-1111.487) (-1110.306) * [-1109.315] (-1110.300) (-1112.628) (-1108.988) -- 0:00:20 658000 -- (-1109.163) (-1109.596) (-1112.597) [-1111.734] * (-1110.368) [-1111.791] (-1111.516) (-1109.538) -- 0:00:20 658500 -- (-1110.222) (-1111.971) (-1110.783) [-1108.691] * (-1110.300) (-1113.955) (-1109.868) [-1111.358] -- 0:00:20 659000 -- (-1110.915) (-1112.476) (-1112.749) [-1109.022] * (-1112.326) [-1111.580] (-1109.389) (-1110.777) -- 0:00:20 659500 -- (-1111.403) (-1114.181) [-1109.727] (-1112.077) * (-1111.618) (-1110.727) [-1109.380] (-1111.509) -- 0:00:20 660000 -- (-1111.188) (-1110.879) (-1115.318) [-1110.684] * (-1110.277) [-1111.111] (-1110.273) (-1111.091) -- 0:00:20 Average standard deviation of split frequencies: 0.009947 660500 -- (-1115.215) (-1110.692) (-1113.809) [-1111.389] * (-1111.221) (-1112.533) [-1109.424] (-1110.812) -- 0:00:20 661000 -- [-1112.881] (-1115.998) (-1110.474) (-1110.811) * [-1109.553] (-1109.012) (-1110.457) (-1111.294) -- 0:00:20 661500 -- (-1112.020) (-1113.350) (-1111.888) [-1109.187] * [-1109.021] (-1109.013) (-1113.884) (-1110.827) -- 0:00:20 662000 -- (-1113.468) (-1113.770) (-1110.337) [-1109.636] * [-1109.546] (-1109.988) (-1109.754) (-1111.606) -- 0:00:20 662500 -- (-1110.293) [-1113.126] (-1113.551) (-1109.912) * [-1113.676] (-1109.864) (-1109.109) (-1112.693) -- 0:00:20 663000 -- (-1110.440) (-1113.453) [-1108.676] (-1110.521) * (-1114.356) (-1110.033) [-1112.599] (-1115.760) -- 0:00:20 663500 -- (-1110.456) (-1110.326) [-1109.321] (-1111.457) * (-1115.249) (-1111.609) [-1113.159] (-1111.334) -- 0:00:20 664000 -- (-1112.241) [-1110.696] (-1108.517) (-1112.464) * (-1112.835) [-1113.304] (-1113.942) (-1110.129) -- 0:00:20 664500 -- [-1109.173] (-1111.206) (-1109.383) (-1112.217) * [-1111.966] (-1110.425) (-1110.952) (-1112.261) -- 0:00:20 665000 -- (-1110.340) (-1109.689) [-1109.274] (-1108.851) * [-1108.818] (-1110.388) (-1109.335) (-1109.437) -- 0:00:20 Average standard deviation of split frequencies: 0.010409 665500 -- (-1108.611) (-1112.851) (-1110.219) [-1109.105] * (-1110.846) (-1112.420) [-1110.555] (-1112.483) -- 0:00:20 666000 -- [-1109.093] (-1108.830) (-1110.648) (-1109.070) * (-1114.315) (-1114.748) [-1111.308] (-1113.872) -- 0:00:20 666500 -- (-1111.427) (-1109.914) [-1111.504] (-1109.305) * (-1112.265) [-1111.320] (-1109.446) (-1108.761) -- 0:00:20 667000 -- (-1109.755) (-1110.833) [-1109.922] (-1108.647) * [-1108.871] (-1109.547) (-1109.815) (-1108.928) -- 0:00:20 667500 -- (-1110.121) [-1109.972] (-1111.346) (-1114.299) * [-1108.828] (-1111.736) (-1109.655) (-1111.247) -- 0:00:20 668000 -- [-1112.395] (-1110.745) (-1112.132) (-1113.854) * (-1108.635) (-1108.721) [-1109.927] (-1110.372) -- 0:00:20 668500 -- (-1114.961) [-1111.139] (-1110.611) (-1113.372) * (-1111.593) [-1113.665] (-1114.052) (-1110.486) -- 0:00:20 669000 -- [-1112.246] (-1110.146) (-1111.163) (-1110.848) * [-1110.281] (-1115.316) (-1113.044) (-1109.797) -- 0:00:20 669500 -- (-1112.011) (-1109.727) [-1113.545] (-1111.395) * (-1109.940) (-1112.258) (-1113.227) [-1110.116] -- 0:00:20 670000 -- (-1112.204) [-1111.201] (-1110.321) (-1114.437) * (-1109.808) [-1113.607] (-1109.599) (-1112.524) -- 0:00:20 Average standard deviation of split frequencies: 0.010856 670500 -- (-1113.959) (-1111.878) [-1112.066] (-1109.966) * [-1110.149] (-1112.061) (-1108.602) (-1110.494) -- 0:00:20 671000 -- [-1113.386] (-1113.363) (-1110.896) (-1111.237) * (-1111.364) (-1111.552) (-1108.686) [-1109.411] -- 0:00:20 671500 -- (-1110.042) (-1108.707) (-1109.917) [-1110.990] * (-1110.195) (-1110.252) (-1109.374) [-1113.421] -- 0:00:20 672000 -- (-1111.194) (-1108.990) [-1109.577] (-1110.133) * (-1109.065) (-1110.351) (-1111.698) [-1110.564] -- 0:00:20 672500 -- [-1110.538] (-1110.348) (-1111.845) (-1111.210) * (-1111.164) [-1109.633] (-1110.241) (-1112.475) -- 0:00:19 673000 -- (-1110.896) [-1111.533] (-1113.019) (-1110.611) * (-1109.688) [-1112.299] (-1114.128) (-1112.832) -- 0:00:19 673500 -- (-1110.807) [-1110.263] (-1109.908) (-1110.943) * [-1109.030] (-1109.147) (-1115.201) (-1110.576) -- 0:00:19 674000 -- (-1111.158) (-1108.614) (-1109.965) [-1111.095] * (-1109.333) (-1109.770) (-1109.970) [-1111.504] -- 0:00:19 674500 -- [-1110.518] (-1113.508) (-1109.854) (-1111.700) * (-1109.364) (-1114.311) [-1109.357] (-1112.914) -- 0:00:19 675000 -- [-1110.163] (-1111.735) (-1113.252) (-1113.496) * (-1109.781) (-1112.957) [-1109.458] (-1108.558) -- 0:00:19 Average standard deviation of split frequencies: 0.010419 675500 -- (-1109.140) (-1113.411) [-1109.224] (-1113.184) * [-1111.692] (-1109.948) (-1112.331) (-1110.663) -- 0:00:19 676000 -- [-1109.482] (-1111.007) (-1109.316) (-1110.801) * (-1113.176) [-1109.394] (-1110.993) (-1112.217) -- 0:00:19 676500 -- (-1109.313) (-1109.518) [-1111.093] (-1111.420) * (-1114.328) (-1111.451) (-1109.597) [-1110.077] -- 0:00:19 677000 -- (-1113.338) (-1108.895) (-1112.015) [-1112.007] * (-1110.897) (-1111.597) [-1109.308] (-1109.246) -- 0:00:19 677500 -- (-1112.562) (-1111.450) [-1109.073] (-1110.405) * (-1112.648) [-1113.663] (-1109.775) (-1109.394) -- 0:00:19 678000 -- [-1108.986] (-1113.112) (-1109.306) (-1110.312) * (-1110.039) [-1110.882] (-1110.301) (-1110.797) -- 0:00:19 678500 -- (-1109.631) [-1110.212] (-1111.643) (-1110.883) * (-1109.815) (-1110.001) [-1111.786] (-1109.534) -- 0:00:19 679000 -- [-1109.582] (-1108.998) (-1110.458) (-1109.098) * (-1113.895) (-1109.860) (-1111.245) [-1109.464] -- 0:00:19 679500 -- (-1109.519) (-1110.061) [-1109.231] (-1112.140) * (-1112.500) (-1113.622) [-1110.253] (-1115.303) -- 0:00:19 680000 -- (-1116.078) (-1111.315) [-1109.163] (-1113.013) * (-1111.007) [-1109.119] (-1110.368) (-1110.911) -- 0:00:19 Average standard deviation of split frequencies: 0.010144 680500 -- (-1110.708) (-1113.066) [-1111.507] (-1110.977) * (-1114.052) (-1109.955) (-1110.320) [-1109.162] -- 0:00:19 681000 -- (-1109.533) [-1109.157] (-1115.501) (-1110.124) * (-1109.187) (-1113.560) (-1110.748) [-1109.924] -- 0:00:19 681500 -- [-1108.823] (-1113.207) (-1110.262) (-1113.829) * (-1109.350) (-1113.474) (-1108.642) [-1111.344] -- 0:00:19 682000 -- (-1113.383) (-1110.728) [-1110.641] (-1110.236) * (-1111.132) [-1114.916] (-1111.419) (-1110.115) -- 0:00:19 682500 -- (-1112.679) [-1109.542] (-1112.276) (-1113.689) * [-1108.864] (-1114.035) (-1110.580) (-1109.206) -- 0:00:19 683000 -- (-1113.758) (-1110.302) [-1112.294] (-1110.815) * (-1111.070) (-1114.469) [-1109.425] (-1109.736) -- 0:00:19 683500 -- [-1113.438] (-1111.273) (-1110.646) (-1110.485) * (-1109.469) (-1110.681) [-1109.066] (-1110.565) -- 0:00:19 684000 -- (-1115.056) (-1110.665) [-1110.416] (-1110.212) * (-1109.757) (-1111.533) (-1108.877) [-1109.992] -- 0:00:19 684500 -- (-1116.245) (-1111.453) (-1109.733) [-1113.143] * (-1109.990) [-1108.642] (-1108.940) (-1113.741) -- 0:00:19 685000 -- (-1109.995) [-1109.253] (-1109.953) (-1111.278) * (-1113.152) (-1110.869) [-1108.746] (-1109.551) -- 0:00:19 Average standard deviation of split frequencies: 0.010766 685500 -- [-1109.251] (-1110.151) (-1110.660) (-1110.480) * [-1111.212] (-1111.325) (-1110.713) (-1113.554) -- 0:00:19 686000 -- (-1109.672) (-1113.520) (-1111.242) [-1111.513] * (-1112.827) (-1113.420) [-1113.885] (-1112.831) -- 0:00:19 686500 -- (-1111.819) (-1114.454) (-1111.265) [-1110.700] * (-1112.620) [-1109.758] (-1110.263) (-1111.500) -- 0:00:19 687000 -- [-1110.540] (-1110.992) (-1108.503) (-1112.564) * (-1112.530) (-1108.999) (-1108.778) [-1112.336] -- 0:00:19 687500 -- (-1109.454) [-1108.648] (-1108.706) (-1109.934) * [-1111.650] (-1111.255) (-1109.940) (-1113.257) -- 0:00:19 688000 -- (-1109.198) (-1114.073) (-1110.065) [-1109.138] * (-1110.032) (-1112.723) (-1109.639) [-1109.649] -- 0:00:19 688500 -- [-1110.712] (-1108.978) (-1109.567) (-1108.785) * (-1109.195) (-1110.921) (-1114.804) [-1110.371] -- 0:00:19 689000 -- (-1109.134) (-1116.296) [-1110.388] (-1110.223) * [-1109.378] (-1109.534) (-1111.223) (-1109.656) -- 0:00:18 689500 -- (-1110.120) [-1108.723] (-1111.233) (-1111.807) * (-1112.979) (-1112.900) (-1113.499) [-1111.095] -- 0:00:18 690000 -- (-1111.349) (-1112.393) (-1113.651) [-1109.472] * (-1110.932) (-1112.858) (-1109.879) [-1111.034] -- 0:00:18 Average standard deviation of split frequencies: 0.010390 690500 -- (-1110.082) [-1110.081] (-1114.917) (-1111.688) * (-1110.797) (-1110.027) [-1109.883] (-1110.752) -- 0:00:18 691000 -- [-1108.930] (-1113.524) (-1111.744) (-1108.652) * (-1110.067) [-1109.547] (-1110.290) (-1110.743) -- 0:00:18 691500 -- (-1109.530) [-1108.844] (-1111.785) (-1113.726) * (-1112.543) [-1112.934] (-1109.728) (-1110.091) -- 0:00:18 692000 -- (-1114.043) (-1110.479) [-1109.477] (-1110.117) * (-1112.266) (-1113.067) [-1112.109] (-1111.164) -- 0:00:18 692500 -- (-1116.881) [-1110.961] (-1111.468) (-1110.965) * (-1109.962) (-1109.475) (-1114.774) [-1111.155] -- 0:00:18 693000 -- (-1112.394) (-1108.547) (-1111.978) [-1112.205] * (-1111.472) [-1112.129] (-1111.478) (-1109.879) -- 0:00:18 693500 -- (-1112.204) (-1109.346) (-1111.913) [-1109.840] * [-1110.324] (-1112.253) (-1112.748) (-1114.134) -- 0:00:18 694000 -- (-1114.252) (-1109.983) (-1112.549) [-1109.869] * (-1110.756) (-1110.940) [-1111.301] (-1108.729) -- 0:00:18 694500 -- (-1115.234) (-1109.308) (-1112.670) [-1108.506] * (-1110.053) (-1109.552) (-1115.483) [-1108.816] -- 0:00:18 695000 -- [-1110.048] (-1112.055) (-1113.209) (-1110.572) * (-1111.252) [-1109.712] (-1109.740) (-1111.080) -- 0:00:18 Average standard deviation of split frequencies: 0.010461 695500 -- (-1112.326) (-1111.456) [-1113.059] (-1112.503) * (-1109.960) [-1110.793] (-1113.925) (-1111.161) -- 0:00:18 696000 -- (-1109.602) [-1110.409] (-1111.774) (-1115.029) * (-1110.793) [-1109.370] (-1112.664) (-1109.264) -- 0:00:18 696500 -- [-1110.522] (-1111.761) (-1110.104) (-1112.078) * (-1109.544) (-1111.826) [-1109.799] (-1110.597) -- 0:00:18 697000 -- [-1109.296] (-1112.471) (-1109.265) (-1110.344) * (-1110.530) [-1112.738] (-1110.692) (-1109.302) -- 0:00:18 697500 -- (-1110.817) (-1109.985) (-1109.836) [-1110.763] * (-1109.536) [-1110.471] (-1109.141) (-1110.070) -- 0:00:18 698000 -- [-1115.001] (-1110.921) (-1109.819) (-1111.967) * (-1113.894) (-1111.931) [-1108.430] (-1110.652) -- 0:00:18 698500 -- (-1110.379) (-1110.703) [-1115.618] (-1109.820) * (-1110.267) (-1109.317) (-1109.230) [-1111.197] -- 0:00:18 699000 -- [-1112.706] (-1110.721) (-1114.529) (-1111.578) * (-1112.022) (-1110.349) (-1110.938) [-1109.906] -- 0:00:18 699500 -- (-1111.303) [-1110.157] (-1113.502) (-1113.499) * [-1109.639] (-1111.408) (-1109.409) (-1111.599) -- 0:00:18 700000 -- (-1109.161) (-1109.936) [-1109.531] (-1113.610) * (-1112.188) [-1112.549] (-1110.613) (-1111.271) -- 0:00:18 Average standard deviation of split frequencies: 0.010615 700500 -- (-1110.809) [-1110.339] (-1108.661) (-1109.615) * (-1111.806) (-1109.144) (-1109.289) [-1111.066] -- 0:00:18 701000 -- (-1109.802) (-1110.011) (-1110.133) [-1108.611] * (-1108.925) (-1109.238) [-1109.442] (-1112.433) -- 0:00:18 701500 -- [-1111.338] (-1108.495) (-1110.178) (-1109.455) * (-1110.084) (-1108.968) (-1109.889) [-1110.771] -- 0:00:18 702000 -- (-1109.040) (-1110.092) (-1109.436) [-1112.997] * (-1111.584) (-1109.438) [-1113.000] (-1110.900) -- 0:00:18 702500 -- (-1113.160) [-1110.659] (-1109.577) (-1111.902) * [-1110.073] (-1109.906) (-1113.389) (-1110.635) -- 0:00:18 703000 -- (-1111.892) [-1111.621] (-1110.472) (-1109.236) * (-1111.287) (-1112.333) [-1109.613] (-1110.262) -- 0:00:18 703500 -- (-1113.099) (-1110.458) (-1112.834) [-1109.117] * (-1109.291) [-1109.649] (-1109.447) (-1110.542) -- 0:00:18 704000 -- [-1111.391] (-1110.283) (-1111.060) (-1112.544) * (-1108.923) (-1113.443) (-1109.658) [-1112.185] -- 0:00:18 704500 -- (-1112.691) (-1110.181) [-1108.905] (-1114.242) * (-1109.227) [-1109.419] (-1117.409) (-1110.141) -- 0:00:18 705000 -- (-1112.188) (-1110.612) [-1110.073] (-1112.837) * (-1114.106) (-1111.515) (-1109.192) [-1111.266] -- 0:00:17 Average standard deviation of split frequencies: 0.010312 705500 -- (-1113.316) (-1113.185) [-1114.703] (-1109.832) * (-1111.747) (-1110.669) (-1109.111) [-1113.234] -- 0:00:17 706000 -- (-1109.899) (-1109.477) [-1110.362] (-1109.009) * [-1110.372] (-1112.069) (-1110.171) (-1114.122) -- 0:00:17 706500 -- (-1109.868) [-1109.821] (-1110.187) (-1110.252) * (-1115.051) [-1112.533] (-1110.240) (-1111.116) -- 0:00:17 707000 -- (-1109.697) [-1111.262] (-1111.363) (-1112.516) * (-1110.113) (-1112.089) (-1109.287) [-1111.548] -- 0:00:17 707500 -- (-1110.389) [-1110.477] (-1108.854) (-1111.986) * (-1112.920) (-1108.750) [-1110.252] (-1110.242) -- 0:00:17 708000 -- (-1112.998) (-1112.215) [-1110.594] (-1111.320) * [-1110.196] (-1109.645) (-1109.110) (-1114.673) -- 0:00:17 708500 -- (-1114.185) (-1113.440) (-1112.908) [-1112.041] * (-1117.122) (-1111.212) [-1111.060] (-1109.425) -- 0:00:17 709000 -- (-1110.267) [-1109.263] (-1110.003) (-1110.927) * [-1113.846] (-1110.197) (-1115.300) (-1110.657) -- 0:00:17 709500 -- [-1110.751] (-1109.125) (-1111.747) (-1111.458) * [-1111.327] (-1112.112) (-1112.616) (-1110.377) -- 0:00:17 710000 -- (-1114.443) (-1109.348) (-1108.638) [-1109.955] * (-1113.350) [-1109.607] (-1111.245) (-1110.436) -- 0:00:17 Average standard deviation of split frequencies: 0.009839 710500 -- (-1113.743) (-1111.671) [-1111.678] (-1111.160) * (-1110.570) [-1108.872] (-1114.537) (-1112.274) -- 0:00:17 711000 -- (-1110.391) [-1111.951] (-1111.849) (-1112.477) * (-1112.837) (-1110.009) (-1112.689) [-1110.521] -- 0:00:17 711500 -- [-1113.099] (-1109.867) (-1110.500) (-1110.489) * (-1113.941) (-1110.283) [-1110.665] (-1111.833) -- 0:00:17 712000 -- (-1112.488) [-1110.768] (-1114.560) (-1111.179) * (-1115.168) [-1108.507] (-1111.951) (-1110.936) -- 0:00:17 712500 -- [-1111.280] (-1111.080) (-1109.887) (-1113.033) * (-1109.207) (-1112.092) (-1112.317) [-1110.999] -- 0:00:17 713000 -- (-1109.907) [-1111.160] (-1112.415) (-1109.932) * [-1112.634] (-1111.234) (-1110.819) (-1110.748) -- 0:00:17 713500 -- (-1111.511) (-1113.229) [-1110.616] (-1109.659) * (-1112.123) (-1111.967) [-1109.240] (-1111.564) -- 0:00:17 714000 -- (-1111.620) [-1112.098] (-1109.804) (-1109.779) * (-1110.601) (-1110.745) [-1113.706] (-1110.611) -- 0:00:17 714500 -- (-1109.957) (-1109.329) [-1108.594] (-1109.002) * [-1112.237] (-1111.336) (-1110.020) (-1112.559) -- 0:00:17 715000 -- (-1111.925) (-1110.897) (-1111.536) [-1113.776] * (-1110.043) [-1112.500] (-1112.903) (-1109.500) -- 0:00:17 Average standard deviation of split frequencies: 0.008724 715500 -- [-1115.215] (-1114.173) (-1112.964) (-1109.902) * [-1108.321] (-1109.749) (-1117.613) (-1109.139) -- 0:00:17 716000 -- (-1109.821) [-1109.684] (-1110.569) (-1112.025) * [-1109.715] (-1110.888) (-1111.297) (-1108.960) -- 0:00:17 716500 -- (-1111.517) (-1109.727) [-1111.004] (-1114.033) * (-1109.860) (-1110.001) [-1110.785] (-1108.960) -- 0:00:17 717000 -- (-1110.780) [-1109.210] (-1111.574) (-1111.579) * (-1111.374) [-1113.052] (-1110.582) (-1110.174) -- 0:00:17 717500 -- (-1110.181) (-1111.693) [-1110.582] (-1113.064) * (-1111.111) (-1109.841) [-1116.994] (-1113.180) -- 0:00:17 718000 -- (-1108.993) (-1111.608) [-1109.209] (-1110.637) * [-1110.224] (-1116.058) (-1112.029) (-1112.220) -- 0:00:17 718500 -- [-1109.869] (-1109.148) (-1112.437) (-1109.721) * [-1109.804] (-1108.549) (-1111.400) (-1113.723) -- 0:00:17 719000 -- [-1110.181] (-1109.403) (-1111.257) (-1109.808) * (-1110.352) (-1112.079) [-1110.962] (-1111.123) -- 0:00:17 719500 -- [-1109.163] (-1110.301) (-1110.007) (-1110.022) * (-1111.849) (-1113.466) (-1109.919) [-1109.899] -- 0:00:17 720000 -- (-1108.837) (-1111.322) [-1113.332] (-1110.234) * (-1113.795) (-1111.057) [-1109.934] (-1110.129) -- 0:00:17 Average standard deviation of split frequencies: 0.008460 720500 -- (-1110.388) (-1109.401) [-1109.294] (-1109.981) * (-1110.122) (-1108.859) [-1110.824] (-1109.916) -- 0:00:17 721000 -- (-1111.966) [-1111.537] (-1110.033) (-1109.982) * (-1117.248) (-1111.253) [-1110.837] (-1109.049) -- 0:00:17 721500 -- (-1110.303) (-1109.627) [-1110.806] (-1110.035) * (-1110.347) (-1112.210) (-1109.024) [-1109.660] -- 0:00:16 722000 -- (-1109.862) (-1109.129) (-1109.866) [-1111.239] * (-1114.417) (-1112.574) (-1110.232) [-1108.937] -- 0:00:16 722500 -- (-1110.252) (-1111.109) [-1111.813] (-1112.684) * (-1111.213) (-1108.988) [-1108.683] (-1111.226) -- 0:00:16 723000 -- (-1112.140) [-1109.752] (-1110.289) (-1114.560) * [-1110.451] (-1110.304) (-1111.184) (-1110.305) -- 0:00:16 723500 -- (-1111.246) (-1111.335) (-1111.088) [-1110.562] * (-1110.257) (-1111.639) [-1112.134] (-1111.859) -- 0:00:16 724000 -- (-1109.508) (-1110.733) [-1109.474] (-1108.612) * (-1113.303) (-1108.689) (-1112.060) [-1111.398] -- 0:00:16 724500 -- [-1109.268] (-1109.675) (-1115.254) (-1108.454) * (-1111.235) [-1109.505] (-1113.936) (-1113.996) -- 0:00:16 725000 -- [-1111.921] (-1111.004) (-1110.730) (-1111.054) * (-1110.465) (-1109.419) [-1110.002] (-1111.099) -- 0:00:16 Average standard deviation of split frequencies: 0.008319 725500 -- [-1113.249] (-1108.755) (-1111.862) (-1110.345) * (-1110.221) (-1110.639) (-1109.159) [-1112.350] -- 0:00:16 726000 -- (-1108.656) (-1109.092) [-1110.047] (-1111.861) * (-1109.876) [-1110.753] (-1111.096) (-1111.308) -- 0:00:16 726500 -- (-1109.078) [-1111.046] (-1110.056) (-1109.719) * (-1111.356) (-1110.084) [-1111.360] (-1111.705) -- 0:00:16 727000 -- (-1108.666) [-1111.019] (-1111.562) (-1111.169) * (-1112.287) (-1112.184) (-1113.097) [-1110.798] -- 0:00:16 727500 -- (-1111.238) (-1113.029) (-1108.722) [-1110.223] * (-1112.240) (-1111.851) [-1109.355] (-1109.295) -- 0:00:16 728000 -- (-1111.384) [-1112.062] (-1110.287) (-1109.150) * (-1110.583) (-1110.285) (-1111.932) [-1111.930] -- 0:00:16 728500 -- [-1109.738] (-1111.238) (-1111.100) (-1109.243) * (-1110.310) (-1114.898) [-1112.878] (-1110.378) -- 0:00:16 729000 -- (-1110.325) (-1110.916) [-1111.309] (-1109.587) * (-1111.017) [-1114.367] (-1112.134) (-1118.368) -- 0:00:16 729500 -- [-1108.931] (-1109.838) (-1110.613) (-1113.117) * (-1110.242) [-1111.552] (-1114.432) (-1110.118) -- 0:00:16 730000 -- (-1111.143) (-1111.408) (-1110.265) [-1110.305] * [-1109.355] (-1110.985) (-1110.441) (-1111.962) -- 0:00:16 Average standard deviation of split frequencies: 0.008468 730500 -- (-1110.452) (-1109.825) [-1109.870] (-1111.554) * (-1110.522) (-1109.734) (-1109.640) [-1110.517] -- 0:00:16 731000 -- (-1109.609) (-1112.917) [-1110.586] (-1115.776) * (-1113.146) (-1110.955) (-1110.501) [-1108.735] -- 0:00:16 731500 -- (-1110.133) (-1111.402) (-1111.382) [-1113.935] * (-1110.486) (-1111.412) [-1113.921] (-1112.420) -- 0:00:16 732000 -- [-1109.444] (-1113.377) (-1112.455) (-1111.702) * [-1109.358] (-1110.798) (-1110.134) (-1113.985) -- 0:00:16 732500 -- (-1110.216) (-1113.469) [-1111.150] (-1110.876) * [-1109.831] (-1110.056) (-1109.266) (-1110.779) -- 0:00:16 733000 -- (-1110.512) [-1109.805] (-1110.131) (-1111.513) * (-1110.385) (-1114.128) [-1109.465] (-1108.892) -- 0:00:16 733500 -- (-1111.565) (-1110.143) (-1110.240) [-1109.481] * (-1108.857) (-1112.634) (-1109.580) [-1109.900] -- 0:00:16 734000 -- [-1113.803] (-1111.240) (-1112.002) (-1112.778) * (-1111.223) [-1111.384] (-1110.485) (-1110.409) -- 0:00:16 734500 -- (-1111.558) (-1111.539) (-1110.744) [-1110.436] * [-1109.155] (-1109.953) (-1109.167) (-1110.246) -- 0:00:16 735000 -- [-1111.356] (-1110.911) (-1111.903) (-1112.535) * [-1111.017] (-1113.223) (-1111.536) (-1111.420) -- 0:00:16 Average standard deviation of split frequencies: 0.008369 735500 -- [-1111.969] (-1113.100) (-1109.686) (-1112.083) * (-1112.514) (-1111.263) (-1111.578) [-1109.324] -- 0:00:16 736000 -- (-1110.456) (-1111.339) (-1110.743) [-1113.616] * (-1112.311) [-1110.240] (-1109.142) (-1110.359) -- 0:00:16 736500 -- (-1113.575) [-1110.033] (-1112.335) (-1110.957) * (-1109.259) [-1109.707] (-1110.476) (-1118.538) -- 0:00:16 737000 -- (-1119.673) (-1111.387) (-1112.791) [-1110.139] * [-1110.231] (-1109.194) (-1114.794) (-1110.095) -- 0:00:16 737500 -- (-1111.977) (-1109.798) [-1108.596] (-1115.649) * (-1109.829) (-1111.000) (-1117.189) [-1111.843] -- 0:00:16 738000 -- (-1111.885) [-1110.019] (-1110.512) (-1113.287) * (-1109.780) [-1111.830] (-1111.550) (-1112.733) -- 0:00:15 738500 -- (-1113.194) [-1113.070] (-1112.496) (-1112.994) * (-1109.688) (-1113.862) (-1111.921) [-1109.219] -- 0:00:15 739000 -- (-1110.865) (-1110.980) (-1108.703) [-1112.158] * [-1110.005] (-1109.922) (-1109.235) (-1112.656) -- 0:00:15 739500 -- [-1109.347] (-1111.337) (-1111.636) (-1113.726) * (-1110.439) (-1110.983) [-1111.754] (-1112.573) -- 0:00:15 740000 -- (-1111.960) (-1109.374) (-1111.764) [-1111.974] * (-1109.883) [-1110.394] (-1114.193) (-1112.599) -- 0:00:15 Average standard deviation of split frequencies: 0.008868 740500 -- (-1111.453) [-1108.587] (-1109.352) (-1112.072) * (-1108.898) (-1108.451) [-1109.812] (-1111.739) -- 0:00:15 741000 -- (-1109.053) (-1112.235) [-1109.458] (-1110.415) * [-1110.120] (-1108.453) (-1111.617) (-1108.407) -- 0:00:15 741500 -- (-1109.986) (-1112.189) (-1109.579) [-1109.465] * (-1109.415) (-1108.419) [-1110.689] (-1111.740) -- 0:00:15 742000 -- (-1110.184) [-1109.034] (-1110.944) (-1110.623) * [-1116.210] (-1109.949) (-1111.282) (-1109.793) -- 0:00:15 742500 -- [-1109.898] (-1112.613) (-1109.205) (-1111.083) * (-1110.872) (-1110.495) [-1109.991] (-1110.358) -- 0:00:15 743000 -- (-1110.735) (-1112.624) (-1108.636) [-1111.610] * [-1109.742] (-1110.759) (-1115.359) (-1110.736) -- 0:00:15 743500 -- (-1119.605) [-1109.463] (-1110.595) (-1109.287) * (-1112.929) (-1109.415) [-1109.268] (-1109.350) -- 0:00:15 744000 -- (-1110.429) [-1110.215] (-1109.969) (-1108.689) * (-1114.095) (-1110.560) (-1109.428) [-1111.658] -- 0:00:15 744500 -- (-1109.327) [-1111.573] (-1108.957) (-1110.352) * [-1110.610] (-1109.724) (-1108.835) (-1113.045) -- 0:00:15 745000 -- [-1110.475] (-1114.161) (-1110.684) (-1113.821) * (-1111.325) (-1110.322) (-1110.342) [-1110.821] -- 0:00:15 Average standard deviation of split frequencies: 0.009084 745500 -- (-1115.041) (-1111.445) (-1109.963) [-1108.840] * [-1110.521] (-1113.056) (-1110.550) (-1109.081) -- 0:00:15 746000 -- [-1110.729] (-1110.143) (-1111.668) (-1113.233) * (-1111.870) (-1112.320) (-1110.030) [-1111.876] -- 0:00:15 746500 -- (-1108.774) [-1110.754] (-1112.635) (-1111.357) * (-1109.519) (-1112.611) (-1110.903) [-1110.746] -- 0:00:15 747000 -- (-1109.873) [-1109.352] (-1111.866) (-1110.752) * [-1112.523] (-1113.359) (-1108.602) (-1109.139) -- 0:00:15 747500 -- (-1113.858) [-1109.556] (-1110.658) (-1110.157) * (-1117.079) (-1113.807) [-1111.613] (-1111.594) -- 0:00:15 748000 -- [-1112.376] (-1109.263) (-1112.629) (-1109.370) * (-1110.639) (-1113.035) (-1111.824) [-1111.981] -- 0:00:15 748500 -- (-1110.431) (-1112.188) (-1109.479) [-1109.382] * (-1110.991) (-1110.943) [-1112.851] (-1108.694) -- 0:00:15 749000 -- (-1110.972) (-1109.817) [-1112.285] (-1110.898) * (-1113.475) [-1110.431] (-1109.442) (-1110.733) -- 0:00:15 749500 -- (-1110.124) (-1112.939) (-1111.161) [-1110.167] * (-1108.580) (-1112.746) [-1111.522] (-1110.052) -- 0:00:15 750000 -- (-1112.647) (-1111.425) [-1110.015] (-1109.623) * (-1110.557) (-1109.014) [-1111.862] (-1108.955) -- 0:00:15 Average standard deviation of split frequencies: 0.009302 750500 -- (-1109.767) [-1110.119] (-1110.067) (-1111.690) * (-1111.976) (-1111.163) [-1110.444] (-1109.081) -- 0:00:15 751000 -- [-1111.555] (-1113.171) (-1111.114) (-1112.689) * (-1108.543) (-1116.169) (-1111.065) [-1108.988] -- 0:00:15 751500 -- (-1111.763) [-1109.331] (-1113.978) (-1109.156) * (-1109.544) (-1112.195) (-1109.519) [-1108.914] -- 0:00:15 752000 -- [-1111.659] (-1110.282) (-1118.473) (-1110.088) * (-1112.580) [-1111.296] (-1110.936) (-1109.590) -- 0:00:15 752500 -- (-1108.646) (-1110.746) [-1109.010] (-1109.401) * (-1112.601) (-1109.153) [-1109.845] (-1109.495) -- 0:00:15 753000 -- (-1108.626) (-1110.531) [-1108.960] (-1109.256) * (-1112.899) (-1113.835) (-1108.768) [-1110.232] -- 0:00:15 753500 -- (-1108.374) [-1110.255] (-1113.914) (-1109.450) * (-1110.596) (-1111.564) [-1109.531] (-1110.386) -- 0:00:15 754000 -- (-1110.203) (-1109.808) [-1111.613] (-1109.209) * (-1111.246) (-1109.753) (-1110.269) [-1109.132] -- 0:00:15 754500 -- (-1109.916) (-1113.745) [-1110.648] (-1108.463) * (-1110.136) (-1111.161) (-1112.380) [-1111.517] -- 0:00:14 755000 -- (-1109.168) (-1112.337) [-1111.248] (-1109.869) * (-1114.056) [-1110.686] (-1112.417) (-1109.023) -- 0:00:14 Average standard deviation of split frequencies: 0.008730 755500 -- (-1108.998) [-1111.397] (-1109.800) (-1113.492) * (-1110.670) [-1116.412] (-1112.819) (-1108.886) -- 0:00:14 756000 -- (-1110.601) (-1113.855) [-1108.644] (-1112.581) * (-1109.296) (-1111.503) [-1109.085] (-1109.317) -- 0:00:14 756500 -- (-1109.359) (-1113.901) [-1110.744] (-1112.780) * (-1110.321) [-1110.092] (-1108.670) (-1109.226) -- 0:00:14 757000 -- [-1109.763] (-1110.865) (-1109.875) (-1114.433) * (-1111.595) [-1112.222] (-1113.102) (-1112.409) -- 0:00:14 757500 -- (-1111.939) [-1110.718] (-1109.131) (-1113.082) * (-1109.283) [-1112.149] (-1111.110) (-1110.482) -- 0:00:14 758000 -- (-1108.986) [-1113.250] (-1110.990) (-1110.106) * (-1113.037) (-1112.137) (-1111.347) [-1113.228] -- 0:00:14 758500 -- (-1109.455) (-1108.909) [-1109.470] (-1113.699) * (-1117.369) (-1108.707) (-1108.979) [-1109.729] -- 0:00:14 759000 -- (-1109.507) [-1108.784] (-1109.819) (-1112.203) * (-1111.032) (-1108.635) (-1112.875) [-1109.889] -- 0:00:14 759500 -- (-1109.571) (-1112.103) (-1109.330) [-1109.800] * (-1111.766) [-1109.773] (-1111.680) (-1115.288) -- 0:00:14 760000 -- (-1112.142) (-1110.417) (-1109.806) [-1110.314] * (-1109.674) (-1109.851) (-1113.037) [-1114.736] -- 0:00:14 Average standard deviation of split frequencies: 0.008831 760500 -- [-1109.707] (-1110.297) (-1113.980) (-1110.320) * (-1110.960) (-1113.399) [-1114.692] (-1110.407) -- 0:00:14 761000 -- (-1109.742) (-1111.938) (-1110.655) [-1110.870] * (-1110.806) (-1108.811) (-1113.065) [-1111.070] -- 0:00:14 761500 -- (-1111.265) (-1110.444) [-1109.769] (-1109.564) * [-1109.330] (-1110.542) (-1110.211) (-1110.481) -- 0:00:14 762000 -- (-1108.717) (-1113.913) (-1109.208) [-1111.923] * (-1109.408) (-1109.635) [-1109.000] (-1110.902) -- 0:00:14 762500 -- (-1108.513) (-1111.033) [-1110.741] (-1114.269) * [-1109.988] (-1110.613) (-1110.932) (-1110.311) -- 0:00:14 763000 -- [-1108.659] (-1113.205) (-1112.593) (-1110.797) * (-1112.277) (-1112.731) [-1111.540] (-1108.725) -- 0:00:14 763500 -- (-1110.474) (-1110.030) (-1111.509) [-1114.141] * (-1109.853) (-1112.769) [-1110.120] (-1108.473) -- 0:00:14 764000 -- [-1111.977] (-1114.821) (-1109.442) (-1111.613) * (-1110.542) [-1111.397] (-1108.949) (-1108.476) -- 0:00:14 764500 -- (-1109.218) (-1108.974) (-1110.561) [-1110.828] * [-1110.579] (-1113.456) (-1109.532) (-1109.492) -- 0:00:14 765000 -- [-1110.789] (-1108.535) (-1114.086) (-1109.408) * (-1112.288) [-1108.885] (-1113.115) (-1110.202) -- 0:00:14 Average standard deviation of split frequencies: 0.008731 765500 -- (-1113.214) (-1111.369) (-1110.027) [-1110.664] * (-1110.586) [-1111.502] (-1112.833) (-1111.389) -- 0:00:14 766000 -- (-1113.082) [-1113.036] (-1113.229) (-1111.878) * (-1110.105) [-1111.796] (-1110.554) (-1114.973) -- 0:00:14 766500 -- (-1112.672) [-1109.107] (-1110.210) (-1110.522) * (-1109.892) [-1112.006] (-1112.078) (-1109.603) -- 0:00:14 767000 -- (-1110.480) (-1110.850) [-1109.995] (-1109.656) * [-1110.897] (-1118.445) (-1110.803) (-1110.826) -- 0:00:14 767500 -- (-1110.017) [-1108.337] (-1110.421) (-1111.735) * [-1109.798] (-1111.107) (-1110.400) (-1114.789) -- 0:00:14 768000 -- [-1109.386] (-1110.745) (-1110.656) (-1109.345) * [-1109.139] (-1113.245) (-1109.570) (-1113.256) -- 0:00:14 768500 -- (-1110.536) (-1109.212) (-1110.697) [-1111.078] * [-1110.470] (-1110.208) (-1110.088) (-1111.324) -- 0:00:14 769000 -- [-1109.267] (-1109.673) (-1109.265) (-1109.316) * (-1109.970) (-1108.566) (-1109.705) [-1110.273] -- 0:00:14 769500 -- (-1110.650) (-1108.536) [-1113.261] (-1112.458) * (-1108.941) (-1109.586) (-1110.626) [-1110.975] -- 0:00:14 770000 -- [-1109.338] (-1110.734) (-1110.476) (-1113.741) * (-1111.224) [-1113.066] (-1110.035) (-1109.816) -- 0:00:14 Average standard deviation of split frequencies: 0.008946 770500 -- [-1110.238] (-1108.599) (-1110.120) (-1111.075) * (-1110.860) (-1112.197) [-1110.545] (-1110.619) -- 0:00:13 771000 -- (-1113.754) (-1108.640) (-1111.323) [-1112.491] * [-1110.583] (-1109.508) (-1110.028) (-1114.154) -- 0:00:13 771500 -- (-1111.096) (-1109.944) (-1110.187) [-1111.383] * (-1110.578) [-1109.159] (-1108.874) (-1111.950) -- 0:00:13 772000 -- (-1110.072) (-1108.395) [-1110.870] (-1110.180) * (-1113.657) [-1108.775] (-1110.878) (-1112.807) -- 0:00:13 772500 -- (-1110.744) (-1114.818) [-1110.638] (-1110.215) * [-1112.278] (-1113.831) (-1113.462) (-1113.649) -- 0:00:13 773000 -- (-1110.525) (-1111.942) (-1109.793) [-1109.911] * (-1111.403) (-1109.803) [-1109.077] (-1110.249) -- 0:00:13 773500 -- (-1109.550) (-1111.151) [-1109.378] (-1109.852) * (-1109.786) (-1111.620) [-1108.794] (-1115.366) -- 0:00:13 774000 -- (-1110.207) (-1111.126) (-1111.167) [-1110.801] * (-1109.707) (-1113.884) (-1109.261) [-1109.985] -- 0:00:13 774500 -- (-1111.482) (-1109.772) [-1113.329] (-1110.912) * (-1108.937) (-1119.001) [-1112.850] (-1112.446) -- 0:00:13 775000 -- [-1109.897] (-1109.236) (-1109.866) (-1110.738) * [-1109.617] (-1118.132) (-1111.572) (-1111.336) -- 0:00:13 Average standard deviation of split frequencies: 0.008869 775500 -- (-1111.791) (-1109.548) (-1110.697) [-1110.045] * [-1108.620] (-1111.402) (-1112.034) (-1111.403) -- 0:00:13 776000 -- (-1109.512) (-1110.031) (-1108.653) [-1111.442] * (-1109.106) [-1109.635] (-1111.043) (-1113.403) -- 0:00:13 776500 -- (-1113.294) (-1109.423) [-1110.032] (-1109.021) * (-1110.600) [-1109.012] (-1113.808) (-1110.267) -- 0:00:13 777000 -- [-1111.544] (-1110.384) (-1110.208) (-1110.482) * (-1108.375) (-1108.706) (-1111.933) [-1109.233] -- 0:00:13 777500 -- (-1110.831) (-1109.936) (-1113.845) [-1109.355] * (-1110.474) [-1109.429] (-1111.516) (-1111.406) -- 0:00:13 778000 -- (-1110.528) (-1109.170) [-1111.551] (-1108.948) * [-1110.143] (-1114.245) (-1111.011) (-1114.085) -- 0:00:13 778500 -- (-1109.975) [-1109.486] (-1112.445) (-1108.679) * (-1113.349) (-1109.199) (-1112.040) [-1110.790] -- 0:00:13 779000 -- (-1112.188) [-1111.443] (-1109.370) (-1108.714) * (-1110.346) (-1112.313) (-1116.839) [-1111.265] -- 0:00:13 779500 -- (-1110.107) (-1111.521) (-1110.152) [-1110.207] * [-1111.715] (-1111.667) (-1120.382) (-1115.449) -- 0:00:13 780000 -- (-1110.856) (-1112.746) [-1110.918] (-1109.682) * (-1117.655) (-1110.778) [-1110.862] (-1113.696) -- 0:00:13 Average standard deviation of split frequencies: 0.009586 780500 -- (-1109.942) (-1110.700) (-1111.633) [-1109.884] * (-1112.704) (-1110.868) (-1109.630) [-1109.557] -- 0:00:13 781000 -- (-1111.556) (-1109.726) [-1111.056] (-1110.233) * (-1110.746) (-1113.790) (-1113.544) [-1109.074] -- 0:00:13 781500 -- (-1112.015) (-1109.713) [-1111.276] (-1109.392) * (-1112.450) (-1111.924) [-1112.316] (-1109.036) -- 0:00:13 782000 -- (-1110.988) (-1110.276) [-1109.163] (-1111.372) * (-1109.809) [-1109.960] (-1113.725) (-1109.622) -- 0:00:13 782500 -- (-1108.823) (-1109.224) (-1108.391) [-1109.140] * (-1112.302) (-1108.999) [-1112.323] (-1109.524) -- 0:00:13 783000 -- (-1109.505) [-1111.752] (-1108.966) (-1109.947) * [-1114.564] (-1109.903) (-1110.768) (-1109.702) -- 0:00:13 783500 -- (-1111.531) (-1116.802) (-1109.466) [-1113.804] * (-1112.312) (-1111.120) (-1111.049) [-1108.547] -- 0:00:13 784000 -- (-1109.599) (-1109.220) [-1110.297] (-1112.284) * (-1109.433) (-1110.507) (-1109.884) [-1108.856] -- 0:00:13 784500 -- (-1110.558) [-1111.677] (-1111.314) (-1109.272) * [-1108.904] (-1109.744) (-1108.502) (-1109.703) -- 0:00:13 785000 -- (-1112.045) (-1113.062) [-1109.828] (-1116.376) * (-1112.908) (-1110.604) [-1108.968] (-1109.017) -- 0:00:13 Average standard deviation of split frequencies: 0.009109 785500 -- (-1110.557) (-1110.098) (-1110.330) [-1109.721] * [-1110.538] (-1108.999) (-1108.742) (-1108.692) -- 0:00:13 786000 -- [-1110.600] (-1108.937) (-1109.254) (-1109.784) * (-1110.065) (-1108.940) [-1108.716] (-1110.107) -- 0:00:13 786500 -- [-1108.990] (-1109.843) (-1109.816) (-1112.563) * (-1110.491) [-1108.674] (-1108.518) (-1109.210) -- 0:00:13 787000 -- (-1109.391) (-1111.646) (-1112.637) [-1110.888] * (-1113.304) [-1108.466] (-1109.887) (-1110.721) -- 0:00:12 787500 -- (-1110.584) (-1109.149) [-1111.493] (-1109.808) * (-1115.575) [-1109.403] (-1110.945) (-1110.136) -- 0:00:12 788000 -- (-1111.603) [-1108.886] (-1116.647) (-1109.635) * [-1113.840] (-1109.316) (-1110.013) (-1108.727) -- 0:00:12 788500 -- (-1109.470) (-1109.101) (-1109.522) [-1110.728] * (-1110.283) (-1110.605) (-1115.010) [-1110.036] -- 0:00:12 789000 -- (-1109.246) [-1109.150] (-1108.909) (-1110.475) * (-1110.307) [-1111.141] (-1111.344) (-1109.854) -- 0:00:12 789500 -- [-1114.549] (-1114.474) (-1110.471) (-1113.194) * (-1109.071) (-1116.907) (-1112.050) [-1109.919] -- 0:00:12 790000 -- (-1109.995) (-1108.940) [-1113.628] (-1109.641) * (-1110.304) (-1114.281) (-1109.561) [-1109.702] -- 0:00:12 Average standard deviation of split frequencies: 0.008608 790500 -- (-1110.975) (-1109.551) (-1110.559) [-1109.514] * [-1109.111] (-1109.891) (-1108.640) (-1110.880) -- 0:00:12 791000 -- (-1113.187) (-1110.450) (-1110.613) [-1111.523] * (-1109.701) (-1110.167) [-1108.887] (-1110.115) -- 0:00:12 791500 -- (-1109.667) (-1110.116) [-1108.634] (-1111.541) * (-1109.021) (-1110.472) [-1111.259] (-1114.390) -- 0:00:12 792000 -- [-1115.022] (-1110.016) (-1113.552) (-1112.957) * (-1111.575) (-1109.909) (-1110.698) [-1111.702] -- 0:00:12 792500 -- (-1114.452) [-1111.353] (-1110.456) (-1108.448) * (-1115.970) [-1110.519] (-1109.681) (-1109.393) -- 0:00:12 793000 -- (-1109.772) [-1109.322] (-1114.013) (-1111.287) * (-1113.252) (-1110.125) [-1110.175] (-1109.790) -- 0:00:12 793500 -- (-1113.130) [-1108.970] (-1110.087) (-1113.675) * [-1111.927] (-1109.637) (-1111.394) (-1109.041) -- 0:00:12 794000 -- (-1112.736) (-1112.295) [-1111.456] (-1115.934) * [-1113.000] (-1109.446) (-1110.377) (-1111.188) -- 0:00:12 794500 -- (-1111.685) [-1109.787] (-1108.479) (-1113.837) * (-1111.177) (-1110.647) (-1112.359) [-1112.181] -- 0:00:12 795000 -- (-1112.501) (-1111.283) [-1108.987] (-1108.932) * (-1111.527) (-1111.213) (-1114.259) [-1113.468] -- 0:00:12 Average standard deviation of split frequencies: 0.008439 795500 -- (-1112.350) (-1112.156) (-1111.285) [-1109.760] * (-1109.767) (-1108.425) (-1112.855) [-1110.517] -- 0:00:12 796000 -- (-1109.459) (-1112.312) [-1114.366] (-1110.667) * (-1110.852) (-1108.545) [-1110.138] (-1110.181) -- 0:00:12 796500 -- (-1110.246) (-1111.370) [-1109.846] (-1114.567) * [-1108.896] (-1111.110) (-1109.811) (-1110.009) -- 0:00:12 797000 -- (-1109.186) [-1109.250] (-1110.904) (-1113.519) * (-1110.847) (-1110.930) (-1110.788) [-1110.532] -- 0:00:12 797500 -- (-1108.966) (-1109.724) [-1112.480] (-1108.897) * [-1109.477] (-1111.064) (-1109.447) (-1115.297) -- 0:00:12 798000 -- (-1111.583) (-1116.172) [-1109.887] (-1116.417) * (-1110.044) (-1109.848) [-1109.284] (-1110.120) -- 0:00:12 798500 -- [-1113.467] (-1113.600) (-1109.913) (-1112.497) * (-1109.817) (-1109.843) [-1109.762] (-1114.592) -- 0:00:12 799000 -- [-1112.495] (-1112.641) (-1110.926) (-1114.194) * (-1109.318) [-1109.229] (-1111.134) (-1111.818) -- 0:00:12 799500 -- (-1113.570) (-1110.295) [-1111.239] (-1115.470) * [-1109.425] (-1110.375) (-1110.934) (-1114.840) -- 0:00:12 800000 -- (-1109.382) (-1109.412) [-1111.374] (-1111.605) * [-1109.034] (-1115.186) (-1113.780) (-1112.815) -- 0:00:12 Average standard deviation of split frequencies: 0.008353 800500 -- [-1110.548] (-1108.705) (-1112.723) (-1111.967) * (-1109.636) [-1109.253] (-1110.708) (-1111.532) -- 0:00:12 801000 -- (-1114.264) (-1109.441) [-1110.471] (-1113.750) * (-1112.819) (-1109.770) (-1110.004) [-1110.561] -- 0:00:12 801500 -- (-1111.281) (-1108.690) [-1110.388] (-1113.794) * (-1116.246) (-1111.333) (-1110.291) [-1111.592] -- 0:00:12 802000 -- (-1109.523) [-1109.146] (-1111.726) (-1112.859) * (-1113.077) (-1109.934) (-1110.028) [-1109.364] -- 0:00:12 802500 -- (-1111.693) (-1109.495) (-1109.562) [-1113.958] * (-1110.621) (-1111.388) (-1110.683) [-1110.046] -- 0:00:12 803000 -- (-1109.642) [-1110.439] (-1109.113) (-1110.981) * (-1110.984) (-1111.737) [-1109.421] (-1110.975) -- 0:00:12 803500 -- (-1109.580) (-1111.054) [-1110.309] (-1113.118) * (-1112.766) (-1110.027) [-1108.625] (-1113.985) -- 0:00:11 804000 -- [-1111.947] (-1109.787) (-1113.037) (-1112.470) * [-1111.910] (-1110.203) (-1108.625) (-1112.446) -- 0:00:11 804500 -- (-1112.921) (-1108.864) [-1111.568] (-1110.797) * (-1112.612) [-1109.955] (-1109.296) (-1109.320) -- 0:00:11 805000 -- (-1115.300) (-1116.766) (-1112.439) [-1109.065] * (-1110.688) (-1109.271) (-1109.984) [-1112.242] -- 0:00:11 Average standard deviation of split frequencies: 0.008152 805500 -- (-1113.272) [-1112.267] (-1110.797) (-1108.545) * [-1109.897] (-1109.541) (-1110.586) (-1109.374) -- 0:00:11 806000 -- (-1112.820) [-1109.049] (-1112.401) (-1111.749) * [-1109.763] (-1112.279) (-1110.381) (-1109.217) -- 0:00:11 806500 -- (-1112.369) [-1108.293] (-1113.150) (-1113.296) * (-1109.696) [-1110.219] (-1110.194) (-1109.408) -- 0:00:11 807000 -- [-1109.972] (-1108.646) (-1110.571) (-1110.897) * (-1108.543) (-1109.177) (-1112.257) [-1108.991] -- 0:00:11 807500 -- (-1110.690) (-1110.032) [-1109.854] (-1110.830) * (-1109.040) [-1111.381] (-1111.073) (-1110.668) -- 0:00:11 808000 -- [-1110.799] (-1109.405) (-1109.853) (-1113.600) * (-1109.638) (-1110.944) (-1108.916) [-1109.686] -- 0:00:11 808500 -- (-1111.751) (-1110.166) [-1112.785] (-1109.291) * (-1111.852) (-1108.850) (-1111.042) [-1111.043] -- 0:00:11 809000 -- (-1109.495) [-1109.884] (-1112.105) (-1109.808) * (-1110.674) (-1110.806) (-1117.777) [-1113.244] -- 0:00:11 809500 -- [-1110.004] (-1110.982) (-1114.916) (-1109.757) * (-1109.244) [-1110.713] (-1110.756) (-1109.129) -- 0:00:11 810000 -- (-1114.413) (-1112.193) (-1117.427) [-1110.936] * (-1109.051) (-1110.134) (-1113.396) [-1109.477] -- 0:00:11 Average standard deviation of split frequencies: 0.008323 810500 -- (-1112.875) (-1109.869) [-1111.944] (-1111.954) * [-1110.449] (-1108.872) (-1111.031) (-1110.032) -- 0:00:11 811000 -- (-1111.639) (-1109.093) [-1109.925] (-1111.450) * (-1113.919) (-1112.561) (-1109.619) [-1108.851] -- 0:00:11 811500 -- [-1110.041] (-1111.137) (-1110.771) (-1109.828) * (-1112.237) (-1111.245) (-1111.157) [-1108.492] -- 0:00:11 812000 -- (-1114.348) [-1109.272] (-1112.937) (-1110.387) * (-1112.304) (-1109.707) (-1109.826) [-1109.172] -- 0:00:11 812500 -- (-1114.421) (-1108.965) [-1111.263] (-1110.759) * [-1110.526] (-1111.841) (-1110.181) (-1111.090) -- 0:00:11 813000 -- [-1109.619] (-1108.838) (-1108.583) (-1111.386) * [-1111.616] (-1112.333) (-1109.252) (-1113.131) -- 0:00:11 813500 -- (-1112.367) (-1108.842) [-1109.547] (-1111.016) * (-1110.757) (-1111.547) [-1111.926] (-1110.382) -- 0:00:11 814000 -- [-1109.387] (-1110.265) (-1111.718) (-1110.308) * [-1110.643] (-1112.316) (-1110.174) (-1110.439) -- 0:00:11 814500 -- (-1110.698) [-1110.491] (-1112.663) (-1109.777) * (-1109.956) (-1111.205) (-1108.958) [-1110.428] -- 0:00:11 815000 -- (-1111.351) [-1112.901] (-1111.957) (-1112.336) * (-1109.738) (-1110.399) (-1110.949) [-1111.395] -- 0:00:11 Average standard deviation of split frequencies: 0.008268 815500 -- [-1111.807] (-1112.985) (-1113.345) (-1109.654) * (-1114.264) (-1113.492) [-1113.067] (-1109.543) -- 0:00:11 816000 -- (-1109.403) (-1111.941) (-1109.080) [-1110.864] * [-1110.722] (-1112.155) (-1111.034) (-1109.673) -- 0:00:11 816500 -- (-1110.302) (-1113.516) [-1109.249] (-1111.028) * (-1113.065) (-1110.122) [-1108.996] (-1112.979) -- 0:00:11 817000 -- [-1111.167] (-1110.643) (-1109.052) (-1109.419) * (-1109.953) [-1109.710] (-1109.645) (-1112.095) -- 0:00:11 817500 -- (-1110.342) (-1115.022) (-1108.932) [-1113.587] * (-1109.032) (-1108.884) (-1113.794) [-1110.826] -- 0:00:11 818000 -- (-1113.936) (-1114.709) (-1108.881) [-1112.287] * (-1109.161) (-1109.026) (-1110.810) [-1109.845] -- 0:00:11 818500 -- (-1111.108) (-1113.097) [-1109.699] (-1112.589) * (-1113.222) [-1113.314] (-1111.200) (-1111.390) -- 0:00:11 819000 -- (-1112.578) (-1109.915) [-1108.711] (-1112.092) * [-1109.546] (-1112.698) (-1113.807) (-1109.188) -- 0:00:11 819500 -- [-1112.187] (-1111.563) (-1110.991) (-1108.893) * (-1110.400) (-1111.984) (-1112.302) [-1109.241] -- 0:00:11 820000 -- (-1110.945) [-1110.364] (-1110.069) (-1110.229) * (-1110.018) (-1109.335) (-1112.691) [-1109.161] -- 0:00:10 Average standard deviation of split frequencies: 0.008473 820500 -- (-1109.173) (-1110.313) [-1110.976] (-1109.421) * (-1115.205) (-1109.836) [-1111.693] (-1108.709) -- 0:00:10 821000 -- (-1108.363) [-1111.446] (-1109.790) (-1109.092) * (-1110.155) (-1112.270) [-1111.196] (-1110.014) -- 0:00:10 821500 -- (-1108.609) [-1109.786] (-1111.152) (-1112.172) * (-1108.806) (-1113.824) [-1111.571] (-1113.018) -- 0:00:10 822000 -- (-1109.591) (-1109.048) [-1111.013] (-1110.030) * (-1110.654) (-1109.652) (-1109.686) [-1108.878] -- 0:00:10 822500 -- [-1110.575] (-1113.335) (-1110.341) (-1109.969) * (-1110.849) (-1109.689) (-1109.629) [-1108.499] -- 0:00:10 823000 -- (-1112.381) (-1113.677) (-1111.829) [-1108.776] * (-1110.259) (-1114.001) [-1109.722] (-1112.599) -- 0:00:10 823500 -- [-1110.393] (-1117.612) (-1110.718) (-1112.847) * (-1110.440) (-1111.430) [-1111.300] (-1111.879) -- 0:00:10 824000 -- [-1112.088] (-1115.798) (-1111.672) (-1114.415) * (-1110.450) (-1110.235) (-1109.206) [-1110.183] -- 0:00:10 824500 -- (-1111.261) (-1114.993) [-1111.503] (-1110.031) * [-1109.979] (-1114.116) (-1110.149) (-1109.529) -- 0:00:10 825000 -- (-1112.648) (-1113.452) [-1112.794] (-1109.572) * (-1114.644) [-1112.553] (-1112.779) (-1110.980) -- 0:00:10 Average standard deviation of split frequencies: 0.008311 825500 -- (-1111.857) [-1109.316] (-1112.857) (-1112.230) * (-1113.381) (-1113.848) [-1113.638] (-1113.054) -- 0:00:10 826000 -- (-1109.827) (-1110.435) [-1110.413] (-1117.680) * (-1111.034) (-1113.167) [-1109.611] (-1109.609) -- 0:00:10 826500 -- (-1108.724) (-1112.786) [-1111.361] (-1112.748) * (-1112.159) [-1110.008] (-1109.102) (-1110.497) -- 0:00:10 827000 -- [-1108.335] (-1114.380) (-1111.074) (-1111.252) * [-1109.382] (-1110.890) (-1111.305) (-1116.856) -- 0:00:10 827500 -- (-1108.783) (-1115.303) (-1109.931) [-1111.878] * [-1109.079] (-1113.736) (-1113.726) (-1108.521) -- 0:00:10 828000 -- [-1111.225] (-1110.083) (-1109.943) (-1110.687) * (-1111.820) (-1112.443) (-1110.284) [-1109.579] -- 0:00:10 828500 -- (-1110.650) (-1110.395) (-1112.427) [-1114.365] * (-1114.072) (-1114.989) (-1111.687) [-1111.571] -- 0:00:10 829000 -- (-1111.868) [-1111.290] (-1110.442) (-1113.470) * (-1110.496) (-1117.539) [-1110.300] (-1112.117) -- 0:00:10 829500 -- (-1112.154) [-1110.080] (-1110.147) (-1114.843) * (-1112.553) (-1111.118) (-1110.867) [-1109.286] -- 0:00:10 830000 -- (-1108.547) (-1109.058) (-1109.328) [-1113.234] * (-1111.395) [-1109.480] (-1123.001) (-1109.639) -- 0:00:10 Average standard deviation of split frequencies: 0.008442 830500 -- [-1109.496] (-1109.835) (-1111.836) (-1111.056) * (-1110.703) (-1111.345) (-1111.013) [-1113.046] -- 0:00:10 831000 -- (-1109.490) (-1110.831) (-1111.214) [-1110.593] * (-1114.516) (-1109.703) (-1112.302) [-1114.085] -- 0:00:10 831500 -- [-1108.982] (-1109.982) (-1110.342) (-1110.556) * [-1109.444] (-1111.404) (-1112.516) (-1112.154) -- 0:00:10 832000 -- [-1109.563] (-1112.595) (-1116.857) (-1110.790) * (-1110.036) (-1109.915) [-1110.902] (-1112.479) -- 0:00:10 832500 -- (-1110.191) (-1109.906) (-1110.003) [-1109.099] * (-1109.950) (-1111.841) (-1111.625) [-1116.504] -- 0:00:10 833000 -- (-1109.004) (-1108.927) [-1111.820] (-1113.079) * (-1110.855) (-1111.247) (-1112.345) [-1112.739] -- 0:00:10 833500 -- [-1108.500] (-1109.332) (-1113.198) (-1111.545) * (-1109.932) (-1110.136) (-1111.199) [-1109.374] -- 0:00:10 834000 -- (-1109.773) (-1108.278) [-1110.386] (-1111.327) * [-1110.909] (-1108.539) (-1112.098) (-1108.218) -- 0:00:10 834500 -- (-1112.541) (-1110.682) [-1109.245] (-1111.522) * (-1113.247) (-1109.359) [-1111.305] (-1109.025) -- 0:00:10 835000 -- (-1115.438) [-1113.556] (-1110.231) (-1110.231) * (-1111.822) [-1108.924] (-1111.438) (-1110.036) -- 0:00:10 Average standard deviation of split frequencies: 0.008493 835500 -- [-1109.697] (-1111.413) (-1109.327) (-1109.261) * [-1111.615] (-1108.666) (-1111.293) (-1110.226) -- 0:00:10 836000 -- (-1113.440) [-1109.414] (-1109.097) (-1109.301) * (-1110.472) (-1108.689) [-1109.621] (-1111.617) -- 0:00:10 836500 -- [-1111.465] (-1111.919) (-1109.199) (-1109.648) * [-1108.923] (-1110.391) (-1113.415) (-1109.525) -- 0:00:09 837000 -- (-1110.097) (-1109.515) (-1109.188) [-1108.903] * (-1113.958) (-1112.525) [-1109.121] (-1110.946) -- 0:00:09 837500 -- (-1110.766) (-1109.504) (-1109.183) [-1110.033] * [-1108.808] (-1109.688) (-1110.640) (-1108.901) -- 0:00:09 838000 -- [-1108.948] (-1110.163) (-1109.196) (-1112.398) * [-1109.595] (-1111.496) (-1109.480) (-1109.786) -- 0:00:09 838500 -- (-1109.837) (-1109.415) [-1109.335] (-1109.588) * (-1111.934) (-1109.717) (-1109.230) [-1109.069] -- 0:00:09 839000 -- (-1109.006) (-1110.778) [-1109.243] (-1109.785) * (-1109.990) (-1113.091) [-1109.214] (-1110.815) -- 0:00:09 839500 -- (-1108.824) [-1113.099] (-1110.560) (-1109.509) * [-1111.374] (-1112.312) (-1110.094) (-1109.595) -- 0:00:09 840000 -- (-1113.613) [-1117.919] (-1111.145) (-1109.176) * (-1110.444) (-1113.847) (-1113.169) [-1112.589] -- 0:00:09 Average standard deviation of split frequencies: 0.008481 840500 -- (-1114.183) (-1114.298) (-1112.459) [-1111.053] * [-1108.970] (-1110.906) (-1113.141) (-1111.481) -- 0:00:09 841000 -- (-1115.740) (-1114.373) [-1111.687] (-1113.878) * [-1110.283] (-1110.300) (-1110.746) (-1113.399) -- 0:00:09 841500 -- [-1110.227] (-1110.858) (-1110.833) (-1112.154) * (-1111.626) (-1111.306) [-1110.917] (-1109.980) -- 0:00:09 842000 -- [-1111.130] (-1109.115) (-1110.354) (-1112.570) * (-1111.343) [-1111.467] (-1110.843) (-1110.529) -- 0:00:09 842500 -- (-1117.038) (-1109.591) (-1109.919) [-1109.178] * [-1110.626] (-1110.272) (-1110.441) (-1109.867) -- 0:00:09 843000 -- (-1112.603) (-1109.564) (-1113.958) [-1109.806] * (-1110.410) (-1110.110) (-1110.366) [-1108.479] -- 0:00:09 843500 -- (-1110.253) (-1109.913) (-1111.768) [-1112.715] * (-1114.011) (-1109.913) (-1109.826) [-1108.506] -- 0:00:09 844000 -- (-1111.391) (-1109.608) [-1110.274] (-1112.691) * [-1109.790] (-1111.705) (-1111.640) (-1109.760) -- 0:00:09 844500 -- [-1110.568] (-1109.872) (-1108.403) (-1109.717) * (-1109.666) (-1111.630) (-1112.199) [-1108.406] -- 0:00:09 845000 -- (-1111.594) [-1112.198] (-1108.557) (-1109.416) * [-1109.555] (-1110.171) (-1110.688) (-1111.918) -- 0:00:09 Average standard deviation of split frequencies: 0.008741 845500 -- (-1109.105) (-1111.106) (-1111.556) [-1109.583] * (-1113.276) (-1110.360) [-1109.304] (-1114.903) -- 0:00:09 846000 -- [-1109.260] (-1111.547) (-1113.046) (-1109.816) * (-1109.902) (-1110.384) [-1110.296] (-1113.372) -- 0:00:09 846500 -- [-1109.829] (-1110.163) (-1113.439) (-1111.442) * (-1109.342) [-1108.671] (-1109.316) (-1112.312) -- 0:00:09 847000 -- [-1110.997] (-1110.814) (-1112.957) (-1113.377) * [-1108.795] (-1110.095) (-1110.342) (-1110.431) -- 0:00:09 847500 -- (-1108.849) [-1111.039] (-1109.196) (-1112.365) * (-1110.089) (-1110.972) [-1109.048] (-1111.932) -- 0:00:09 848000 -- [-1109.384] (-1109.031) (-1111.526) (-1109.543) * [-1108.737] (-1112.756) (-1113.149) (-1112.326) -- 0:00:09 848500 -- (-1111.338) [-1109.617] (-1111.342) (-1116.055) * (-1113.074) [-1111.680] (-1111.597) (-1111.951) -- 0:00:09 849000 -- (-1109.840) (-1111.875) [-1109.757] (-1110.524) * (-1114.192) (-1110.063) (-1111.314) [-1109.228] -- 0:00:09 849500 -- (-1109.301) (-1109.567) (-1109.341) [-1111.994] * [-1112.109] (-1109.958) (-1110.194) (-1110.778) -- 0:00:09 850000 -- (-1110.026) (-1113.319) [-1110.616] (-1108.625) * (-1109.520) (-1109.705) (-1110.113) [-1108.987] -- 0:00:09 Average standard deviation of split frequencies: 0.008278 850500 -- (-1108.954) (-1109.900) [-1108.983] (-1110.339) * (-1110.106) (-1110.411) (-1110.627) [-1110.843] -- 0:00:09 851000 -- (-1109.925) (-1110.051) [-1110.135] (-1112.415) * (-1114.535) (-1111.085) [-1110.854] (-1111.504) -- 0:00:09 851500 -- (-1109.750) [-1109.530] (-1108.986) (-1110.980) * [-1113.896] (-1111.153) (-1112.235) (-1111.355) -- 0:00:09 852000 -- (-1109.361) (-1111.332) [-1109.321] (-1111.367) * [-1114.477] (-1111.627) (-1112.846) (-1112.114) -- 0:00:09 852500 -- (-1111.529) (-1114.738) (-1110.316) [-1109.869] * (-1113.657) (-1112.494) (-1110.125) [-1114.092] -- 0:00:08 853000 -- (-1112.121) [-1109.457] (-1109.521) (-1109.276) * (-1114.215) (-1110.130) [-1109.838] (-1110.899) -- 0:00:08 853500 -- (-1109.830) (-1111.905) (-1110.043) [-1111.208] * (-1113.875) (-1110.535) (-1111.535) [-1110.746] -- 0:00:08 854000 -- [-1109.147] (-1109.090) (-1109.564) (-1113.876) * [-1112.920] (-1110.567) (-1111.422) (-1110.078) -- 0:00:08 854500 -- (-1109.716) [-1111.586] (-1110.566) (-1110.909) * (-1111.965) [-1111.678] (-1114.961) (-1110.259) -- 0:00:08 855000 -- (-1111.096) (-1114.017) (-1109.295) [-1110.086] * (-1110.910) (-1111.895) [-1109.580] (-1109.644) -- 0:00:08 Average standard deviation of split frequencies: 0.008364 855500 -- [-1110.446] (-1110.266) (-1111.856) (-1111.839) * (-1117.013) (-1110.525) (-1109.711) [-1111.370] -- 0:00:08 856000 -- [-1111.740] (-1108.983) (-1109.267) (-1109.882) * (-1109.589) (-1111.702) (-1108.804) [-1111.887] -- 0:00:08 856500 -- (-1110.249) (-1112.661) (-1109.603) [-1111.829] * (-1110.455) (-1110.802) (-1108.885) [-1108.878] -- 0:00:08 857000 -- (-1110.952) [-1110.036] (-1108.698) (-1112.882) * (-1111.299) [-1109.467] (-1108.739) (-1109.092) -- 0:00:08 857500 -- [-1109.937] (-1111.603) (-1116.232) (-1112.262) * [-1109.303] (-1109.471) (-1108.679) (-1113.123) -- 0:00:08 858000 -- (-1111.563) [-1110.134] (-1109.461) (-1109.333) * (-1109.061) (-1112.294) (-1109.146) [-1109.417] -- 0:00:08 858500 -- (-1113.293) [-1110.099] (-1112.023) (-1115.279) * (-1109.139) (-1112.463) (-1110.152) [-1113.480] -- 0:00:08 859000 -- (-1112.067) [-1110.467] (-1112.494) (-1111.997) * (-1109.038) [-1110.383] (-1110.211) (-1110.250) -- 0:00:08 859500 -- (-1109.949) [-1110.496] (-1113.815) (-1110.801) * (-1109.076) (-1112.339) (-1112.770) [-1112.620] -- 0:00:08 860000 -- (-1110.635) (-1109.995) [-1112.384] (-1110.638) * (-1110.672) [-1109.657] (-1110.105) (-1110.120) -- 0:00:08 Average standard deviation of split frequencies: 0.007924 860500 -- (-1110.875) [-1108.834] (-1111.676) (-1110.070) * [-1113.199] (-1118.157) (-1111.682) (-1112.329) -- 0:00:08 861000 -- (-1108.690) (-1112.515) [-1111.615] (-1113.509) * (-1110.076) [-1109.719] (-1109.589) (-1109.961) -- 0:00:08 861500 -- [-1109.492] (-1110.624) (-1112.113) (-1117.122) * [-1110.325] (-1110.390) (-1110.999) (-1112.280) -- 0:00:08 862000 -- [-1108.940] (-1110.537) (-1111.846) (-1113.063) * (-1109.031) [-1110.566] (-1110.904) (-1112.930) -- 0:00:08 862500 -- (-1109.295) [-1111.718] (-1111.472) (-1108.741) * (-1108.883) (-1109.303) [-1111.920] (-1111.262) -- 0:00:08 863000 -- (-1109.442) (-1109.445) (-1109.311) [-1108.969] * (-1109.239) (-1108.361) (-1111.405) [-1109.918] -- 0:00:08 863500 -- (-1110.354) (-1112.063) [-1109.901] (-1109.170) * (-1114.771) (-1109.180) (-1111.073) [-1111.072] -- 0:00:08 864000 -- [-1109.841] (-1112.720) (-1108.604) (-1111.050) * (-1109.885) (-1108.946) [-1111.528] (-1112.159) -- 0:00:08 864500 -- (-1112.214) (-1110.321) (-1112.637) [-1110.936] * [-1110.045] (-1109.501) (-1114.615) (-1112.359) -- 0:00:08 865000 -- [-1112.396] (-1109.178) (-1112.545) (-1112.724) * (-1112.705) (-1108.923) (-1109.231) [-1110.299] -- 0:00:08 Average standard deviation of split frequencies: 0.007839 865500 -- [-1108.990] (-1111.607) (-1111.940) (-1109.770) * (-1108.919) (-1109.251) [-1110.896] (-1115.908) -- 0:00:08 866000 -- (-1117.424) (-1112.374) (-1113.038) [-1109.698] * (-1111.327) (-1109.374) [-1111.238] (-1111.490) -- 0:00:08 866500 -- (-1111.521) (-1111.157) (-1109.656) [-1114.216] * (-1110.269) (-1109.964) (-1109.812) [-1110.162] -- 0:00:08 867000 -- (-1112.578) (-1109.947) [-1110.016] (-1109.804) * (-1112.089) [-1110.785] (-1109.685) (-1109.692) -- 0:00:08 867500 -- (-1110.552) [-1109.819] (-1108.981) (-1110.563) * (-1112.836) [-1115.932] (-1111.906) (-1118.185) -- 0:00:08 868000 -- (-1110.362) (-1110.466) [-1110.591] (-1114.418) * (-1110.816) (-1111.988) [-1110.764] (-1113.504) -- 0:00:08 868500 -- (-1112.499) (-1113.477) [-1111.415] (-1114.497) * (-1109.562) (-1111.635) (-1108.614) [-1112.557] -- 0:00:08 869000 -- [-1110.833] (-1110.273) (-1111.233) (-1114.743) * (-1110.548) [-1113.027] (-1110.270) (-1113.109) -- 0:00:07 869500 -- (-1114.466) (-1109.127) (-1111.974) [-1112.119] * (-1110.310) [-1110.468] (-1110.978) (-1111.409) -- 0:00:07 870000 -- (-1109.831) [-1111.425] (-1111.891) (-1112.530) * (-1109.984) (-1109.472) (-1112.558) [-1111.259] -- 0:00:07 Average standard deviation of split frequencies: 0.008085 870500 -- [-1111.780] (-1110.507) (-1111.045) (-1110.879) * (-1113.449) [-1113.643] (-1113.044) (-1111.915) -- 0:00:07 871000 -- (-1108.892) (-1110.451) [-1110.426] (-1108.417) * [-1108.809] (-1114.038) (-1116.288) (-1109.989) -- 0:00:07 871500 -- [-1108.842] (-1110.683) (-1111.407) (-1112.824) * (-1109.536) (-1110.163) (-1117.572) [-1110.065] -- 0:00:07 872000 -- [-1108.846] (-1110.145) (-1109.039) (-1113.227) * (-1109.530) [-1109.641] (-1111.652) (-1109.488) -- 0:00:07 872500 -- (-1109.332) (-1110.525) [-1110.114] (-1113.575) * (-1109.439) [-1109.717] (-1111.082) (-1112.111) -- 0:00:07 873000 -- (-1109.333) [-1113.704] (-1110.708) (-1111.959) * (-1110.032) [-1112.983] (-1117.264) (-1109.368) -- 0:00:07 873500 -- (-1117.946) [-1111.319] (-1110.429) (-1110.406) * (-1110.396) (-1112.346) [-1111.653] (-1110.680) -- 0:00:07 874000 -- (-1110.061) [-1112.646] (-1110.640) (-1109.999) * (-1114.277) (-1111.727) [-1109.141] (-1112.948) -- 0:00:07 874500 -- (-1110.988) [-1109.983] (-1111.207) (-1112.149) * (-1112.539) (-1109.563) (-1109.562) [-1114.249] -- 0:00:07 875000 -- [-1109.451] (-1109.572) (-1111.015) (-1109.514) * [-1110.879] (-1113.540) (-1115.086) (-1108.953) -- 0:00:07 Average standard deviation of split frequencies: 0.008180 875500 -- (-1109.170) (-1110.255) (-1110.833) [-1110.437] * (-1109.945) (-1115.744) (-1109.869) [-1108.814] -- 0:00:07 876000 -- (-1111.271) (-1114.311) [-1111.583] (-1110.112) * (-1109.333) (-1110.327) (-1109.092) [-1110.544] -- 0:00:07 876500 -- (-1110.156) (-1109.197) (-1109.667) [-1115.824] * [-1110.295] (-1111.660) (-1112.195) (-1111.810) -- 0:00:07 877000 -- (-1112.064) (-1110.633) (-1108.788) [-1112.597] * [-1110.167] (-1112.636) (-1111.698) (-1109.363) -- 0:00:07 877500 -- (-1109.837) (-1111.513) [-1109.068] (-1109.958) * (-1115.437) (-1110.008) [-1116.412] (-1113.441) -- 0:00:07 878000 -- (-1110.848) (-1110.642) [-1111.800] (-1110.964) * [-1109.658] (-1114.788) (-1115.133) (-1110.425) -- 0:00:07 878500 -- (-1111.133) (-1109.741) (-1114.621) [-1111.923] * (-1113.534) (-1114.194) [-1117.176] (-1109.463) -- 0:00:07 879000 -- [-1109.068] (-1111.710) (-1109.010) (-1111.554) * [-1109.457] (-1111.395) (-1110.791) (-1112.233) -- 0:00:07 879500 -- (-1108.892) [-1110.398] (-1108.932) (-1110.496) * (-1108.559) (-1112.676) [-1110.302] (-1109.228) -- 0:00:07 880000 -- [-1109.760] (-1110.453) (-1109.492) (-1110.356) * (-1110.164) (-1109.110) (-1109.810) [-1109.061] -- 0:00:07 Average standard deviation of split frequencies: 0.008172 880500 -- (-1110.763) [-1112.019] (-1109.096) (-1111.397) * [-1112.521] (-1110.229) (-1110.691) (-1108.672) -- 0:00:07 881000 -- (-1110.720) [-1108.706] (-1111.390) (-1109.508) * [-1111.068] (-1111.240) (-1108.880) (-1108.366) -- 0:00:07 881500 -- [-1109.215] (-1109.402) (-1109.700) (-1108.735) * (-1111.827) (-1111.551) (-1109.531) [-1112.718] -- 0:00:07 882000 -- (-1109.269) (-1110.530) (-1110.324) [-1109.823] * [-1110.104] (-1113.682) (-1110.577) (-1110.491) -- 0:00:07 882500 -- (-1113.983) [-1108.754] (-1111.345) (-1109.818) * (-1110.999) [-1110.480] (-1111.491) (-1109.667) -- 0:00:07 883000 -- [-1111.506] (-1109.931) (-1108.648) (-1111.022) * (-1116.172) (-1115.651) [-1109.073] (-1109.650) -- 0:00:07 883500 -- (-1109.715) (-1113.637) [-1109.006] (-1109.973) * (-1114.973) (-1113.421) (-1108.832) [-1110.461] -- 0:00:07 884000 -- (-1110.715) [-1110.832] (-1108.849) (-1111.600) * [-1108.602] (-1108.389) (-1109.123) (-1112.850) -- 0:00:07 884500 -- (-1113.003) [-1110.167] (-1111.265) (-1110.170) * [-1111.126] (-1111.127) (-1109.156) (-1109.631) -- 0:00:07 885000 -- (-1111.858) [-1111.035] (-1110.567) (-1110.696) * [-1110.055] (-1110.181) (-1110.158) (-1109.754) -- 0:00:07 Average standard deviation of split frequencies: 0.008371 885500 -- (-1110.439) (-1112.685) (-1110.565) [-1108.618] * (-1113.068) (-1109.618) (-1111.369) [-1109.396] -- 0:00:06 886000 -- [-1111.934] (-1111.787) (-1111.184) (-1108.742) * (-1113.198) [-1110.226] (-1109.716) (-1110.843) -- 0:00:06 886500 -- [-1109.617] (-1110.476) (-1110.012) (-1111.065) * [-1114.086] (-1110.356) (-1109.297) (-1113.354) -- 0:00:06 887000 -- (-1110.175) (-1110.224) [-1115.277] (-1114.892) * (-1111.402) (-1110.326) (-1110.537) [-1110.788] -- 0:00:06 887500 -- (-1109.817) (-1111.046) [-1112.261] (-1111.738) * (-1110.417) (-1110.024) [-1110.187] (-1111.220) -- 0:00:06 888000 -- (-1109.308) (-1111.575) [-1117.127] (-1112.546) * (-1110.669) (-1109.418) [-1110.602] (-1110.624) -- 0:00:06 888500 -- (-1109.331) [-1117.057] (-1113.028) (-1115.767) * [-1110.299] (-1109.309) (-1109.652) (-1109.377) -- 0:00:06 889000 -- [-1108.382] (-1110.678) (-1109.951) (-1110.100) * [-1110.632] (-1109.239) (-1115.958) (-1109.285) -- 0:00:06 889500 -- [-1111.964] (-1110.760) (-1113.599) (-1108.578) * (-1112.053) (-1112.555) [-1115.651] (-1111.569) -- 0:00:06 890000 -- [-1109.966] (-1111.832) (-1109.288) (-1112.093) * [-1110.227] (-1109.721) (-1109.630) (-1112.089) -- 0:00:06 Average standard deviation of split frequencies: 0.008398 890500 -- [-1111.977] (-1110.345) (-1111.780) (-1109.292) * (-1112.910) (-1113.330) [-1109.467] (-1115.042) -- 0:00:06 891000 -- (-1113.515) (-1113.393) (-1110.912) [-1112.914] * (-1109.395) (-1110.752) (-1110.455) [-1110.437] -- 0:00:06 891500 -- [-1112.918] (-1113.866) (-1109.256) (-1110.276) * (-1111.882) (-1110.943) [-1110.236] (-1111.259) -- 0:00:06 892000 -- (-1112.648) (-1113.336) (-1109.558) [-1109.625] * (-1109.527) [-1110.923] (-1111.510) (-1109.320) -- 0:00:06 892500 -- (-1109.871) (-1109.418) [-1108.581] (-1109.183) * (-1109.548) (-1110.953) (-1113.201) [-1110.939] -- 0:00:06 893000 -- [-1115.272] (-1113.015) (-1108.770) (-1112.987) * [-1110.457] (-1110.141) (-1111.183) (-1109.795) -- 0:00:06 893500 -- (-1110.339) (-1111.463) [-1109.902] (-1109.395) * (-1113.840) (-1110.000) [-1109.735] (-1110.605) -- 0:00:06 894000 -- (-1111.266) (-1109.999) (-1109.944) [-1112.884] * (-1116.875) (-1110.575) [-1114.485] (-1109.507) -- 0:00:06 894500 -- [-1111.968] (-1113.349) (-1111.859) (-1113.168) * (-1110.846) [-1110.116] (-1117.616) (-1109.484) -- 0:00:06 895000 -- (-1112.171) (-1109.759) (-1110.427) [-1112.132] * [-1109.079] (-1112.735) (-1110.921) (-1108.812) -- 0:00:06 Average standard deviation of split frequencies: 0.008453 895500 -- (-1109.298) (-1110.616) (-1109.644) [-1114.796] * (-1112.363) (-1117.336) [-1108.559] (-1110.894) -- 0:00:06 896000 -- (-1109.593) (-1112.701) [-1109.062] (-1109.375) * (-1112.946) (-1111.025) [-1110.246] (-1111.695) -- 0:00:06 896500 -- [-1110.310] (-1109.423) (-1108.828) (-1111.017) * [-1109.962] (-1110.961) (-1110.408) (-1113.424) -- 0:00:06 897000 -- [-1110.237] (-1110.145) (-1111.268) (-1110.042) * (-1112.020) (-1109.734) [-1111.708] (-1113.082) -- 0:00:06 897500 -- (-1115.431) (-1111.235) (-1112.019) [-1108.889] * (-1111.761) [-1108.527] (-1110.158) (-1110.562) -- 0:00:06 898000 -- (-1110.934) (-1112.903) [-1110.639] (-1112.585) * (-1109.378) (-1109.571) (-1113.210) [-1110.087] -- 0:00:06 898500 -- (-1113.619) (-1112.457) [-1108.935] (-1111.532) * [-1112.219] (-1111.321) (-1117.456) (-1109.930) -- 0:00:06 899000 -- (-1116.259) (-1108.854) (-1110.703) [-1111.195] * (-1110.833) (-1111.322) [-1110.950] (-1112.823) -- 0:00:06 899500 -- [-1109.800] (-1113.710) (-1110.975) (-1111.298) * (-1108.951) [-1112.555] (-1109.505) (-1119.403) -- 0:00:06 900000 -- (-1116.577) (-1110.075) [-1113.434] (-1114.927) * [-1111.032] (-1111.979) (-1113.177) (-1111.778) -- 0:00:06 Average standard deviation of split frequencies: 0.008479 900500 -- [-1112.477] (-1109.750) (-1109.517) (-1113.670) * [-1112.151] (-1110.523) (-1112.470) (-1111.800) -- 0:00:06 901000 -- (-1115.073) [-1110.112] (-1113.873) (-1111.352) * [-1108.566] (-1111.919) (-1110.280) (-1116.282) -- 0:00:06 901500 -- [-1111.320] (-1112.087) (-1110.676) (-1112.868) * [-1111.187] (-1109.578) (-1110.110) (-1109.209) -- 0:00:06 902000 -- [-1112.224] (-1111.840) (-1112.253) (-1108.979) * (-1109.969) (-1112.216) (-1111.805) [-1109.331] -- 0:00:05 902500 -- (-1110.674) [-1111.572] (-1109.417) (-1108.580) * (-1111.491) (-1110.326) [-1110.618] (-1109.638) -- 0:00:05 903000 -- [-1113.793] (-1115.414) (-1108.850) (-1111.149) * [-1110.304] (-1109.985) (-1110.844) (-1109.825) -- 0:00:05 903500 -- [-1114.219] (-1115.386) (-1112.872) (-1110.524) * [-1110.136] (-1113.255) (-1110.893) (-1119.196) -- 0:00:05 904000 -- (-1110.583) (-1115.016) [-1109.155] (-1111.504) * (-1110.268) (-1109.868) [-1110.614] (-1114.393) -- 0:00:05 904500 -- [-1110.182] (-1119.399) (-1109.624) (-1110.865) * (-1110.052) (-1109.477) [-1109.880] (-1110.316) -- 0:00:05 905000 -- (-1110.726) [-1112.790] (-1110.189) (-1109.945) * (-1113.018) (-1111.028) [-1109.126] (-1112.539) -- 0:00:05 Average standard deviation of split frequencies: 0.008221 905500 -- [-1110.282] (-1111.641) (-1110.576) (-1113.777) * (-1109.564) (-1111.428) [-1109.499] (-1109.705) -- 0:00:05 906000 -- (-1110.546) [-1110.450] (-1109.206) (-1116.455) * (-1110.204) (-1113.733) (-1112.331) [-1111.787] -- 0:00:05 906500 -- (-1113.019) [-1108.646] (-1114.917) (-1114.617) * (-1109.653) (-1110.462) [-1112.275] (-1110.529) -- 0:00:05 907000 -- (-1108.620) [-1110.391] (-1109.364) (-1112.791) * (-1111.265) (-1110.792) [-1111.659] (-1109.349) -- 0:00:05 907500 -- (-1109.748) [-1109.260] (-1109.474) (-1113.711) * (-1115.738) (-1112.383) [-1111.210] (-1115.937) -- 0:00:05 908000 -- [-1114.687] (-1109.855) (-1110.809) (-1113.008) * (-1109.332) (-1110.197) (-1115.503) [-1110.916] -- 0:00:05 908500 -- [-1111.661] (-1113.337) (-1110.002) (-1111.761) * [-1111.769] (-1109.222) (-1116.763) (-1110.139) -- 0:00:05 909000 -- (-1114.264) (-1109.757) (-1109.174) [-1109.904] * (-1110.901) (-1110.690) [-1109.562] (-1108.811) -- 0:00:05 909500 -- (-1112.441) (-1109.958) (-1108.611) [-1110.675] * (-1115.418) (-1115.311) (-1111.905) [-1109.572] -- 0:00:05 910000 -- (-1111.786) [-1111.888] (-1112.631) (-1110.636) * [-1109.115] (-1114.085) (-1112.938) (-1109.135) -- 0:00:05 Average standard deviation of split frequencies: 0.007972 910500 -- (-1112.462) [-1111.306] (-1112.632) (-1109.769) * (-1116.836) [-1113.317] (-1109.216) (-1108.756) -- 0:00:05 911000 -- (-1112.536) (-1114.379) [-1110.886] (-1110.502) * (-1111.445) (-1113.415) [-1109.092] (-1108.756) -- 0:00:05 911500 -- (-1113.202) (-1112.707) [-1109.357] (-1110.168) * (-1109.795) [-1112.308] (-1109.054) (-1109.979) -- 0:00:05 912000 -- (-1108.492) (-1111.206) [-1110.250] (-1109.931) * (-1112.067) [-1109.060] (-1108.986) (-1108.909) -- 0:00:05 912500 -- [-1108.909] (-1109.176) (-1111.446) (-1108.907) * (-1112.862) (-1109.880) (-1111.838) [-1108.259] -- 0:00:05 913000 -- [-1108.732] (-1109.853) (-1111.701) (-1108.901) * [-1110.232] (-1111.488) (-1110.731) (-1111.243) -- 0:00:05 913500 -- (-1109.350) (-1110.383) (-1109.394) [-1111.191] * (-1117.074) (-1109.426) [-1109.665] (-1109.875) -- 0:00:05 914000 -- [-1112.234] (-1113.934) (-1109.627) (-1111.455) * (-1115.208) [-1110.416] (-1110.156) (-1110.249) -- 0:00:05 914500 -- (-1109.559) (-1111.372) [-1110.678] (-1111.237) * (-1111.945) (-1112.779) (-1110.302) [-1109.621] -- 0:00:05 915000 -- (-1109.764) (-1112.890) [-1110.114] (-1110.886) * (-1109.600) [-1114.166] (-1111.715) (-1108.999) -- 0:00:05 Average standard deviation of split frequencies: 0.007720 915500 -- (-1109.952) (-1113.017) [-1110.001] (-1109.577) * (-1109.094) [-1110.697] (-1110.133) (-1108.448) -- 0:00:05 916000 -- (-1109.488) (-1113.179) [-1110.833] (-1110.034) * (-1114.597) (-1113.198) [-1109.053] (-1108.545) -- 0:00:05 916500 -- [-1108.603] (-1108.637) (-1111.146) (-1109.452) * (-1111.905) [-1109.979] (-1110.681) (-1109.841) -- 0:00:05 917000 -- (-1108.665) (-1108.542) (-1110.617) [-1109.076] * [-1111.371] (-1111.318) (-1110.122) (-1110.698) -- 0:00:05 917500 -- (-1108.804) [-1112.115] (-1109.082) (-1110.371) * (-1111.792) (-1110.337) (-1109.996) [-1110.586] -- 0:00:05 918000 -- (-1110.790) (-1111.940) [-1110.322] (-1110.593) * [-1115.408] (-1111.414) (-1109.273) (-1112.932) -- 0:00:05 918500 -- (-1108.580) [-1112.188] (-1110.585) (-1109.814) * [-1110.015] (-1111.511) (-1109.364) (-1111.044) -- 0:00:04 919000 -- [-1110.883] (-1114.046) (-1109.153) (-1109.477) * (-1109.791) [-1115.678] (-1110.785) (-1110.101) -- 0:00:04 919500 -- (-1110.013) (-1111.062) (-1109.326) [-1108.398] * (-1109.700) (-1109.104) (-1110.041) [-1112.532] -- 0:00:04 920000 -- (-1110.859) (-1110.436) [-1109.507] (-1111.330) * [-1112.991] (-1113.908) (-1111.920) (-1109.647) -- 0:00:04 Average standard deviation of split frequencies: 0.007817 920500 -- (-1109.897) [-1112.623] (-1109.908) (-1110.853) * (-1114.492) (-1114.628) [-1111.293] (-1110.328) -- 0:00:04 921000 -- (-1110.623) [-1114.180] (-1111.173) (-1110.193) * (-1113.458) (-1113.341) (-1111.201) [-1109.528] -- 0:00:04 921500 -- (-1110.950) (-1111.581) (-1113.697) [-1109.644] * (-1109.133) (-1110.131) [-1109.703] (-1111.059) -- 0:00:04 922000 -- (-1110.146) (-1109.287) (-1111.399) [-1109.587] * [-1115.669] (-1110.712) (-1111.854) (-1116.333) -- 0:00:04 922500 -- [-1110.260] (-1109.199) (-1110.120) (-1112.472) * (-1113.357) [-1109.017] (-1111.791) (-1112.525) -- 0:00:04 923000 -- [-1109.986] (-1113.697) (-1110.723) (-1109.257) * (-1111.485) (-1110.778) (-1110.822) [-1108.988] -- 0:00:04 923500 -- (-1108.693) (-1113.344) (-1112.208) [-1111.601] * (-1114.331) (-1109.790) (-1108.796) [-1108.957] -- 0:00:04 924000 -- [-1109.951] (-1114.209) (-1112.439) (-1109.398) * (-1115.300) [-1111.495] (-1112.250) (-1110.966) -- 0:00:04 924500 -- [-1110.018] (-1116.044) (-1110.235) (-1110.932) * [-1109.830] (-1111.133) (-1110.570) (-1115.477) -- 0:00:04 925000 -- [-1110.497] (-1121.948) (-1110.653) (-1111.018) * (-1108.949) [-1110.019] (-1111.717) (-1109.812) -- 0:00:04 Average standard deviation of split frequencies: 0.007840 925500 -- [-1109.202] (-1112.556) (-1111.387) (-1111.332) * (-1110.943) (-1113.142) (-1109.971) [-1108.885] -- 0:00:04 926000 -- (-1113.940) (-1110.920) (-1113.103) [-1109.383] * [-1109.235] (-1110.617) (-1112.938) (-1111.840) -- 0:00:04 926500 -- (-1110.851) (-1109.150) (-1109.533) [-1112.034] * (-1109.965) (-1112.638) (-1108.816) [-1114.639] -- 0:00:04 927000 -- (-1109.636) (-1109.441) [-1109.708] (-1110.437) * [-1109.870] (-1109.847) (-1109.109) (-1111.541) -- 0:00:04 927500 -- (-1114.172) [-1109.823] (-1108.928) (-1111.414) * (-1111.184) [-1108.919] (-1110.997) (-1109.374) -- 0:00:04 928000 -- (-1109.544) [-1108.778] (-1108.943) (-1109.195) * [-1112.446] (-1110.320) (-1110.756) (-1110.579) -- 0:00:04 928500 -- [-1108.778] (-1112.191) (-1111.651) (-1110.456) * [-1109.280] (-1111.345) (-1111.320) (-1113.325) -- 0:00:04 929000 -- (-1108.649) (-1111.072) (-1110.016) [-1110.791] * (-1110.443) [-1109.390] (-1109.414) (-1111.544) -- 0:00:04 929500 -- [-1108.808] (-1109.566) (-1109.638) (-1112.428) * (-1109.112) (-1112.846) [-1109.994] (-1108.508) -- 0:00:04 930000 -- (-1112.929) (-1110.778) (-1109.164) [-1112.719] * [-1109.539] (-1111.814) (-1112.801) (-1108.946) -- 0:00:04 Average standard deviation of split frequencies: 0.007851 930500 -- [-1113.773] (-1109.079) (-1110.990) (-1108.859) * (-1109.421) (-1109.922) (-1111.074) [-1111.173] -- 0:00:04 931000 -- (-1110.325) (-1112.743) (-1109.979) [-1110.295] * (-1113.845) (-1112.476) (-1109.567) [-1109.892] -- 0:00:04 931500 -- (-1111.513) (-1111.958) (-1109.884) [-1112.309] * (-1112.981) [-1110.575] (-1113.078) (-1111.549) -- 0:00:04 932000 -- (-1111.567) [-1109.682] (-1110.541) (-1111.775) * [-1110.417] (-1112.622) (-1109.809) (-1112.261) -- 0:00:04 932500 -- [-1112.698] (-1113.159) (-1114.077) (-1112.082) * (-1111.373) (-1110.958) [-1110.045] (-1113.038) -- 0:00:04 933000 -- (-1111.613) (-1113.150) (-1110.013) [-1110.493] * (-1112.436) (-1112.675) [-1108.751] (-1110.845) -- 0:00:04 933500 -- (-1111.931) [-1109.541] (-1109.597) (-1114.554) * (-1109.595) (-1108.750) [-1113.963] (-1108.845) -- 0:00:04 934000 -- (-1110.935) (-1109.137) [-1109.191] (-1112.778) * (-1110.579) (-1111.546) [-1109.793] (-1109.789) -- 0:00:04 934500 -- (-1111.515) (-1110.244) (-1109.714) [-1111.108] * [-1109.899] (-1109.693) (-1112.818) (-1109.344) -- 0:00:03 935000 -- (-1109.875) (-1114.006) (-1113.032) [-1109.900] * (-1109.826) (-1111.268) (-1115.783) [-1109.986] -- 0:00:03 Average standard deviation of split frequencies: 0.007689 935500 -- (-1113.232) (-1110.786) (-1108.995) [-1110.625] * [-1109.687] (-1109.535) (-1114.852) (-1110.885) -- 0:00:03 936000 -- (-1111.804) [-1108.955] (-1109.562) (-1110.612) * (-1111.897) [-1110.598] (-1110.872) (-1109.891) -- 0:00:03 936500 -- (-1115.730) (-1109.835) [-1115.869] (-1110.255) * [-1109.329] (-1113.059) (-1110.338) (-1109.038) -- 0:00:03 937000 -- [-1110.129] (-1111.920) (-1110.231) (-1111.665) * (-1115.384) (-1108.996) (-1109.606) [-1109.010] -- 0:00:03 937500 -- [-1111.055] (-1112.784) (-1109.770) (-1111.325) * (-1120.115) (-1108.956) (-1109.418) [-1108.922] -- 0:00:03 938000 -- (-1109.161) (-1115.962) [-1111.490] (-1109.510) * (-1108.770) [-1112.652] (-1111.542) (-1111.985) -- 0:00:03 938500 -- [-1110.066] (-1110.638) (-1112.647) (-1109.872) * [-1110.554] (-1109.756) (-1110.217) (-1109.972) -- 0:00:03 939000 -- [-1110.987] (-1108.816) (-1111.069) (-1108.812) * (-1112.019) (-1110.822) [-1110.132] (-1110.666) -- 0:00:03 939500 -- [-1109.269] (-1109.647) (-1110.826) (-1110.789) * (-1111.642) (-1110.818) [-1110.397] (-1110.399) -- 0:00:03 940000 -- (-1109.275) [-1110.744] (-1110.798) (-1110.246) * (-1111.873) [-1109.859] (-1112.346) (-1110.577) -- 0:00:03 Average standard deviation of split frequencies: 0.008457 940500 -- (-1111.553) (-1112.931) [-1112.505] (-1110.820) * (-1115.035) (-1109.317) [-1109.431] (-1109.498) -- 0:00:03 941000 -- (-1109.399) (-1111.128) [-1109.288] (-1110.625) * [-1110.602] (-1109.268) (-1111.989) (-1110.798) -- 0:00:03 941500 -- (-1110.849) [-1109.475] (-1109.392) (-1112.478) * (-1115.396) (-1111.014) (-1113.343) [-1108.938] -- 0:00:03 942000 -- [-1110.653] (-1110.620) (-1109.552) (-1111.394) * (-1115.952) (-1111.362) [-1109.354] (-1110.190) -- 0:00:03 942500 -- (-1113.226) [-1110.789] (-1109.194) (-1111.924) * [-1109.979] (-1113.028) (-1109.401) (-1109.176) -- 0:00:03 943000 -- (-1110.115) (-1110.380) [-1109.044] (-1109.671) * (-1110.426) (-1112.903) (-1110.709) [-1108.998] -- 0:00:03 943500 -- (-1108.542) (-1111.527) (-1109.908) [-1110.901] * [-1109.663] (-1111.045) (-1113.120) (-1109.627) -- 0:00:03 944000 -- (-1109.206) (-1110.769) (-1109.548) [-1111.635] * (-1110.021) (-1115.565) [-1111.224] (-1109.135) -- 0:00:03 944500 -- (-1109.703) (-1111.488) [-1110.788] (-1113.705) * (-1111.234) (-1114.529) [-1112.120] (-1109.669) -- 0:00:03 945000 -- [-1108.906] (-1118.067) (-1113.538) (-1110.286) * (-1110.967) (-1111.216) (-1110.556) [-1110.668] -- 0:00:03 Average standard deviation of split frequencies: 0.008440 945500 -- [-1108.961] (-1114.325) (-1114.334) (-1113.389) * (-1108.683) (-1112.154) (-1111.296) [-1111.385] -- 0:00:03 946000 -- (-1113.400) (-1111.956) [-1112.600] (-1111.104) * (-1108.770) (-1113.320) (-1109.985) [-1111.117] -- 0:00:03 946500 -- (-1111.066) [-1110.729] (-1113.050) (-1115.348) * [-1109.871] (-1110.240) (-1111.301) (-1110.846) -- 0:00:03 947000 -- (-1109.927) (-1110.315) [-1113.113] (-1109.391) * (-1109.329) (-1110.729) [-1110.249] (-1111.243) -- 0:00:03 947500 -- [-1109.649] (-1113.122) (-1112.515) (-1110.599) * [-1109.676] (-1109.286) (-1110.229) (-1112.361) -- 0:00:03 948000 -- (-1111.014) (-1109.894) [-1113.569] (-1112.234) * (-1110.003) [-1110.928] (-1109.358) (-1110.663) -- 0:00:03 948500 -- (-1112.135) (-1109.144) (-1111.442) [-1110.172] * [-1111.961] (-1112.724) (-1110.658) (-1112.222) -- 0:00:03 949000 -- (-1113.774) (-1111.941) [-1109.382] (-1110.100) * (-1111.754) [-1112.870] (-1109.303) (-1108.559) -- 0:00:03 949500 -- (-1110.429) (-1110.541) (-1109.649) [-1109.940] * (-1110.150) (-1111.667) [-1110.552] (-1109.916) -- 0:00:03 950000 -- [-1114.419] (-1112.541) (-1108.359) (-1109.391) * (-1112.224) (-1110.697) [-1112.681] (-1111.715) -- 0:00:03 Average standard deviation of split frequencies: 0.008740 950500 -- (-1113.850) (-1111.815) [-1108.359] (-1112.366) * (-1108.728) [-1112.105] (-1113.380) (-1111.408) -- 0:00:03 951000 -- (-1110.379) (-1109.441) [-1108.397] (-1114.301) * [-1110.177] (-1112.900) (-1110.084) (-1114.458) -- 0:00:02 951500 -- (-1112.437) [-1109.148] (-1110.281) (-1112.462) * [-1108.913] (-1112.259) (-1111.646) (-1111.685) -- 0:00:02 952000 -- (-1111.807) (-1109.626) [-1108.930] (-1115.904) * (-1110.661) (-1113.507) [-1117.323] (-1111.766) -- 0:00:02 952500 -- (-1111.569) (-1108.925) [-1109.173] (-1110.994) * (-1109.498) [-1112.929] (-1113.567) (-1110.838) -- 0:00:02 953000 -- (-1111.153) (-1108.918) (-1108.875) [-1108.860] * (-1109.493) (-1112.356) (-1113.311) [-1112.297] -- 0:00:02 953500 -- (-1113.986) (-1110.851) (-1109.220) [-1108.619] * (-1108.544) (-1108.909) [-1110.205] (-1111.093) -- 0:00:02 954000 -- [-1110.705] (-1115.819) (-1112.338) (-1114.980) * (-1113.114) [-1108.627] (-1109.705) (-1112.921) -- 0:00:02 954500 -- (-1114.585) (-1110.554) [-1109.107] (-1109.145) * [-1113.310] (-1108.573) (-1111.083) (-1111.178) -- 0:00:02 955000 -- (-1110.127) (-1109.879) (-1111.004) [-1111.736] * (-1110.000) (-1111.444) [-1110.471] (-1114.218) -- 0:00:02 Average standard deviation of split frequencies: 0.008416 955500 -- [-1109.347] (-1113.174) (-1108.981) (-1113.849) * (-1110.118) [-1110.394] (-1109.517) (-1110.936) -- 0:00:02 956000 -- [-1112.410] (-1108.823) (-1109.895) (-1115.751) * (-1114.509) (-1108.410) (-1110.741) [-1109.777] -- 0:00:02 956500 -- (-1111.352) (-1109.307) (-1112.000) [-1111.858] * [-1111.885] (-1109.962) (-1110.164) (-1111.711) -- 0:00:02 957000 -- (-1109.669) (-1110.069) [-1109.549] (-1114.353) * (-1112.104) (-1111.747) (-1112.018) [-1111.388] -- 0:00:02 957500 -- [-1113.261] (-1109.522) (-1110.959) (-1110.533) * [-1110.457] (-1111.928) (-1109.461) (-1112.329) -- 0:00:02 958000 -- (-1112.734) (-1110.849) [-1113.863] (-1110.121) * (-1110.491) (-1110.557) (-1114.002) [-1118.646] -- 0:00:02 958500 -- (-1110.423) [-1112.437] (-1112.635) (-1109.844) * (-1112.481) [-1109.831] (-1118.217) (-1116.733) -- 0:00:02 959000 -- (-1109.068) [-1109.251] (-1120.595) (-1108.753) * [-1109.775] (-1110.699) (-1112.098) (-1110.779) -- 0:00:02 959500 -- (-1110.013) (-1110.214) [-1109.127] (-1109.138) * [-1111.217] (-1110.107) (-1112.372) (-1110.859) -- 0:00:02 960000 -- (-1116.785) (-1112.712) (-1110.138) [-1108.932] * [-1111.148] (-1108.850) (-1111.185) (-1111.182) -- 0:00:02 Average standard deviation of split frequencies: 0.008407 960500 -- (-1116.448) (-1110.574) [-1112.054] (-1109.031) * (-1110.743) [-1110.173] (-1110.768) (-1110.585) -- 0:00:02 961000 -- (-1112.065) [-1109.902] (-1111.624) (-1110.790) * (-1109.795) (-1108.903) [-1108.596] (-1113.941) -- 0:00:02 961500 -- (-1114.015) (-1113.725) (-1114.029) [-1112.096] * (-1110.871) (-1112.221) (-1111.861) [-1112.876] -- 0:00:02 962000 -- (-1111.587) (-1110.030) [-1113.996] (-1109.329) * (-1114.372) [-1111.006] (-1111.918) (-1110.526) -- 0:00:02 962500 -- (-1114.651) [-1110.287] (-1112.159) (-1111.547) * (-1111.286) (-1111.598) [-1109.654] (-1110.933) -- 0:00:02 963000 -- (-1111.025) (-1109.880) (-1111.549) [-1109.400] * [-1109.165] (-1108.709) (-1111.381) (-1111.190) -- 0:00:02 963500 -- [-1110.183] (-1111.325) (-1110.788) (-1109.867) * (-1110.911) (-1109.988) [-1109.591] (-1108.801) -- 0:00:02 964000 -- (-1110.491) (-1110.472) [-1112.128] (-1109.660) * (-1111.375) [-1109.716] (-1114.659) (-1111.360) -- 0:00:02 964500 -- [-1108.831] (-1113.230) (-1114.452) (-1108.719) * [-1111.370] (-1110.079) (-1110.771) (-1116.160) -- 0:00:02 965000 -- [-1111.874] (-1112.406) (-1110.352) (-1112.631) * [-1108.529] (-1112.049) (-1110.000) (-1112.842) -- 0:00:02 Average standard deviation of split frequencies: 0.008198 965500 -- [-1110.302] (-1108.404) (-1111.466) (-1113.968) * (-1111.007) (-1109.034) [-1110.155] (-1110.026) -- 0:00:02 966000 -- (-1109.672) (-1108.390) (-1109.075) [-1111.694] * (-1109.372) [-1111.336] (-1111.274) (-1112.290) -- 0:00:02 966500 -- (-1109.521) [-1108.583] (-1111.541) (-1113.347) * [-1108.968] (-1111.475) (-1110.109) (-1110.640) -- 0:00:02 967000 -- (-1109.256) (-1108.659) (-1111.591) [-1109.831] * (-1111.900) (-1109.870) [-1109.952] (-1108.786) -- 0:00:02 967500 -- [-1109.276] (-1109.862) (-1110.246) (-1108.306) * (-1110.008) (-1110.639) (-1109.425) [-1108.890] -- 0:00:01 968000 -- [-1110.214] (-1108.999) (-1113.657) (-1112.149) * [-1110.110] (-1110.247) (-1110.568) (-1111.736) -- 0:00:01 968500 -- (-1110.157) (-1111.372) [-1111.522] (-1108.875) * (-1108.247) (-1109.803) (-1109.147) [-1109.974] -- 0:00:01 969000 -- (-1110.790) (-1109.461) (-1112.065) [-1110.409] * [-1110.968] (-1111.210) (-1110.074) (-1109.292) -- 0:00:01 969500 -- (-1110.813) (-1109.284) [-1110.200] (-1109.473) * (-1111.186) [-1109.248] (-1109.155) (-1108.863) -- 0:00:01 970000 -- [-1114.311] (-1109.445) (-1112.517) (-1112.955) * (-1110.362) [-1110.567] (-1109.686) (-1109.589) -- 0:00:01 Average standard deviation of split frequencies: 0.008224 970500 -- (-1111.108) (-1111.866) (-1113.177) [-1114.185] * [-1108.788] (-1109.679) (-1111.197) (-1111.646) -- 0:00:01 971000 -- (-1112.816) (-1114.091) [-1109.830] (-1112.571) * (-1109.767) (-1110.357) [-1111.796] (-1113.960) -- 0:00:01 971500 -- [-1109.766] (-1109.216) (-1109.732) (-1112.160) * (-1112.754) (-1111.934) (-1113.321) [-1113.857] -- 0:00:01 972000 -- [-1110.872] (-1113.114) (-1111.808) (-1113.150) * [-1111.808] (-1111.616) (-1110.393) (-1112.962) -- 0:00:01 972500 -- (-1109.970) (-1108.839) (-1109.654) [-1110.890] * (-1109.525) [-1111.471] (-1109.325) (-1111.612) -- 0:00:01 973000 -- [-1109.733] (-1110.897) (-1111.645) (-1108.931) * (-1110.753) [-1109.276] (-1110.987) (-1109.722) -- 0:00:01 973500 -- [-1109.639] (-1112.331) (-1111.667) (-1111.707) * (-1108.748) (-1109.618) [-1111.871] (-1112.080) -- 0:00:01 974000 -- (-1113.380) [-1110.351] (-1109.868) (-1110.312) * (-1110.202) (-1108.649) (-1111.866) [-1109.937] -- 0:00:01 974500 -- (-1111.611) [-1110.322] (-1110.507) (-1113.669) * (-1108.795) [-1109.479] (-1112.844) (-1111.123) -- 0:00:01 975000 -- (-1112.764) (-1110.558) (-1109.569) [-1111.893] * (-1110.575) (-1110.262) [-1112.316] (-1109.108) -- 0:00:01 Average standard deviation of split frequencies: 0.008308 975500 -- (-1109.785) (-1109.984) [-1110.636] (-1112.079) * (-1112.019) (-1112.002) (-1112.413) [-1109.119] -- 0:00:01 976000 -- (-1110.368) (-1111.548) [-1113.605] (-1112.184) * (-1112.292) (-1111.487) (-1112.786) [-1110.144] -- 0:00:01 976500 -- (-1111.417) (-1108.807) [-1109.802] (-1114.443) * [-1110.804] (-1110.750) (-1109.491) (-1114.258) -- 0:00:01 977000 -- (-1112.248) [-1110.552] (-1111.277) (-1109.374) * [-1114.634] (-1110.434) (-1109.880) (-1112.113) -- 0:00:01 977500 -- (-1112.933) (-1112.073) (-1114.717) [-1110.415] * (-1113.408) [-1110.958] (-1110.598) (-1111.369) -- 0:00:01 978000 -- [-1112.180] (-1113.774) (-1110.544) (-1111.818) * (-1111.501) (-1110.899) (-1108.887) [-1108.795] -- 0:00:01 978500 -- (-1110.545) (-1110.237) (-1109.166) [-1112.446] * (-1116.448) [-1110.223] (-1108.932) (-1109.016) -- 0:00:01 979000 -- [-1111.560] (-1109.359) (-1109.621) (-1112.103) * (-1113.037) (-1113.755) (-1108.810) [-1112.350] -- 0:00:01 979500 -- [-1110.057] (-1111.500) (-1109.066) (-1112.587) * (-1113.380) [-1109.884] (-1108.873) (-1110.909) -- 0:00:01 980000 -- [-1111.838] (-1112.950) (-1113.413) (-1110.880) * (-1111.944) [-1109.877] (-1112.368) (-1111.409) -- 0:00:01 Average standard deviation of split frequencies: 0.008236 980500 -- (-1113.936) [-1110.865] (-1109.689) (-1109.969) * (-1112.867) (-1110.952) (-1111.047) [-1109.215] -- 0:00:01 981000 -- (-1112.533) [-1111.257] (-1111.243) (-1110.060) * (-1112.352) (-1112.881) (-1115.199) [-1117.682] -- 0:00:01 981500 -- (-1110.876) (-1114.712) (-1109.579) [-1108.918] * [-1110.841] (-1111.143) (-1113.891) (-1114.754) -- 0:00:01 982000 -- [-1110.372] (-1115.246) (-1111.379) (-1114.312) * [-1112.936] (-1109.786) (-1116.133) (-1111.363) -- 0:00:01 982500 -- (-1110.607) (-1114.223) (-1111.995) [-1108.564] * (-1110.027) (-1109.364) (-1109.966) [-1111.691] -- 0:00:01 983000 -- [-1113.799] (-1109.834) (-1109.563) (-1112.432) * (-1112.787) [-1110.528] (-1109.812) (-1112.629) -- 0:00:01 983500 -- (-1110.389) (-1108.965) [-1109.767] (-1112.722) * [-1108.499] (-1109.977) (-1109.555) (-1113.194) -- 0:00:01 984000 -- (-1117.170) [-1109.202] (-1112.026) (-1110.528) * (-1110.348) (-1109.108) [-1109.054] (-1111.819) -- 0:00:00 984500 -- (-1112.836) [-1110.446] (-1111.085) (-1110.227) * [-1109.023] (-1109.845) (-1108.716) (-1112.219) -- 0:00:00 985000 -- [-1109.123] (-1109.542) (-1111.082) (-1113.375) * (-1108.723) (-1109.625) (-1109.148) [-1113.355] -- 0:00:00 Average standard deviation of split frequencies: 0.008191 985500 -- [-1110.084] (-1110.918) (-1109.072) (-1108.697) * (-1108.625) [-1109.438] (-1110.102) (-1112.665) -- 0:00:00 986000 -- (-1110.492) [-1111.116] (-1108.673) (-1109.785) * (-1109.094) (-1110.633) [-1109.685] (-1113.789) -- 0:00:00 986500 -- (-1110.292) [-1112.194] (-1109.820) (-1109.067) * (-1110.430) [-1110.284] (-1112.545) (-1111.260) -- 0:00:00 987000 -- (-1111.837) (-1109.415) (-1108.929) [-1109.851] * (-1109.380) [-1113.038] (-1113.280) (-1111.066) -- 0:00:00 987500 -- [-1110.157] (-1108.552) (-1111.256) (-1111.173) * (-1109.787) (-1111.968) [-1112.898] (-1111.154) -- 0:00:00 988000 -- (-1112.458) (-1113.918) [-1110.752] (-1109.439) * (-1111.971) [-1110.449] (-1113.529) (-1110.530) -- 0:00:00 988500 -- (-1112.232) (-1114.023) [-1113.783] (-1110.914) * [-1110.575] (-1111.175) (-1112.739) (-1111.160) -- 0:00:00 989000 -- (-1111.523) (-1111.568) [-1111.779] (-1109.011) * (-1110.625) (-1110.444) [-1110.822] (-1109.562) -- 0:00:00 989500 -- (-1109.459) [-1109.129] (-1111.059) (-1110.627) * (-1110.783) (-1109.703) [-1111.639] (-1111.097) -- 0:00:00 990000 -- (-1110.031) [-1110.403] (-1109.575) (-1111.243) * [-1112.616] (-1108.817) (-1109.665) (-1108.844) -- 0:00:00 Average standard deviation of split frequencies: 0.008375 990500 -- (-1110.905) (-1108.984) (-1111.992) [-1110.759] * (-1110.313) (-1109.649) [-1110.720] (-1109.818) -- 0:00:00 991000 -- (-1110.143) [-1109.922] (-1113.899) (-1109.919) * (-1109.402) [-1111.699] (-1109.695) (-1109.561) -- 0:00:00 991500 -- (-1110.609) [-1110.346] (-1111.827) (-1109.185) * [-1110.673] (-1112.954) (-1108.860) (-1111.112) -- 0:00:00 992000 -- (-1109.337) [-1109.864] (-1111.993) (-1109.150) * (-1111.245) (-1111.362) [-1112.580] (-1112.405) -- 0:00:00 992500 -- [-1109.050] (-1111.201) (-1110.449) (-1108.850) * (-1110.132) (-1113.116) [-1111.259] (-1113.004) -- 0:00:00 993000 -- (-1114.892) (-1109.100) (-1114.278) [-1110.685] * (-1109.192) [-1109.362] (-1109.039) (-1113.400) -- 0:00:00 993500 -- (-1111.709) (-1110.970) (-1111.810) [-1108.514] * [-1109.729] (-1109.125) (-1110.310) (-1109.750) -- 0:00:00 994000 -- (-1112.151) [-1109.110] (-1109.072) (-1108.595) * (-1109.463) (-1111.174) (-1110.176) [-1113.085] -- 0:00:00 994500 -- (-1111.500) [-1111.127] (-1109.015) (-1108.873) * (-1109.719) [-1109.910] (-1111.485) (-1109.455) -- 0:00:00 995000 -- [-1115.814] (-1111.268) (-1109.753) (-1108.904) * (-1111.857) [-1112.242] (-1109.378) (-1112.938) -- 0:00:00 Average standard deviation of split frequencies: 0.008141 995500 -- [-1110.058] (-1110.298) (-1110.324) (-1109.104) * (-1112.166) (-1112.059) [-1110.720] (-1112.143) -- 0:00:00 996000 -- (-1110.714) (-1113.376) (-1109.067) [-1110.714] * (-1111.707) [-1109.981] (-1111.450) (-1113.649) -- 0:00:00 996500 -- (-1108.773) (-1111.467) (-1108.756) [-1108.708] * (-1111.541) [-1110.881] (-1114.665) (-1108.752) -- 0:00:00 997000 -- [-1108.501] (-1112.255) (-1110.877) (-1109.839) * [-1111.053] (-1110.567) (-1114.938) (-1109.532) -- 0:00:00 997500 -- [-1109.890] (-1111.450) (-1111.309) (-1116.003) * [-1111.173] (-1109.920) (-1112.672) (-1111.691) -- 0:00:00 998000 -- (-1114.452) [-1109.359] (-1111.704) (-1110.042) * (-1111.639) (-1109.943) (-1115.094) [-1113.018] -- 0:00:00 998500 -- (-1109.086) (-1109.168) [-1108.807] (-1110.082) * (-1111.381) [-1108.979] (-1109.865) (-1112.196) -- 0:00:00 999000 -- (-1109.273) (-1112.584) (-1109.647) [-1109.286] * (-1110.648) [-1109.767] (-1111.452) (-1110.454) -- 0:00:00 999500 -- (-1110.449) (-1113.921) [-1109.502] (-1113.166) * [-1110.866] (-1108.726) (-1109.425) (-1109.314) -- 0:00:00 1000000 -- (-1112.204) (-1112.195) [-1111.364] (-1109.114) * (-1110.513) (-1113.454) [-1109.235] (-1109.134) -- 0:00:00 Average standard deviation of split frequencies: 0.008228 Analysis completed in 1 mins 1 seconds Analysis used 60.61 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1108.20 Likelihood of best state for "cold" chain of run 2 was -1108.20 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.3 % ( 67 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 27.0 % ( 21 %) Dirichlet(Pi{all}) 28.3 % ( 31 %) Slider(Pi{all}) 78.8 % ( 55 %) Multiplier(Alpha{1,2}) 77.6 % ( 46 %) Multiplier(Alpha{3}) 20.2 % ( 18 %) Slider(Pinvar{all}) 98.7 % ( 94 %) ExtSPR(Tau{all},V{all}) 70.5 % ( 71 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 25 %) Multiplier(V{all}) 97.4 % ( 99 %) Nodeslider(V{all}) 30.3 % ( 25 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.6 % ( 67 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 26.8 % ( 27 %) Dirichlet(Pi{all}) 29.0 % ( 31 %) Slider(Pi{all}) 78.7 % ( 54 %) Multiplier(Alpha{1,2}) 77.4 % ( 40 %) Multiplier(Alpha{3}) 19.6 % ( 19 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 75 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 88 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 27 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.5 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166268 0.82 0.67 3 | 166818 166732 0.84 4 | 166771 166117 167294 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166637 0.82 0.67 3 | 166554 166691 0.84 4 | 166947 166906 166265 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1109.82 |1 2 | | 2 2 | | 2 2 | | * 2 1 2 2 1| | 1 1 1 2 1 1 11 | | 1 1 1 2 1 1 1 2* 21212 21 2 1 | | 1 2 1 2 2 1 1 1 2 1 111 | | *1 2221 122 2 1 1 1 121 112 1 | |2 * 2 1 2 2* * 2 *2 2 2 | | 2 2 22 2 2 1 1 2 22| | 1 1 1 1 2 2 | | 2 1 2 1 | | 2 1 1 2 | | 2 1 | | 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1111.74 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1109.95 -1113.43 2 -1109.94 -1113.87 -------------------------------------- TOTAL -1109.94 -1113.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902065 0.088072 0.386960 1.494742 0.870721 1305.03 1403.02 1.000 r(A<->C){all} 0.178531 0.022157 0.000094 0.482802 0.142521 218.37 250.19 1.001 r(A<->G){all} 0.179582 0.022355 0.000100 0.485219 0.141037 115.28 200.53 1.000 r(A<->T){all} 0.160966 0.018394 0.000121 0.439138 0.126247 194.67 259.64 1.006 r(C<->G){all} 0.157485 0.017005 0.000124 0.415606 0.126470 219.39 227.39 1.000 r(C<->T){all} 0.165162 0.019629 0.000044 0.456782 0.126685 96.65 189.01 1.006 r(G<->T){all} 0.158274 0.019104 0.000076 0.436428 0.121012 214.31 278.53 1.001 pi(A){all} 0.160965 0.000167 0.136336 0.186529 0.160425 1297.17 1399.09 1.000 pi(C){all} 0.278230 0.000242 0.249051 0.309356 0.278067 1214.56 1265.08 1.000 pi(G){all} 0.344266 0.000291 0.311446 0.377867 0.344278 1150.27 1206.52 1.000 pi(T){all} 0.216539 0.000207 0.187748 0.242739 0.216363 1385.71 1406.61 1.000 alpha{1,2} 0.417241 0.242077 0.000204 1.366887 0.240380 1200.86 1269.74 1.000 alpha{3} 0.455620 0.225402 0.000152 1.420161 0.294439 1245.73 1345.97 1.000 pinvar{all} 0.998119 0.000005 0.993808 0.999998 0.998834 1129.29 1248.66 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ...**. 8 -- .***.* 9 -- ...*.* 10 -- .****. 11 -- ..**.. 12 -- .*.*.. 13 -- .**... 14 -- ..*.*. 15 -- .*.*** 16 -- ..**** 17 -- ..*..* 18 -- ....** 19 -- .**.** 20 -- .*...* 21 -- .*..*. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 447 0.148901 0.004240 0.145903 0.151899 2 8 447 0.148901 0.011777 0.140573 0.157229 2 9 443 0.147568 0.009893 0.140573 0.154564 2 10 442 0.147235 0.015075 0.136576 0.157895 2 11 442 0.147235 0.002827 0.145237 0.149234 2 12 439 0.146236 0.008951 0.139907 0.152565 2 13 437 0.145570 0.003298 0.143238 0.147901 2 14 434 0.144570 0.006595 0.139907 0.149234 2 15 424 0.141239 0.002827 0.139241 0.143238 2 16 423 0.140906 0.016488 0.129247 0.152565 2 17 417 0.138907 0.008009 0.133245 0.144570 2 18 417 0.138907 0.001413 0.137908 0.139907 2 19 407 0.135576 0.007066 0.130580 0.140573 2 20 402 0.133911 0.019786 0.119920 0.147901 2 21 391 0.130247 0.005182 0.126582 0.133911 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.098962 0.009796 0.000017 0.301650 0.067658 1.000 2 length{all}[2] 0.097311 0.009342 0.000064 0.293026 0.066680 1.001 2 length{all}[3] 0.100073 0.010083 0.000016 0.299355 0.069176 1.000 2 length{all}[4] 0.102502 0.010461 0.000049 0.313412 0.070196 1.000 2 length{all}[5] 0.101478 0.010081 0.000018 0.301883 0.070176 1.000 2 length{all}[6] 0.101657 0.010040 0.000042 0.299482 0.070952 1.000 2 length{all}[7] 0.102178 0.010058 0.000304 0.308639 0.069739 0.998 2 length{all}[8] 0.097648 0.009229 0.000271 0.267819 0.062288 0.998 2 length{all}[9] 0.097178 0.008129 0.000823 0.292433 0.071210 0.998 2 length{all}[10] 0.092721 0.008534 0.000230 0.266229 0.064388 0.998 2 length{all}[11] 0.097410 0.008626 0.000000 0.261410 0.071368 1.002 2 length{all}[12] 0.100539 0.010800 0.000285 0.347285 0.069706 0.998 2 length{all}[13] 0.094534 0.009739 0.000284 0.279740 0.064555 0.999 2 length{all}[14] 0.106163 0.012984 0.000132 0.309567 0.066768 0.998 2 length{all}[15] 0.094152 0.008930 0.000135 0.299268 0.066404 1.006 2 length{all}[16] 0.102341 0.009957 0.000022 0.309300 0.071651 0.998 2 length{all}[17] 0.099298 0.009080 0.000249 0.288716 0.068342 0.998 2 length{all}[18] 0.105634 0.012074 0.000023 0.321606 0.072831 1.000 2 length{all}[19] 0.099640 0.011778 0.000034 0.279478 0.068631 1.002 2 length{all}[20] 0.106464 0.011891 0.000718 0.315497 0.070147 0.998 2 length{all}[21] 0.097476 0.008190 0.000079 0.268603 0.071651 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008228 Maximum standard deviation of split frequencies = 0.019786 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.006 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /--------------------------------------------------------------------- C1 (1) | |-------------------------------------------------------------------- C2 (2) | |---------------------------------------------------------------------- C3 (3) + |----------------------------------------------------------------------- C4 (4) | |----------------------------------------------------------------------- C5 (5) | \------------------------------------------------------------------------ C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 822 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 51 patterns at 274 / 274 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 51 patterns at 274 / 274 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 49776 bytes for conP 4488 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.038720 0.102888 0.023900 0.045515 0.082892 0.055695 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1157.743663 Iterating by ming2 Initial: fx= 1157.743663 x= 0.03872 0.10289 0.02390 0.04551 0.08289 0.05569 0.30000 1.30000 1 h-m-p 0.0000 0.0001 656.6766 ++ 1119.474297 m 0.0001 13 | 1/8 2 h-m-p 0.0010 0.0069 53.8462 -----------.. | 1/8 3 h-m-p 0.0000 0.0001 601.4312 ++ 1099.524493 m 0.0001 44 | 2/8 4 h-m-p 0.0008 0.0107 39.0464 -----------.. | 2/8 5 h-m-p 0.0000 0.0000 538.7883 ++ 1092.180720 m 0.0000 75 | 3/8 6 h-m-p 0.0004 0.0150 29.9592 ----------.. | 3/8 7 h-m-p 0.0000 0.0000 466.4227 ++ 1083.915548 m 0.0000 105 | 4/8 8 h-m-p 0.0006 0.0198 22.6906 -----------.. | 4/8 9 h-m-p 0.0000 0.0001 380.6620 ++ 1069.105145 m 0.0001 136 | 5/8 10 h-m-p 0.0019 0.0359 14.2685 ------------.. | 5/8 11 h-m-p 0.0000 0.0001 270.0693 ++ 1063.605788 m 0.0001 168 | 6/8 12 h-m-p 0.2750 8.0000 0.0000 +++ 1063.605788 m 8.0000 180 | 6/8 13 h-m-p 0.0287 8.0000 0.0018 -----C 1063.605788 0 0.0000 198 | 6/8 14 h-m-p 0.0160 8.0000 0.0001 +++++ 1063.605788 m 8.0000 214 | 6/8 15 h-m-p 0.0160 8.0000 0.1967 +++Y 1063.605786 0 2.0369 230 | 6/8 16 h-m-p 1.6000 8.0000 0.0042 Y 1063.605786 0 1.1955 243 | 6/8 17 h-m-p 1.6000 8.0000 0.0001 -C 1063.605786 0 0.1000 257 | 6/8 18 h-m-p 0.8240 8.0000 0.0000 Y 1063.605786 0 0.8240 270 | 6/8 19 h-m-p 1.6000 8.0000 0.0000 N 1063.605786 0 1.6000 283 | 6/8 20 h-m-p 0.7464 8.0000 0.0000 -Y 1063.605786 0 0.0466 297 | 6/8 21 h-m-p 0.0243 8.0000 0.0000 --Y 1063.605786 0 0.0004 312 Out.. lnL = -1063.605786 313 lfun, 313 eigenQcodon, 1878 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.015705 0.073802 0.073107 0.069052 0.064057 0.101720 0.667304 0.523200 0.100958 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.301611 np = 9 lnL0 = -1163.960360 Iterating by ming2 Initial: fx= 1163.960360 x= 0.01571 0.07380 0.07311 0.06905 0.06406 0.10172 0.66730 0.52320 0.10096 1 h-m-p 0.0000 0.0001 578.7454 ++ 1141.618364 m 0.0001 14 | 1/9 2 h-m-p 0.0001 0.0003 397.8577 ++ 1106.265661 m 0.0003 26 | 2/9 3 h-m-p 0.0002 0.0012 227.2194 ++ 1064.789809 m 0.0012 38 | 3/9 4 h-m-p 0.0000 0.0000 307.6348 ++ 1064.479306 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0001 1110.8454 ++ 1063.700844 m 0.0001 62 | 5/9 6 h-m-p 0.0000 0.0000 117.7021 ++ 1063.605986 m 0.0000 74 | 7/9 7 h-m-p 1.6000 8.0000 0.0000 -----Y 1063.605986 0 0.0004 91 Out.. lnL = -1063.605986 92 lfun, 276 eigenQcodon, 1104 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.049779 0.107345 0.044655 0.107403 0.040026 0.055846 0.618892 1.297413 0.525220 0.142902 1.153379 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 9.459633 np = 11 lnL0 = -1165.651609 Iterating by ming2 Initial: fx= 1165.651609 x= 0.04978 0.10735 0.04466 0.10740 0.04003 0.05585 0.61889 1.29741 0.52522 0.14290 1.15338 1 h-m-p 0.0000 0.0002 577.4067 +++ 1107.159674 m 0.0002 17 | 1/11 2 h-m-p 0.0000 0.0001 290.6117 ++ 1101.093814 m 0.0001 31 | 2/11 3 h-m-p 0.0000 0.0000 56337.2224 ++ 1095.812601 m 0.0000 45 | 3/11 4 h-m-p 0.0000 0.0000 32270.9236 ++ 1091.154167 m 0.0000 59 | 4/11 5 h-m-p 0.0000 0.0000 6982.7707 ++ 1080.752209 m 0.0000 73 | 5/11 6 h-m-p 0.0016 0.0639 19.4131 -----------.. | 5/11 7 h-m-p 0.0000 0.0001 365.8891 ++ 1063.622200 m 0.0001 110 | 6/11 8 h-m-p 0.0041 0.1287 7.9707 ------------.. | 6/11 9 h-m-p 0.0000 0.0000 269.9651 ++ 1063.605760 m 0.0000 148 | 7/11 10 h-m-p 0.0160 8.0000 0.0000 Y 1063.605760 0 0.0160 162 | 7/11 11 h-m-p 0.0496 8.0000 0.0000 C 1063.605760 0 0.0469 180 Out.. lnL = -1063.605760 181 lfun, 724 eigenQcodon, 3258 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1063.622707 S = -1063.602467 -0.007763 Calculating f(w|X), posterior probabilities of site classes. did 10 / 51 patterns 0:02 did 20 / 51 patterns 0:02 did 30 / 51 patterns 0:02 did 40 / 51 patterns 0:02 did 50 / 51 patterns 0:02 did 51 / 51 patterns 0:02 Time used: 0:02 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.010683 0.062365 0.084781 0.050807 0.016062 0.104574 0.610666 0.657198 1.203358 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 11.927303 np = 9 lnL0 = -1148.956064 Iterating by ming2 Initial: fx= 1148.956064 x= 0.01068 0.06236 0.08478 0.05081 0.01606 0.10457 0.61067 0.65720 1.20336 1 h-m-p 0.0000 0.0000 613.8630 ++ 1132.977812 m 0.0000 14 | 1/9 2 h-m-p 0.0003 0.0014 70.4902 ++ 1127.321155 m 0.0014 26 | 2/9 3 h-m-p 0.0000 0.0002 811.5275 ++ 1116.146742 m 0.0002 38 | 3/9 4 h-m-p 0.0001 0.0006 519.9981 ++ 1101.111224 m 0.0006 50 | 4/9 5 h-m-p 0.0002 0.0009 220.2206 ++ 1092.650487 m 0.0009 62 | 5/9 6 h-m-p 0.0009 0.0044 158.9862 ++ 1088.093555 m 0.0044 74 | 6/9 7 h-m-p 0.0115 4.7030 40.1762 -------------.. | 6/9 8 h-m-p 0.0000 0.0004 237.5949 +++ 1063.605581 m 0.0004 110 | 7/9 9 h-m-p 1.6000 8.0000 0.0000 ++ 1063.605581 m 8.0000 122 | 7/9 10 h-m-p 0.0160 8.0000 0.0003 +++++ 1063.605581 m 8.0000 139 | 7/9 11 h-m-p 0.0013 0.4432 2.1093 -----------.. | 7/9 12 h-m-p 0.0160 8.0000 0.0003 +++++ 1063.605580 m 8.0000 177 | 7/9 13 h-m-p 0.0160 8.0000 0.7662 ------------C 1063.605580 0 0.0000 203 | 7/9 14 h-m-p 0.0160 8.0000 0.0002 +++++ 1063.605580 m 8.0000 220 | 7/9 15 h-m-p 0.0160 8.0000 1.9010 -----------C 1063.605580 0 0.0000 245 | 7/9 16 h-m-p 0.0160 8.0000 0.0000 -Y 1063.605580 0 0.0010 258 | 7/9 17 h-m-p 0.0160 8.0000 0.0001 +++++ 1063.605580 m 8.0000 275 | 7/9 18 h-m-p 0.0002 0.0882 10.9875 +++++ 1063.605535 m 0.0882 292 | 8/9 19 h-m-p 1.6000 8.0000 0.0000 Y 1063.605535 0 1.6000 304 | 8/9 20 h-m-p 0.0160 8.0000 0.0000 Y 1063.605535 0 0.0160 317 Out.. lnL = -1063.605535 318 lfun, 3498 eigenQcodon, 19080 P(t) Time used: 0:07 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.086242 0.049594 0.101484 0.090741 0.091791 0.108928 0.000100 0.900000 0.780391 1.023858 1.151864 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 12.610955 np = 11 lnL0 = -1196.022623 Iterating by ming2 Initial: fx= 1196.022623 x= 0.08624 0.04959 0.10148 0.09074 0.09179 0.10893 0.00011 0.90000 0.78039 1.02386 1.15186 1 h-m-p 0.0000 0.0000 572.6892 ++ 1195.686704 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0027 177.1213 +++++ 1120.891711 m 0.0027 33 | 2/11 3 h-m-p 0.0000 0.0002 1042.7022 ++ 1076.054830 m 0.0002 47 | 3/11 4 h-m-p 0.0001 0.0005 172.7307 ++ 1071.068031 m 0.0005 61 | 4/11 5 h-m-p 0.0000 0.0000 2403.1293 ++ 1070.046898 m 0.0000 75 | 5/11 6 h-m-p 0.0000 0.0000 25708.4261 ++ 1065.713222 m 0.0000 89 | 6/11 7 h-m-p 0.0011 0.0054 14.3147 -----------.. | 6/11 8 h-m-p 0.0000 0.0000 376.1670 ++ 1065.144305 m 0.0000 126 | 7/11 9 h-m-p 0.0001 0.0260 12.1850 +++++ 1064.226318 m 0.0260 143 | 8/11 10 h-m-p 0.0035 0.0174 0.6629 ++ 1063.605535 m 0.0174 157 | 9/11 11 h-m-p 1.6000 8.0000 0.0002 ++ 1063.605535 m 8.0000 174 | 9/11 12 h-m-p 0.2851 8.0000 0.0053 +++ 1063.605535 m 8.0000 191 | 9/11 13 h-m-p 0.2311 8.0000 0.1833 -------Y 1063.605535 0 0.0000 214 | 9/11 14 h-m-p 0.1278 8.0000 0.0000 Y 1063.605535 0 0.1278 230 | 9/11 15 h-m-p 0.0160 8.0000 0.0005 --Y 1063.605535 0 0.0003 248 | 9/11 16 h-m-p 0.0160 8.0000 0.0005 -------Y 1063.605535 0 0.0000 271 Out.. lnL = -1063.605535 272 lfun, 3264 eigenQcodon, 17952 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1063.671834 S = -1063.606572 -0.029042 Calculating f(w|X), posterior probabilities of site classes. did 10 / 51 patterns 0:11 did 20 / 51 patterns 0:12 did 30 / 51 patterns 0:12 did 40 / 51 patterns 0:12 did 50 / 51 patterns 0:12 did 51 / 51 patterns 0:12 Time used: 0:12 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=274 NC_011896_1_WP_010907616_1_238_MLBR_RS01170 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL NC_002677_1_NP_301292_1_164_ML0232 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL ************************************************** NC_011896_1_WP_010907616_1_238_MLBR_RS01170 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL NC_002677_1_NP_301292_1_164_ML0232 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL ************************************************** NC_011896_1_WP_010907616_1_238_MLBR_RS01170 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG NC_002677_1_NP_301292_1_164_ML0232 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG ************************************************** NC_011896_1_WP_010907616_1_238_MLBR_RS01170 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG NC_002677_1_NP_301292_1_164_ML0232 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG ************************************************** NC_011896_1_WP_010907616_1_238_MLBR_RS01170 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL NC_002677_1_NP_301292_1_164_ML0232 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL ************************************************** NC_011896_1_WP_010907616_1_238_MLBR_RS01170 TLHGLRLVFERNREAQRGRLKTAR NC_002677_1_NP_301292_1_164_ML0232 TLHGLRLVFERNREAQRGRLKTAR NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 TLHGLRLVFERNREAQRGRLKTAR NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 TLHGLRLVFERNREAQRGRLKTAR NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 TLHGLRLVFERNREAQRGRLKTAR NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 TLHGLRLVFERNREAQRGRLKTAR ************************
>NC_011896_1_WP_010907616_1_238_MLBR_RS01170 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >NC_002677_1_NP_301292_1_164_ML0232 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC >NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 GTGCTGCTGGCCATCGACGTTCGCAACACGCATACCGTCGTCGGATTGCT GTCCGGATCCAAGGAGCATGCAAAGGTCGTGCAGCAATGGCGGATCCGCA CTGAATCCGAGGTTACCGCGGACGAACTGGCCTTGATTATCGACGGCTTG ATCGGTGATGATTCCGAGCGACTCGCCGGAGCTGCCGCATTGTCGACCGT CCCGTCGGTGCTGCACGAGGTGCGGATCATGCTCGATCAGTACTGGCCGT CGGTGCCGCACGTACTGATCGAACCGGGGGTGCGCACCGGTATCCCGCTG CTGGTAGATAATCCGAAAGAAGTGGGTGCCGACCGGATCGTGAACTGCCT GGCGGCGTTCCACAAGTTCGGTCAAGCTGCCATCGTGGTCGATTTCGGGT CGTCGATCTGCGTGGATGTGGTGTCGGCCAAAGGGGAGTTTCTGGGCGGT GCCATTGCGCCCGGAGTGCAGGTGTCTTCGGATGCCGCGGCTGCCCGCTC TGCCGCGTTGCGCCGCGTTGAGCTGGCCAGACCCCGCTCGGTGGTTGGTA AAAACACGGTCGAATGTATGCAGGCCGGTGTGGTGTTCGGTTTTGCTGGG CTGGTCGATGGCTTAGTCGGCCGCATGCGCCAGGACGTGGAGGAATTTTC CGGCGACTTAGGTAATCGGGTTGCGGTCGTGGCTACCGGGCATACCGCGC CGCTGTTGCTGCCCGAGCTGCATACCGTTGACCACTACGATCGGCACCTG ACCCTTCATGGTCTGCGACTGGTCTTCGAACGCAATCGGGAAGCGCAGCG TGGCCGGTTGAAGACGGCGCGC
>NC_011896_1_WP_010907616_1_238_MLBR_RS01170 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >NC_002677_1_NP_301292_1_164_ML0232 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR >NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGL IGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL LVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGG AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAG LVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHL TLHGLRLVFERNREAQRGRLKTAR
#NEXUS [ID: 0622007634] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907616_1_238_MLBR_RS01170 NC_002677_1_NP_301292_1_164_ML0232 NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 ; end; begin trees; translate 1 NC_011896_1_WP_010907616_1_238_MLBR_RS01170, 2 NC_002677_1_NP_301292_1_164_ML0232, 3 NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760, 4 NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665, 5 NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230, 6 NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06765776,2:0.06668045,3:0.06917594,4:0.07019637,5:0.07017645,6:0.07095175); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06765776,2:0.06668045,3:0.06917594,4:0.07019637,5:0.07017645,6:0.07095175); end;
Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1109.95 -1113.43 2 -1109.94 -1113.87 -------------------------------------- TOTAL -1109.94 -1113.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0232/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902065 0.088072 0.386960 1.494742 0.870721 1305.03 1403.02 1.000 r(A<->C){all} 0.178531 0.022157 0.000094 0.482802 0.142521 218.37 250.19 1.001 r(A<->G){all} 0.179582 0.022355 0.000100 0.485219 0.141037 115.28 200.53 1.000 r(A<->T){all} 0.160966 0.018394 0.000121 0.439138 0.126247 194.67 259.64 1.006 r(C<->G){all} 0.157485 0.017005 0.000124 0.415606 0.126470 219.39 227.39 1.000 r(C<->T){all} 0.165162 0.019629 0.000044 0.456782 0.126685 96.65 189.01 1.006 r(G<->T){all} 0.158274 0.019104 0.000076 0.436428 0.121012 214.31 278.53 1.001 pi(A){all} 0.160965 0.000167 0.136336 0.186529 0.160425 1297.17 1399.09 1.000 pi(C){all} 0.278230 0.000242 0.249051 0.309356 0.278067 1214.56 1265.08 1.000 pi(G){all} 0.344266 0.000291 0.311446 0.377867 0.344278 1150.27 1206.52 1.000 pi(T){all} 0.216539 0.000207 0.187748 0.242739 0.216363 1385.71 1406.61 1.000 alpha{1,2} 0.417241 0.242077 0.000204 1.366887 0.240380 1200.86 1269.74 1.000 alpha{3} 0.455620 0.225402 0.000152 1.420161 0.294439 1245.73 1345.97 1.000 pinvar{all} 0.998119 0.000005 0.993808 0.999998 0.998834 1129.29 1248.66 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0232/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 274 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 3 3 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1 TTC 5 5 5 5 5 5 | TCC 5 5 5 5 5 5 | TAC 2 2 2 2 2 2 | TGC 2 2 2 2 2 2 Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 7 7 7 7 7 7 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 5 5 5 5 5 5 | Arg CGT 1 1 1 1 1 1 CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 5 5 5 5 5 5 | CGC 11 11 11 11 11 11 CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2 CTG 18 18 18 18 18 18 | CCG 7 7 7 7 7 7 | CAG 6 6 6 6 6 6 | CGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0 ATC 10 10 10 10 10 10 | ACC 8 8 8 8 8 8 | AAC 3 3 3 3 3 3 | AGC 0 0 0 0 0 0 ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 1 1 1 1 1 1 Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 6 6 6 6 6 6 | Ala GCT 5 5 5 5 5 5 | Asp GAT 9 9 9 9 9 9 | Gly GGT 10 10 10 10 10 10 GTC 10 10 10 10 10 10 | GCC 13 13 13 13 13 13 | GAC 7 7 7 7 7 7 | GGC 6 6 6 6 6 6 GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 8 8 8 8 8 8 | GGA 4 4 4 4 4 4 GTG 19 19 19 19 19 19 | GCG 10 10 10 10 10 10 | GAG 8 8 8 8 8 8 | GGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907616_1_238_MLBR_RS01170 position 1: T:0.14234 C:0.25547 A:0.14964 G:0.45255 position 2: T:0.32847 C:0.24453 A:0.23723 G:0.18978 position 3: T:0.17883 C:0.33577 A:0.09489 G:0.39051 Average T:0.21655 C:0.27859 A:0.16058 G:0.34428 #2: NC_002677_1_NP_301292_1_164_ML0232 position 1: T:0.14234 C:0.25547 A:0.14964 G:0.45255 position 2: T:0.32847 C:0.24453 A:0.23723 G:0.18978 position 3: T:0.17883 C:0.33577 A:0.09489 G:0.39051 Average T:0.21655 C:0.27859 A:0.16058 G:0.34428 #3: NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760 position 1: T:0.14234 C:0.25547 A:0.14964 G:0.45255 position 2: T:0.32847 C:0.24453 A:0.23723 G:0.18978 position 3: T:0.17883 C:0.33577 A:0.09489 G:0.39051 Average T:0.21655 C:0.27859 A:0.16058 G:0.34428 #4: NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665 position 1: T:0.14234 C:0.25547 A:0.14964 G:0.45255 position 2: T:0.32847 C:0.24453 A:0.23723 G:0.18978 position 3: T:0.17883 C:0.33577 A:0.09489 G:0.39051 Average T:0.21655 C:0.27859 A:0.16058 G:0.34428 #5: NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230 position 1: T:0.14234 C:0.25547 A:0.14964 G:0.45255 position 2: T:0.32847 C:0.24453 A:0.23723 G:0.18978 position 3: T:0.17883 C:0.33577 A:0.09489 G:0.39051 Average T:0.21655 C:0.27859 A:0.16058 G:0.34428 #6: NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275 position 1: T:0.14234 C:0.25547 A:0.14964 G:0.45255 position 2: T:0.32847 C:0.24453 A:0.23723 G:0.18978 position 3: T:0.17883 C:0.33577 A:0.09489 G:0.39051 Average T:0.21655 C:0.27859 A:0.16058 G:0.34428 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 18 | Ser S TCT 12 | Tyr Y TAT 0 | Cys C TGT 6 TTC 30 | TCC 30 | TAC 12 | TGC 12 Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0 TTG 42 | TCG 48 | TAG 0 | Trp W TGG 12 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 0 | His H CAT 30 | Arg R CGT 6 CTC 12 | CCC 18 | CAC 30 | CGC 66 CTA 0 | CCA 0 | Gln Q CAA 12 | CGA 12 CTG 108 | CCG 42 | CAG 36 | CGG 42 ------------------------------------------------------------------------------ Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 18 | Ser S AGT 0 ATC 60 | ACC 48 | AAC 18 | AGC 0 ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 6 Met M ATG 18 | ACG 18 | AAG 24 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 36 | Ala A GCT 30 | Asp D GAT 54 | Gly G GGT 60 GTC 60 | GCC 78 | GAC 42 | GGC 36 GTA 12 | GCA 12 | Glu E GAA 48 | GGA 24 GTG 114 | GCG 60 | GAG 48 | GGG 30 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.14234 C:0.25547 A:0.14964 G:0.45255 position 2: T:0.32847 C:0.24453 A:0.23723 G:0.18978 position 3: T:0.17883 C:0.33577 A:0.09489 G:0.39051 Average T:0.21655 C:0.27859 A:0.16058 G:0.34428 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1063.605786 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.667304 1.151864 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907616_1_238_MLBR_RS01170: 0.000004, NC_002677_1_NP_301292_1_164_ML0232: 0.000004, NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760: 0.000004, NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665: 0.000004, NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230: 0.000004, NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.66730 omega (dN/dS) = 1.15186 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 612.5 209.5 1.1519 0.0000 0.0000 0.0 0.0 7..2 0.000 612.5 209.5 1.1519 0.0000 0.0000 0.0 0.0 7..3 0.000 612.5 209.5 1.1519 0.0000 0.0000 0.0 0.0 7..4 0.000 612.5 209.5 1.1519 0.0000 0.0000 0.0 0.0 7..5 0.000 612.5 209.5 1.1519 0.0000 0.0000 0.0 0.0 7..6 0.000 612.5 209.5 1.1519 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1063.605986 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000005 0.000004 0.000004 0.000004 0.000004 0.618892 0.890326 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000025 (1: 0.000004, 2: 0.000005, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907616_1_238_MLBR_RS01170: 0.000004, NC_002677_1_NP_301292_1_164_ML0232: 0.000005, NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760: 0.000004, NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665: 0.000004, NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230: 0.000004, NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.61889 MLEs of dN/dS (w) for site classes (K=2) p: 0.89033 0.10967 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 613.1 208.9 0.1097 0.0000 0.0000 0.0 0.0 7..2 0.000 613.1 208.9 0.1097 0.0000 0.0000 0.0 0.0 7..3 0.000 613.1 208.9 0.1097 0.0000 0.0000 0.0 0.0 7..4 0.000 613.1 208.9 0.1097 0.0000 0.0000 0.0 0.0 7..5 0.000 613.1 208.9 0.1097 0.0000 0.0000 0.0 0.0 7..6 0.000 613.1 208.9 0.1097 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1063.605760 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.610666 0.580618 0.262625 0.000001 1.173854 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907616_1_238_MLBR_RS01170: 0.000004, NC_002677_1_NP_301292_1_164_ML0232: 0.000004, NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760: 0.000004, NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665: 0.000004, NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230: 0.000004, NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.61067 MLEs of dN/dS (w) for site classes (K=3) p: 0.58062 0.26263 0.15676 w: 0.00000 1.00000 1.17385 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 613.3 208.7 0.4466 0.0000 0.0000 0.0 0.0 7..2 0.000 613.3 208.7 0.4466 0.0000 0.0000 0.0 0.0 7..3 0.000 613.3 208.7 0.4466 0.0000 0.0000 0.0 0.0 7..4 0.000 613.3 208.7 0.4466 0.0000 0.0000 0.0 0.0 7..5 0.000 613.3 208.7 0.4466 0.0000 0.0000 0.0 0.0 7..6 0.000 613.3 208.7 0.4466 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907616_1_238_MLBR_RS01170) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907616_1_238_MLBR_RS01170) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:02 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1063.605535 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.791041 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907616_1_238_MLBR_RS01170: 0.000004, NC_002677_1_NP_301292_1_164_ML0232: 0.000004, NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760: 0.000004, NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665: 0.000004, NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230: 0.000004, NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.79104 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:07 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1063.605535 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.290829 1.456239 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907616_1_238_MLBR_RS01170: 0.000004, NC_002677_1_NP_301292_1_164_ML0232: 0.000004, NZ_LVXE01000009_1_WP_010907616_1_2867_A3216_RS04760: 0.000004, NZ_LYPH01000016_1_WP_010907616_1_566_A8144_RS02665: 0.000004, NZ_CP029543_1_WP_010907616_1_238_DIJ64_RS01230: 0.000004, NZ_AP014567_1_WP_010907616_1_247_JK2ML_RS01275: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.29083 (p1 = 0.00001) w = 1.45624 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.45624 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 624.4 197.6 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907616_1_238_MLBR_RS01170) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.105 0.104 0.103 0.101 0.100 0.099 0.098 0.097 0.096 0.096 Time used: 0:12
Model 1: NearlyNeutral -1063.605986 Model 2: PositiveSelection -1063.60576 Model 0: one-ratio -1063.605786 Model 7: beta -1063.605535 Model 8: beta&w>1 -1063.605535 Model 0 vs 1 3.999999998995918E-4 Model 2 vs 1 4.5200000022305176E-4 Model 8 vs 7 0.0